Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= W02G9_3
         (867 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17565000|ref|NP_503727.1| cubilin precursor (31.6 kD) (5D147)...   578   e-164
gi|39592917|emb|CAE62531.1| Hypothetical protein CBG06640 [Caeno...   342   5e-93
gi|27802748|emb|CAD60796.1| SI:bZ1C3.1 (novel protein similar to...   108   1e-22
gi|14388673|gb|AAK61830.1| intrinsic factor-vitamin B12 receptor...   107   3e-22
gi|4557503|ref|NP_001072.1| cubilin; intrinsic factor-cobalamin ...   107   3e-22
gi|47210578|emb|CAF92640.1| unnamed protein product [Tetraodon n...   107   3e-22
gi|47229403|emb|CAF99391.1| unnamed protein product [Tetraodon n...   107   3e-22
gi|34866550|ref|XP_235279.2| similar to CUB and sushi multiple d...   107   3e-22
gi|38045886|ref|NP_443132.2| CUB and Sushi multiple domains 3 is...   107   4e-22
gi|30908445|gb|AAO34702.1| CUB and sushi multiple domains 3 [Hom...   107   4e-22
gi|38604740|sp|Q7Z407|CSM3_HUMAN CUB and sushi multiple domains ...   107   4e-22
gi|38045890|ref|NP_937757.1| CUB and Sushi multiple domains 3 is...   107   4e-22
gi|34330133|dbj|BAC82444.1| CSMD3 protein isoform 2 [Homo sapiens]    107   4e-22
gi|34330131|dbj|BAC82443.1| CSMD3 protein isoform 1 [Homo sapiens]    107   4e-22
gi|38045888|ref|NP_937756.1| CUB and Sushi multiple domains 3 is...   107   4e-22
gi|34327986|dbj|BAB67787.2| KIAA1894 protein [Homo sapiens]           107   4e-22
gi|38604742|sp|Q80T79|CSM3_MOUSE CUB and sushi multiple domains ...   106   8e-22
gi|47229455|emb|CAF99443.1| unnamed protein product [Tetraodon n...   106   8e-22
gi|38077450|ref|XP_139502.3| similar to KIAA1894 protein [Mus mu...   106   8e-22
gi|16758040|ref|NP_445784.1| cubilin [Rattus norvegicus] >gnl|BL...   105   2e-21
gi|50731858|ref|XP_418391.1| PREDICTED: similar to CUB and Sushi...   103   4e-21
gi|16716457|ref|NP_444401.1| CUB and Sushi multiple domains 1 [M...   102   1e-20
gi|7381454|gb|AAF61487.1| cubilin [Mus musculus]                      100   3e-20
gi|47224082|emb|CAG12911.1| unnamed protein product [Tetraodon n...   100   3e-20
gi|38074443|ref|XP_130038.2| cubilin (intrinsic factor-cobalamin...   100   3e-20
gi|47223073|emb|CAG07160.1| unnamed protein product [Tetraodon n...    99   1e-19
gi|6492289|gb|AAF14258.1| cubilin [Canis familiaris]                   99   2e-19
gi|41393595|ref|NP_150094.3| CUB and Sushi multiple domains 1 [H...    99   2e-19
gi|38604975|sp|Q96PZ7|CSM1_HUMAN CUB and sushi multiple domains ...    99   2e-19
gi|34533622|dbj|BAC86754.1| unnamed protein product [Homo sapiens]     98   2e-19
gi|50732417|ref|XP_418626.1| PREDICTED: similar to cubilin [Gall...    98   3e-19
gi|50759800|ref|XP_417788.1| PREDICTED: similar to CUB and sushi...    98   3e-19
gi|47207936|emb|CAF91436.1| unnamed protein product [Tetraodon n...    97   5e-19
gi|48095748|ref|XP_394526.1| similar to ENSANGP00000021200 [Apis...    97   5e-19
gi|4505643|ref|NP_002584.1| procollagen C-endopeptidase enhancer...    97   5e-19
gi|7512178|pir||T30337 polyprotein - African clawed frog >gnl|BL...    96   8e-19
gi|50744878|ref|XP_419917.1| PREDICTED: similar to CUB and Sushi...    96   8e-19
gi|6919941|sp|Q15113|PCO1_HUMAN Procollagen C-proteinase enhance...    95   2e-18
gi|32563523|ref|NP_443128.1| CUB and Sushi multiple domains 2 [H...    95   2e-18
gi|34534755|dbj|BAC87101.1| unnamed protein product [Homo sapiens]     95   2e-18
gi|34871467|ref|XP_232753.2| similar to CUB and sushi multiple d...    94   4e-18
gi|38078814|ref|XP_355522.1| similar to CUB and Sushi multiple d...    94   5e-18
gi|42655792|ref|XP_380176.1| similar to hypothetical protein D03...    93   9e-18
gi|47551167|ref|NP_999763.1| scavenger receptor cysteine-rich pr...    92   1e-17
gi|25152806|ref|NP_510672.2| tolloid-like (107.5 kD) (XR87) [Cae...    92   2e-17
gi|15620839|dbj|BAB67783.1| KIAA1890 protein [Homo sapiens]            92   2e-17
gi|37181456|gb|AAQ88541.1| CSMD1 [Homo sapiens]                        92   2e-17
gi|50732415|ref|XP_418625.1| PREDICTED: similar to cubilin; intr...    91   3e-17
gi|6679221|ref|NP_032814.1| procollagen C-proteinase enhancer pr...    91   3e-17
gi|9506953|ref|NP_062110.1| procollagen C-proteinase enhancer pr...    91   3e-17
gi|6919942|sp|Q61398|PCO1_MOUSE Procollagen C-proteinase enhance...    91   3e-17
gi|50748263|ref|XP_426424.1| PREDICTED: similar to hatching enzy...    91   3e-17
gi|45382677|ref|NP_990034.1| colloid protein [Gallus gallus] >gn...    91   3e-17
gi|46249470|gb|AAH68655.1| MGC81032 protein [Xenopus laevis]           91   3e-17
gi|28804497|dbj|BAC58037.1| neuropilin-2 [Gallus gallus]               90   6e-17
gi|45383570|ref|NP_989615.1| neuropilin 2 [Gallus gallus] >gnl|B...    90   6e-17
gi|14787181|gb|AAG52948.1| CUB and sushi multiple domains protei...    90   6e-17
gi|17226303|gb|AAL37723.1| neuropilin-2a1 receptor [Gallus gallus]     90   6e-17
gi|27924019|gb|AAK73475.2| CUB and sushi multiple domains 1 prot...    90   6e-17
gi|41080642|gb|AAR99509.1| soluble neuropilin 2a1 [Danio rerio]        88   2e-16
gi|47218722|emb|CAG05694.1| unnamed protein product [Tetraodon n...    88   3e-16
gi|48110771|ref|XP_396277.1| similar to CG9138-PA [Apis mellifera]     86   8e-16
gi|47085731|ref|NP_998130.1| neuropilin 2 a; neuropilin 2a [Dani...    86   8e-16
gi|40556950|gb|AAR87832.1| neuropilin 2b [Danio rerio]                 86   8e-16
gi|15277254|dbj|BAB63372.1| oviductin [Bufo japonicus]                 86   8e-16
gi|38074445|ref|XP_140816.3| similar to cubilin; cubilin (intrin...    86   1e-15
gi|34879396|ref|XP_225027.2| similar to CSMD1 [Rattus norvegicus]      86   1e-15
gi|21666355|gb|AAM73675.1| xolloid-like metalloprotease [Xenopus...    86   1e-15
gi|24582396|ref|NP_609091.2| CG9138-PA [Drosophila melanogaster]...    86   1e-15
gi|17531345|ref|NP_494427.1| predicted CDS, c-type lectin and CU...    85   2e-15
gi|2736071|gb|AAB94048.1| procollagen C-proteinase enhancer prot...    85   2e-15
gi|38146363|gb|AAR11554.1| neuropilin 2a [Danio rerio]                 85   2e-15
gi|2736072|gb|AAB94049.1| procollagen C-proteinase enhancer prot...    85   2e-15
gi|34532689|dbj|BAC86505.1| unnamed protein product [Homo sapiens]     84   3e-15
gi|31213165|ref|XP_315526.1| ENSANGP00000021200 [Anopheles gambi...    84   3e-15
gi|17552510|ref|NP_498023.1| predicted CDS, c-type lectin and CU...    84   3e-15
gi|2547130|gb|AAC51788.1| neuropilin-2(a0) [Homo sapiens]              84   3e-15
gi|2547132|gb|AAC51789.1| neuropilin-2(a17) [Homo sapiens]             84   3e-15
gi|41872572|ref|NP_958436.1| neuropilin 2 isoform 3 precursor; v...    84   3e-15
gi|41872533|ref|NP_003863.2| neuropilin 2 isoform 2 precursor; v...    84   3e-15
gi|41872557|ref|NP_957716.1| neuropilin 2 isoform 6 precursor; v...    84   3e-15
gi|41872562|ref|NP_957718.1| neuropilin 2 isoform 1 precursor; v...    84   3e-15
gi|6678363|ref|NP_033416.1| tolloid-like [Mus musculus] >gnl|BL_...    84   3e-15
gi|11907926|gb|AAG41403.1| neuropilin-2b(O) [Homo sapiens]             84   3e-15
gi|41872567|ref|NP_957719.1| neuropilin 2 isoform 5 precursor; v...    84   3e-15
gi|41872544|ref|NP_061004.3| neuropilin 2 isoform 4 precursor; v...    84   3e-15
gi|11907928|gb|AAG41404.1| neuropilin-2b(5) [Homo sapiens]             84   3e-15
gi|13540699|ref|NP_110496.1| neuropilin-2 [Rattus norvegicus] >g...    84   4e-15
gi|2547128|gb|AAC53381.1| neuropilin-2(b5) [Mus musculus]              84   5e-15
gi|47551107|ref|NP_999728.1| bone morphogenetic protein 1 [Stron...    84   5e-15
gi|33469111|ref|NP_035069.1| neuropilin 2 [Mus musculus] >gnl|BL...    84   5e-15
gi|2547122|gb|AAC53378.1| neuropilin-2(a17) [Mus musculus]             84   5e-15
gi|19548766|gb|AAL90780.1| neuropilin-2(a17) [Mus musculus] >gnl...    84   5e-15
gi|9297006|sp|O35375|NRP2_MOUSE Neuropilin-2 precursor (Vascular...    84   5e-15
gi|2547120|gb|AAC53377.1| neuropilin-2(a0) [Mus musculus]              84   5e-15
gi|2547126|gb|AAC53380.1| neuropilin-2(b0) [Mus musculus]              84   5e-15
gi|17537005|ref|NP_496688.1| predicted CDS, c-type lectin and CU...    84   5e-15
gi|7509603|pir||T26655 hypothetical protein Y38E10A.e - Caenorha...    84   5e-15
gi|29612427|gb|AAH49835.1| Similar to deleted in malignant brain...    83   7e-15
gi|6681027|ref|NP_031795.1| deleted in malignant brain tumors 1;...    83   7e-15
gi|39585607|emb|CAE65367.1| Hypothetical protein CBG10312 [Caeno...    83   7e-15
gi|17509297|ref|NP_493166.1| predicted CDS, tolloid like family ...    83   7e-15
gi|7209584|dbj|BAA92266.1| vomeroglandin [Mus musculus]                83   7e-15
gi|7497310|pir||T32326 hypothetical protein C41H7.7 - Caenorhabd...    83   9e-15
gi|32565327|ref|NP_494426.2| c-type lectin and CUB domain contai...    83   9e-15
gi|24899649|emb|CAD56242.1| tolloid-like protein [Crassostrea gi...    83   9e-15
gi|41055076|ref|NP_956754.1| hypothetical protein MGC63590 [Dani...    83   9e-15
gi|32766604|gb|AAH54953.1| MGC64292 protein [Xenopus laevis]           83   9e-15
gi|28302217|gb|AAH46734.1| MGC64292 protein [Xenopus laevis]           83   9e-15
gi|27463046|gb|AAO15690.1| hatching gland-like XheI protein [Xen...    82   1e-14
gi|17559406|ref|NP_506591.1| c-type lectin and CUB domain contai...    82   1e-14
gi|7511720|pir||T31069 tolloid-BMP-1 like protein 1 - California...    82   2e-14
gi|34866475|ref|XP_235273.2| similar to CUB and sushi multiple d...    82   2e-14
gi|17506207|ref|NP_493162.1| c-type lectin and CUB domain contai...    82   2e-14
gi|2695979|emb|CAA70854.1| xolloid [Xenopus laevis]                    81   3e-14
gi|22547221|ref|NP_036596.3| tolloid-like 1 [Homo sapiens] >gnl|...    81   3e-14
gi|9247108|gb|AAF86287.1| tolloid-like protein [Homo sapiens]          81   3e-14
gi|7188780|gb|AAF37867.1| exoskeleton protein RP43 [Riftia pachy...    81   3e-14
gi|47085725|ref|NP_998131.1| neuropilin 2 b; neuropilin 2b [Dani...    81   3e-14
gi|38146365|gb|AAR11555.1| neuropilin 2b [Danio rerio]                 81   3e-14
gi|31873348|emb|CAD97665.1| hypothetical protein [Homo sapiens]        81   3e-14
gi|18859499|ref|NP_571085.1| bone morphogenetic protein 1; tollo...    80   4e-14
gi|24981014|gb|AAH39724.1| Similar to mannan-binding lectin seri...    80   4e-14
gi|439713|dbj|BAA04477.1| precursor of P100 serine protease of R...    80   6e-14
gi|6683456|dbj|BAA89206.1| MASP/P100 [Homo sapiens]                    80   6e-14
gi|21264359|ref|NP_624302.1| mannan-binding lectin serine protea...    80   6e-14
gi|21264357|ref|NP_001870.3| mannan-binding lectin serine protea...    80   6e-14
gi|32564282|ref|NP_493725.2| c-type lectin and CUB domain contai...    80   6e-14
gi|6755807|ref|NP_036034.1| tolloid-like 2 [Mus musculus] >gnl|B...    80   6e-14
gi|38969915|gb|AAH63079.1| Bmp1 protein [Mus musculus]                 80   6e-14
gi|39589890|emb|CAE60888.1| Hypothetical protein CBG04603 [Caeno...    80   6e-14
gi|1345609|sp|P98063|BMP1_MOUSE Bone morphogenetic protein 1 pre...    80   6e-14
gi|42734447|ref|NP_033885.2| bone morphogenetic protein 1 [Mus m...    80   6e-14
gi|34878091|ref|XP_224784.2| similar to mammalian tolloid-like p...    80   8e-14
gi|27370326|ref|NP_766461.1| hypothetical protein D030010E02 [Mu...    80   8e-14
gi|33468666|emb|CAE30401.1| SI:zC237L4.5 (novel protein similar ...    79   1e-13
gi|31377817|ref|NP_852474.1| neuropilin 1 a [Danio rerio] >gnl|B...    79   1e-13
gi|27372291|dbj|BAC53657.1| neuropilin-1 [Danio rerio]                 79   1e-13
gi|38146359|gb|AAR11552.1| neuropilin 1a [Danio rerio]                 79   1e-13
gi|2146870|pir||S72579 hypothetical protein C35D10.1 - Caenorhab...    79   1e-13
gi|17552508|ref|NP_498022.1| c-type lectin and CUB domain contai...    79   1e-13
gi|19860140|sp|P48740|CRAR_HUMAN Complement-activating component...    79   1e-13
gi|3985980|dbj|BAA34864.1| mannose-binding protein associated se...    79   1e-13
gi|2118103|pir||I54763 Ra-reactive factor (EC 3.4.21.-) 1 precur...    79   1e-13
gi|40556948|gb|AAR87831.1| neuropilin 2a [Danio rerio]                 79   2e-13
gi|13623323|gb|AAH06265.1| PCOLCE2 protein [Homo sapiens]              78   3e-13
gi|7019483|ref|NP_037495.1| procollagen C-endopeptidase enhancer...    78   3e-13
gi|37619835|emb|CAB01145.2| Hypothetical protein F08H9.8 [Caenor...    78   3e-13
gi|50749418|ref|XP_421628.1| PREDICTED: similar to tolloid-like ...    77   4e-13
gi|22095011|ref|NP_083896.1| procollagen C-endopeptidase enhance...    77   4e-13
gi|2134176|pir||I51569 UVS.2 protein - African clawed frog (frag...    77   5e-13
gi|2828509|sp|P42664|UVS2_XENLA Embryonic protein UVS.2 precurso...    77   5e-13
gi|32450276|gb|AAH54276.1| Pcolce2-prov protein [Xenopus laevis]       77   5e-13
gi|38044106|ref|NP_937828.1| oviductin protease [Homo sapiens] >...    77   5e-13
gi|5453579|ref|NP_006120.1| bone morphogenetic protein 1 isoform...    77   6e-13
gi|7428249|pir||B58788 procollagen C-endopeptidase (EC 3.4.24.19...    77   6e-13
gi|2695977|emb|CAA70853.1| bone morphogenetic protein 1b [Xenopu...    76   8e-13
gi|19070657|gb|AAL83947.1| procollagen COOH-terminal proteinase ...    76   8e-13
gi|50751642|ref|XP_422492.1| PREDICTED: similar to hypothetical ...    76   8e-13
gi|34327970|dbj|BAA76776.2| KIAA0932 protein [Homo sapiens]            76   1e-12
gi|17506483|ref|NP_493152.1| c-type lectin and CUB domain contai...    76   1e-12
gi|33878312|gb|AAH13871.1| TLL2 protein [Homo sapiens]                 76   1e-12
gi|6912724|ref|NP_036597.1| tolloid-like 2 [Homo sapiens] >gnl|B...    76   1e-12
gi|6678810|ref|NP_032581.1| mannan-binding lectin serine proteas...    75   1e-12
gi|16040962|dbj|BAB69688.1| MBL-associated serine protease-3 [Mu...    75   1e-12
gi|26327451|dbj|BAC27469.1| unnamed protein product [Mus musculus]     75   1e-12
gi|47215317|emb|CAG01622.1| unnamed protein product [Tetraodon n...    75   1e-12
gi|5902811|ref|NP_006121.1| bone morphogenetic protein 1 isoform...    75   2e-12
gi|4502421|ref|NP_001190.1| bone morphogenetic protein 1 isoform...    75   2e-12
gi|10432398|emb|CAC10288.1| dJ947L8.1.3 (novel CUB domain protei...    75   2e-12
gi|5902813|ref|NP_006122.1| bone morphogenetic protein 1 isoform...    75   2e-12
gi|5902808|ref|NP_006119.1| bone morphogenetic protein 1 isoform...    75   2e-12
gi|7512084|pir||S71352 metalloproteinase (EC 3.4.24.-) 10 precur...    75   2e-12
gi|47216316|emb|CAF96612.1| unnamed protein product [Tetraodon n...    75   2e-12
gi|47204841|emb|CAF88849.1| unnamed protein product [Tetraodon n...    74   3e-12
gi|49522356|gb|AAH75353.1| Unknown (protein for MGC:89049) [Xeno...    74   3e-12
gi|47223677|emb|CAF99286.1| unnamed protein product [Tetraodon n...    74   3e-12
gi|1345610|sp|P98070|BMP1_XENLA Bone morphogenetic protein 1 pre...    74   3e-12
gi|7688073|emb|CAB89695.1| mannose-binding protein associated se...    74   3e-12
gi|47087159|ref|NP_998752.1| mannan-binding lectin associated se...    74   3e-12
gi|43429892|gb|AAS46613.1| pancrin [Rattus norvegicus]                 74   4e-12
gi|135912|sp|P25723|TLD_DROME Dorsal-ventral patterning tolloid ...    74   4e-12
gi|33589420|gb|AAQ22477.1| RE25412p [Drosophila melanogaster]          74   4e-12
gi|45549230|ref|NP_524487.2| CG6868-PA [Drosophila melanogaster]...    74   4e-12
gi|17559516|ref|NP_504865.1| c-type lectin and CUB domain contai...    74   5e-12
gi|1209014|dbj|BAA11922.1| Xtld protein [Xenopus laevis]               74   5e-12
gi|30089303|dbj|BAC75886.1| mannose-binding lectin associated se...    73   7e-12
gi|1168684|sp|P42674|BP10_PARLI Blastula protease-10 precursor >...    73   7e-12
gi|34870007|ref|XP_233272.2| similar to hypothetical protein D03...    72   1e-11
gi|10432400|emb|CAC10290.1| dJ947L8.1.1 (novel CUB and Sushi (SC...    72   1e-11
gi|1363286|pir||A57190 ebnerin precursor - rat >gnl|BL_ORD_ID|17...    72   2e-11
gi|23268693|gb|AAN16473.1| DMBT1 4.7 kb transcript variant [Ratt...    72   2e-11
gi|30089305|dbj|BAC75887.1| mannose-binding lectin associated se...    72   2e-11
gi|38194215|dbj|BAD01492.1| tolloid like [Achaearanea tepidariorum]    72   2e-11
gi|16769722|gb|AAL29080.1| LP01328p [Drosophila melanogaster]          72   2e-11
gi|563144|gb|AAA70057.1| tolloid related-1                             72   2e-11
gi|2133650|pir||S58984 development protein tolkin (EC 3.4.24.-) ...    72   2e-11
gi|17136740|ref|NP_476879.1| CG6863-PA [Drosophila melanogaster]...    72   2e-11
gi|31212883|ref|XP_312182.1| ENSANGP00000010271 [Anopheles gambi...    71   4e-11
gi|47551175|ref|NP_999767.1| metalloproteinase SpAN [Strongyloce...    70   5e-11
gi|47214686|emb|CAF97210.1| unnamed protein product [Tetraodon n...    70   5e-11
gi|39580361|emb|CAE61466.1| Hypothetical protein CBG05359 [Caeno...    70   6e-11
gi|38455786|gb|AAR20894.1| complement C1s [Sus scrofa]                 70   6e-11
gi|34555967|emb|CAB16536.2| Hypothetical protein Y70C5C.2 [Caeno...    70   8e-11
gi|27596831|gb|AAO20894.1| tolloid protease-like protein [Ilyana...    70   8e-11
gi|17566216|ref|NP_507227.1| c-type lectin and CUB domain contai...    70   8e-11
gi|37805305|gb|AAH60129.1| Neuropilin [Mus musculus]                   70   8e-11
gi|2852121|gb|AAC02259.1| bone morphogenetic protein 1 [Gallus g...    69   1e-10
gi|26023947|ref|NP_659566.1| neuropilin [Rattus norvegicus] >gnl...    69   1e-10
gi|27527940|emb|CAD32171.1| MASP-3 protein [Rattus norvegicus]         69   1e-10
gi|2407643|gb|AAC53345.1| neuropilin [Rattus norvegicus]               69   1e-10
gi|47225132|emb|CAF98759.1| unnamed protein product [Tetraodon n...    69   1e-10
gi|41149218|ref|XP_372311.1| similar to cubilin; intrinsic facto...    69   1e-10
gi|47087165|ref|NP_998751.1| mannan-binding lectin associated se...    69   1e-10
gi|619861|gb|AAC41710.1| bone morphogenetic protein                    69   1e-10
gi|31615702|pdb|1NT0|A Chain A, Crystal Structure Of The Cub1-Eg...    69   1e-10
gi|7799289|emb|CAB90832.1| mannose-binding protein associated se...    69   1e-10
gi|34872471|ref|XP_342978.1| MASP-2 protein [Rattus norvegicus]        69   1e-10
gi|17559776|ref|NP_507557.1| c-type lectin and CUB domain contai...    69   2e-10
gi|48097714|ref|XP_393866.1| similar to CG6863-PA [Apis mellifera]     68   2e-10
gi|39589896|emb|CAE60894.1| Hypothetical protein CBG04609 [Caeno...    68   2e-10
gi|17559398|ref|NP_506588.1| CUB domain and c-type lectin precur...    68   2e-10
gi|47230755|emb|CAF99948.1| unnamed protein product [Tetraodon n...    68   2e-10
gi|24640838|ref|NP_727348.1| CG32702-PA [Drosophila melanogaster...    68   2e-10
gi|30089307|dbj|BAC75888.1| mannose-binding lectin associated se...    68   3e-10
gi|30089308|dbj|BAC75889.1| mannose-binding lectin associated se...    68   3e-10
gi|6679134|ref|NP_032763.1| neuropilin; Neuropilin-1 [Mus muscul...    68   3e-10
gi|39585604|emb|CAE65364.1| Hypothetical protein CBG10309 [Caeno...    68   3e-10
gi|14043498|gb|AAH07737.1| NRP1 protein [Homo sapiens]                 67   4e-10
gi|33339552|gb|AAQ14300.1| muscle type neuropilin 1 [Homo sapiens]     67   4e-10
gi|11907932|gb|AAG41406.1| neuropilin-1 soluble isoform 11 [Homo...    67   4e-10
gi|6407545|dbj|BAA86867.1| mannose-binding lectin-associated ser...    67   4e-10
gi|31209055|ref|XP_313494.1| ENSANGP00000021251 [Anopheles gambi...    67   4e-10
gi|47219400|emb|CAG01563.1| unnamed protein product [Tetraodon n...    67   4e-10
gi|7271465|gb|AAF44344.1| soluble neuropilin-1 [Homo sapiens] >g...    67   4e-10
gi|38078818|ref|XP_355523.1| similar to CUB and sushi multiple d...    67   4e-10
gi|30584295|gb|AAP36396.1| Homo sapiens neuropilin 1 [synthetic ...    67   4e-10
gi|32331165|gb|AAP80144.1| neuropilin-1 [Homo sapiens]                 67   4e-10
gi|9297107|sp|O14786|NRP1_HUMAN Neuropilin-1 precursor (Vascular...    67   4e-10
gi|2407641|gb|AAC51759.1| neuropilin [Homo sapiens]                    67   4e-10
gi|2978560|gb|AAC12921.1| vascular endothelial cell growth facto...    67   4e-10
gi|41080624|gb|AAR99506.1| soluble neuropilin 1b [Danio rerio]         67   5e-10
gi|50752188|ref|XP_426680.1| PREDICTED: similar to procollagen C...    67   5e-10
gi|45382151|ref|NP_990113.1| neuropilin precursor [Gallus gallus...    67   5e-10
gi|38146361|gb|AAR11553.1| neuropilin 1b [Danio rerio]                 67   5e-10
gi|40748260|gb|AAR89616.1| neuropilin 1b [Danio rerio]                 67   5e-10
gi|17507929|ref|NP_493197.1| c-type lectin and CUB domain contai...    67   5e-10
gi|40254452|ref|NP_003864.2| neuropilin 1 [Homo sapiens] >gnl|BL...    67   5e-10
gi|30520377|ref|NP_071317.2| CUB and zona pellucida-like domains...    67   5e-10
gi|4996234|dbj|BAA78381.1| truncated form of mannose-binding lec...    67   7e-10
gi|45387759|ref|NP_991237.1| neuropilin 1 b; neuropilin 1b [Dani...    67   7e-10
gi|26005769|dbj|BAC41340.1| mannose-binding lectin-associated se...    67   7e-10
gi|28395795|ref|NP_071593.1| mannose-binding protein associated ...    66   9e-10
gi|10432396|emb|CAC10286.1| dJ947L8.1.5 (novel CUB domain protei...    66   9e-10
gi|39596329|emb|CAE69967.1| Hypothetical protein CBG16363 [Caeno...    66   1e-09
gi|50729444|ref|XP_416518.1| PREDICTED: similar to Complement C1...    65   1e-09
gi|47228129|emb|CAF97758.1| unnamed protein product [Tetraodon n...    65   1e-09
gi|7512176|pir||T30338 oviductin (EC 3.4.21.-) - African clawed ...    65   1e-09
gi|38078816|ref|XP_131674.2| similar to CUB and Sushi multiple d...    65   2e-09
gi|32566786|ref|NP_506587.2| c-type lectin and CUB domain contai...    65   2e-09
gi|47218721|emb|CAG05693.1| unnamed protein product [Tetraodon n...    65   2e-09
gi|47226850|emb|CAG06692.1| unnamed protein product [Tetraodon n...    65   2e-09
gi|39589891|emb|CAE60889.1| Hypothetical protein CBG04604 [Caeno...    65   3e-09
gi|2852123|gb|AAC02260.1| Tolloid [Gallus gallus]                      65   3e-09
gi|17552872|ref|NP_497813.1| extracellular CUB domain containing...    65   3e-09
gi|47224080|emb|CAG12909.1| unnamed protein product [Tetraodon n...    65   3e-09
gi|39585606|emb|CAE65366.1| Hypothetical protein CBG10311 [Caeno...    64   3e-09
gi|10432394|emb|CAC10284.1| dJ947L8.1.7 (novel CUB domain protei...    64   3e-09
gi|27462728|gb|AAO15558.1| complement component C1sa [Mus musculus]    64   3e-09
gi|21450097|ref|NP_659187.1| complement component 1, s subcompon...    64   3e-09
gi|4502495|ref|NP_001725.1| complement component 1, s subcompone...    64   4e-09
gi|27462724|gb|AAO15556.1| complement component C1SA [Mus musculus]    64   4e-09
gi|20302095|ref|NP_620255.1| complement component 1, s subcompon...    64   4e-09
gi|26352560|dbj|BAC39910.1| unnamed protein product [Mus musculus]     64   4e-09
gi|6407558|dbj|BAA86864.1| complement C1s [Homo sapiens]               64   4e-09
gi|50749889|ref|XP_421801.1| PREDICTED: similar to CRP-ductin-al...    64   4e-09
gi|7495300|pir||T32032 hypothetical protein C03H5.1 - Caenorhabd...    64   4e-09
gi|85699|pir||JQ0948 A5 antigen precursor - African clawed frog ...    64   6e-09
gi|7506171|pir||T23853 hypothetical protein R02D5.2 - Caenorhabd...    64   6e-09
gi|39581281|emb|CAE60027.1| Hypothetical protein CBG03533 [Caeno...    64   6e-09
gi|39593191|emb|CAE64660.1| Hypothetical protein CBG09432 [Caeno...    64   6e-09
gi|49119094|gb|AAH73178.1| Unknown (protein for MGC:79894) [Xeno...    64   6e-09
gi|112932|sp|P28824|NRP1_XENLA Neuropilin-1 precursor (A5 protei...    64   6e-09
gi|47225569|emb|CAG12052.1| unnamed protein product [Tetraodon n...    63   7e-09
gi|39583858|emb|CAE63948.1| Hypothetical protein CBG08530 [Caeno...    63   7e-09
gi|38303991|gb|AAH62042.1| Complement component 1, s subcomponen...    63   1e-08
gi|6407538|dbj|BAA86866.1| mannose-binding protein-associated se...    63   1e-08
gi|3724122|emb|CAA09096.1| hypothetical protein [Mus musculus]         63   1e-08
gi|26005767|dbj|BAC41339.1| mannose-binding lectin-associated se...    63   1e-08
gi|50748091|ref|XP_421101.1| PREDICTED: similar to astacin like ...    62   1e-08
gi|20073175|gb|AAH27183.1| Similar to complement component 1, s ...    62   1e-08
gi|50729868|ref|XP_425539.1| PREDICTED: similar to enteropeptida...    62   1e-08
gi|1589367|prf||2211228A enteropeptidase                               62   2e-08
gi|15530225|gb|AAH13893.1| Masp2 protein [Mus musculus] >gnl|BL_...    62   2e-08
gi|3928517|dbj|BAA34674.1| mannose-binding lectin associated ser...    62   2e-08
gi|34867472|ref|XP_213668.2| similar to enteropeptidase [Rattus ...    62   2e-08
gi|6688733|emb|CAB65250.1| mannose binding lectin-associated ser...    62   2e-08
gi|39589889|emb|CAE60887.1| Hypothetical protein CBG04602 [Caeno...    62   2e-08
gi|31982080|ref|NP_776110.2| regeneration associated muscle prot...    62   2e-08
gi|26352936|dbj|BAC40098.1| unnamed protein product [Mus musculus]     62   2e-08
gi|17537003|ref|NP_496687.1| CUB Sushi multiple domains 1 family...    62   2e-08
gi|50749895|ref|XP_421804.1| PREDICTED: similar to CUB and zona ...    62   2e-08
gi|48095617|ref|XP_394492.1| similar to ENSANGP00000021959 [Apis...    61   3e-08
gi|27805393|ref|NP_776289.1| complement component C1SB [Mus musc...    61   3e-08
gi|47216482|emb|CAG02133.1| unnamed protein product [Tetraodon n...    61   3e-08
gi|47223519|emb|CAF98006.1| unnamed protein product [Tetraodon n...    61   3e-08
gi|31237924|ref|XP_319692.1| ENSANGP00000021959 [Anopheles gambi...    61   3e-08
gi|30578425|ref|NP_849186.1| protease, serine, 7 (enterokinase);...    61   4e-08
gi|26332511|dbj|BAC29973.1| unnamed protein product [Mus musculus]     61   4e-08
gi|6407531|dbj|BAA86865.1| mannose-binding protein-associated se...    61   4e-08
gi|26349171|dbj|BAC38225.1| unnamed protein product [Mus musculus]     61   4e-08
gi|21264363|ref|NP_006601.2| mannan-binding lectin serine protea...    61   4e-08
gi|26350603|dbj|BAC38938.1| unnamed protein product [Mus musculus]     61   4e-08
gi|7387859|sp|O00187|MAS2_HUMAN Mannan-binding lectin serine pro...    61   4e-08
gi|12276136|gb|AAG50274.1| MBL-associated serine protease 2 [Hom...    61   4e-08
gi|5459324|emb|CAB50733.1| MASP-2 protein [Homo sapiens] >gnl|BL...    61   4e-08
gi|38089384|ref|XP_134498.3| neuropilin- and tolloid-like protei...    61   4e-08
gi|34863203|ref|XP_236179.2| similar to membrane-type frizzled-r...    61   4e-08
gi|6679489|ref|NP_032967.1| protease, serine, 7 (enterokinase); ...    61   4e-08
gi|31981500|ref|NP_067261.2| seizure related gene 6 [Mus musculu...    61   4e-08
gi|4502493|ref|NP_001724.1| complement component 1, r subcompone...    61   4e-08
gi|47223422|emb|CAG04283.1| unnamed protein product [Tetraodon n...    60   5e-08
gi|17557350|ref|NP_506271.1| c-type lectin and CUB domain contai...    60   5e-08
gi|39589888|emb|CAE60886.1| Hypothetical protein CBG04601 [Caeno...    60   6e-08
gi|26342266|dbj|BAC34795.1| unnamed protein product [Mus musculus]     60   6e-08
gi|34856588|ref|XP_230325.2| similar to E430002G05Rik protein [R...    60   6e-08
gi|47187593|emb|CAF88390.1| unnamed protein product [Tetraodon n...    60   6e-08
gi|17540462|ref|NP_500454.1| c-type lectin and low density lipop...    60   8e-08
gi|17559402|ref|NP_506589.1| c-type lectin and CUB domain contai...    60   8e-08
gi|47217067|emb|CAG02378.1| unnamed protein product [Tetraodon n...    60   8e-08
gi|47213002|emb|CAF95394.1| unnamed protein product [Tetraodon n...    59   1e-07
gi|49257232|gb|AAH71077.1| St14-A-prov protein [Xenopus laevis]        59   1e-07
gi|21740001|emb|CAD39019.1| hypothetical protein [Homo sapiens]        59   1e-07
gi|29835268|gb|AAH51145.1| Neuropilin- and tolloid-like protein ...    59   1e-07
gi|20373181|ref|NP_620416.1| neuropilin- and tolloid-like protei...    59   1e-07
gi|20269724|gb|AAM18028.1| neuropilin and tolloid like-1 [Mus mu...    59   1e-07
gi|23510396|ref|NP_694821.2| neuropilin- and tolloid-like protei...    59   1e-07
gi|115204|sp|P00736|C1R_HUMAN Complement C1r subcomponent precur...    59   1e-07
gi|17566556|ref|NP_506157.1| cubilin (5N107) [Caenorhabditis ele...    59   1e-07
gi|50753731|ref|XP_414109.1| PREDICTED: similar to neuropilin- a...    59   1e-07
gi|50736281|ref|XP_419104.1| PREDICTED: similar to neuropilin- a...    59   1e-07
gi|17507729|ref|NP_493109.1| predicted CDS, c-type lectin and CU...    59   1e-07
gi|47212995|emb|CAF96698.1| unnamed protein product [Tetraodon n...    59   1e-07
gi|24041026|ref|NP_060562.3| neuropilin- and tolloid-like protei...    59   1e-07
gi|47220867|emb|CAG03074.1| unnamed protein product [Tetraodon n...    59   1e-07
gi|41680635|ref|NP_963840.1| hypothetical protein LOC200008 [Hom...    59   2e-07
gi|115676|sp|P15156|CASP_MESAU Calcium-dependent serine proteina...    59   2e-07
gi|7716870|gb|AAF68585.1| tolloid [Drosophila simulans]                59   2e-07
gi|7716880|gb|AAF68590.1| tolloid [Drosophila simulans]                59   2e-07
gi|7716872|gb|AAF68586.1| tolloid [Drosophila simulans]                59   2e-07
gi|7716882|gb|AAF68591.1| tolloid [Drosophila simulans]                59   2e-07
gi|7716878|gb|AAF68589.1| tolloid [Drosophila simulans]                59   2e-07
gi|47207564|emb|CAF96210.1| unnamed protein product [Tetraodon n...    59   2e-07
gi|7716874|gb|AAF68587.1| tolloid [Drosophila simulans]                59   2e-07
gi|7716876|gb|AAF68588.1| tolloid [Drosophila simulans]                59   2e-07
gi|39587832|emb|CAE67850.1| Hypothetical protein CBG13437 [Caeno...    59   2e-07
gi|24641790|ref|NP_727708.1| CG32635-PA [Drosophila melanogaster...    59   2e-07
gi|1168541|sp|P42662|ASTL_COTJA Astacin like metalloendopeptidas...    58   2e-07
gi|31874185|emb|CAD97994.1| hypothetical protein [Homo sapiens]        58   2e-07
gi|1332377|gb|AAB00792.1| adhesion receptor CD44                       58   3e-07
gi|1351315|sp|P98066|TSG6_HUMAN Tumor necrosis factor-inducible ...    58   3e-07
gi|26051243|ref|NP_009046.2| tumor necrosis factor, alpha-induce...    58   3e-07
gi|17508029|ref|NP_491159.1| predicted CDS, neuropilin- tolloid-...    58   3e-07
gi|26343591|dbj|BAC35452.1| unnamed protein product [Mus musculus]     58   3e-07
gi|627699|pir||A53663 enteropeptidase (EC 3.4.21.9) precursor - pig    58   3e-07
gi|47575834|ref|NP_001001259.1| enteropeptidase, light chain (L ...    58   3e-07
gi|47229456|emb|CAF99444.1| unnamed protein product [Tetraodon n...    58   3e-07
gi|42523126|ref|NP_968506.1| putative RTX family exoprotein [Bde...    58   3e-07
gi|20452470|ref|NP_620552.1| neuropilin- and tolloid-like protei...    58   3e-07
gi|31559952|ref|NP_659195.2| neuropilin- and tolloid-like protei...    58   3e-07
gi|39583725|emb|CAE63829.1| Hypothetical protein CBG08382 [Caeno...    58   3e-07
gi|22128653|ref|NP_667337.1| membrane-type frizzled-related prot...    58   3e-07
gi|17559404|ref|NP_506590.1| CUB domain and c-type lectin precur...    58   3e-07
gi|4519515|dbj|BAA75639.1| procollagen C-proteinase 3 [Rattus no...    57   4e-07
gi|30578414|ref|NP_849191.1| seizure related 6 homolog [Homo sap...    57   4e-07
gi|21740104|emb|CAD39067.1| hypothetical protein [Homo sapiens]        57   4e-07
gi|21749913|dbj|BAC03684.1| unnamed protein product [Homo sapiens]     57   4e-07
gi|13899255|ref|NP_113621.1| membrane frizzled-related protein; ...    57   4e-07
gi|16549794|dbj|BAB70859.1| unnamed protein product [Homo sapiens]     57   4e-07
gi|50748042|ref|XP_421084.1| PREDICTED: similar to ELGC699 [Gall...    57   5e-07
gi|27462726|gb|AAO15557.1| complement component C1rb [Mus musculus]    57   5e-07
gi|13435522|gb|AAH04637.1| Complement component 1, r subcomponen...    57   5e-07
gi|47605363|sp|Q8CG16|C1R_MOUSE Complement C1r subcomponent prec...    57   5e-07
gi|12963529|ref|NP_075632.1| complement component 1, r subcompon...    57   5e-07
gi|50749891|ref|XP_421802.1| PREDICTED: similar to hensin [Gallu...    57   7e-07
gi|50794515|ref|XP_428014.1| PREDICTED: similar to CRP-ductin-al...    57   7e-07
gi|38077498|ref|XP_356803.1| similar to CUB and Sushi multiple d...    57   7e-07
gi|19527647|gb|AAL89938.1| SD01877p [Drosophila melanogaster]          56   9e-07
gi|29791610|gb|AAH50329.1| NETO1 protein [Homo sapiens]                56   9e-07
gi|34872800|ref|XP_239260.2| similar to Seizure related gene 6 [...    56   1e-06
gi|34364726|emb|CAE45808.1| hypothetical protein [Homo sapiens]        56   1e-06
gi|50659100|ref|NP_001001991.1| regeneration associated muscle p...    56   1e-06
gi|14042814|dbj|BAB55404.1| unnamed protein product [Homo sapiens]     56   1e-06
gi|50659098|ref|NP_056245.2| regeneration associated muscle prot...    56   1e-06
gi|47551295|ref|NP_999830.1| egg bindin receptor 1 [Strongylocen...    55   2e-06
gi|16930101|dbj|BAB72012.1| attractin [Mesocricetus auratus]           55   2e-06
gi|50798883|ref|XP_424040.1| PREDICTED: similar to hypothetical ...    55   2e-06
gi|6678379|ref|NP_033424.1| tumor necrosis factor alpha induced ...    55   2e-06
gi|9757702|dbj|BAB08218.1| homolog of human MT-SP1 [Xenopus laevis]    55   2e-06
gi|39587831|emb|CAE67849.1| Hypothetical protein CBG13436 [Caeno...    55   2e-06
gi|16215729|dbj|BAB69961.1| bone morphogenetic protein 1 [Rattus...    55   2e-06
gi|6753146|ref|NP_033860.1| attractin [Mus musculus] >gnl|BL_ORD...    55   2e-06
gi|13431313|sp|Q9WU60|ATRN_MOUSE Attractin precursor (Mahogany p...    55   2e-06
gi|7513558|pir||T30549 hensin - rabbit >gnl|BL_ORD_ID|1357646 gi...    55   2e-06
gi|21450863|ref|NP_647538.1| attractin isoform 2; attractin-2; m...    55   3e-06
gi|8118083|gb|AAF72882.1| secreted attractin precursor [Homo sap...    55   3e-06
gi|1351316|sp|P98065|TSG6_RABIT Tumor necrosis factor-inducible ...    55   3e-06
gi|38087459|ref|XP_355949.1| similar to deleted in malignant bra...    55   3e-06
gi|21450848|ref|NP_036202.2| attractin isoform 3; attractin-2; m...    55   3e-06
gi|3676347|gb|AAC61902.1| Attractin; DPPT-L [Homo sapiens]             55   3e-06
gi|7711012|emb|CAB90288.1| dJ581P3.2 (attractin (with dipeptidyl...    55   3e-06
gi|8118082|gb|AAF72881.1| membrane attractin precursor [Homo sap...    55   3e-06
gi|21450861|ref|NP_647537.1| attractin isoform 1; attractin-2; m...    55   3e-06
gi|5916203|gb|AAD55939.1| estrogen-regulated protein [Rattus nor...    55   3e-06
gi|16758922|ref|NP_446457.1| integral membrane-associated protei...    55   3e-06
gi|47217103|emb|CAG02604.1| unnamed protein product [Tetraodon n...    54   3e-06
gi|7498680|pir||T20617 hypothetical protein F08H9.6 - Caenorhabd...    54   3e-06
gi|49900216|gb|AAH76994.1| Unknown (protein for MGC:89623) [Xeno...    54   3e-06
gi|5912464|emb|CAB56155.1| DMBT1/8kb.2 protein [Homo sapiens]          54   3e-06
gi|17567501|ref|NP_509883.1| predicted CDS, neuropilin (XL898) [...    54   4e-06
gi|12275312|dbj|BAB21018.1| attractin [Rattus norvegicus]              54   4e-06
gi|39580744|emb|CAE64130.1| Hypothetical protein CBG08746 [Caeno...    54   4e-06
gi|34013516|ref|NP_766496.2| oviductin precursor; oviductin [Mus...    54   4e-06
gi|46405366|emb|CAF31497.1| Hypothetical protein Y105E8A.7b [Cae...    54   4e-06
gi|11993941|ref|NP_032437.2| CUB and zona pellucida-like domains...    54   4e-06
gi|18376552|emb|CAD21658.1| Hypothetical protein Y105E8A.7a [Cae...    54   4e-06
gi|13786196|ref|NP_112641.1| attractin [Rattus norvegicus] >gnl|...    54   4e-06
gi|47211322|emb|CAF96187.1| unnamed protein product [Tetraodon n...    54   4e-06
gi|7500773|pir||T21946 hypothetical protein F38B2.3 - Caenorhabd...    54   4e-06
gi|26329465|dbj|BAC28471.1| unnamed protein product [Mus musculus]     54   4e-06
gi|2055305|dbj|BAA19763.1| AsMASPb [Halocynthia roretzi]               54   6e-06
gi|26005773|dbj|BAC41342.1| mannose-binding lectin-associated se...    54   6e-06
gi|14349287|dbj|BAB60718.1| proacrosin [Halocynthia roretzi]           54   6e-06
gi|38086533|ref|XP_194337.2| similar to EGF domain-containing pr...    54   6e-06
gi|30173102|sp|Q90Y90|KRM1_XENLA Kremen protein 1 precursor (Kri...    54   6e-06
gi|4093196|gb|AAD03057.1| attractin-2 [Homo sapiens]                   53   8e-06
gi|50747712|ref|XP_420957.1| PREDICTED: similar to cytochrome b5...    53   8e-06
gi|6689101|emb|CAB65389.1| MASP-2 protein [Rattus norvegicus]          53   8e-06
gi|34860189|ref|XP_219319.2| similar to scavenger receptor cyste...    53   8e-06
gi|8923740|ref|NP_060049.1| deleted in malignant brain tumors 1 ...    53   8e-06
gi|34365344|emb|CAE45995.1| hypothetical protein [Homo sapiens]        53   8e-06
gi|6624920|emb|CAB63941.1| DMBT1 prototype [Homo sapiens]              53   8e-06
gi|4758170|ref|NP_004397.1| deleted in malignant brain tumors 1 ...    53   8e-06
gi|4996278|dbj|BAA78577.1| DMBT1 [Homo sapiens]                        53   8e-06
gi|6633801|ref|NP_015568.1| deleted in malignant brain tumors 1 ...    53   8e-06
gi|14715231|emb|CAC44122.1| DMBT1/8kb.2 protein [Homo sapiens]         53   8e-06
gi|2055303|dbj|BAA19762.1| AsMASPa [Halocynthia roretzi]               53   1e-05
gi|26005771|dbj|BAC41341.1| mannose-binding lectin-associated se...    53   1e-05
gi|39581873|emb|CAE60767.1| Hypothetical protein CBG04455 [Caeno...    53   1e-05
gi|27806737|ref|NP_776420.1| attractin [Bos taurus] >gnl|BL_ORD_...    53   1e-05
gi|50749835|ref|XP_421777.1| PREDICTED: similar to attractin-lik...    52   1e-05
gi|47219584|emb|CAG02290.1| unnamed protein product [Tetraodon n...    52   1e-05
gi|6689089|emb|CAB65383.1| MASP-2 protein [Rattus norvegicus]          52   2e-05
gi|6822243|emb|CAB70973.1| MASP-2 protein [Rattus norvegicus]          52   2e-05
gi|4585307|gb|AAD25372.1| attractin [Mus musculus]                     52   2e-05
gi|2209345|gb|AAB65832.1| Ra-reactive factor serine protease p10...    52   2e-05
gi|17560376|ref|NP_508027.1| bone morphogenetic protein 1 family...    52   2e-05
gi|30424770|ref|NP_780375.1| RIKEN cDNA 5430419D17 [Mus musculus...    51   3e-05
gi|47216046|emb|CAG11377.1| unnamed protein product [Tetraodon n...    51   3e-05
gi|47218517|emb|CAF98049.1| unnamed protein product [Tetraodon n...    51   3e-05
gi|24648095|ref|NP_732390.1| CG31149-PA [Drosophila melanogaster...    51   3e-05
gi|34871459|ref|XP_345583.1| similar to CUB and sushi multiple d...    51   3e-05
gi|7498330|pir||T20428 hypothetical protein E03A3.5 - Caenorhabd...    51   4e-05
gi|17541878|ref|NP_501918.1| extracellular CUB domain containing...    51   4e-05
gi|12314084|emb|CAC05321.1| dJ1007G16.2 (novel CUB domain protei...    51   4e-05
gi|4039157|gb|AAC97514.1| similar to Homo sapiens DMBT1 [Macaca ...    51   4e-05
gi|24582674|ref|NP_609180.2| CG7466-PA [Drosophila melanogaster]...    50   5e-05
gi|47212344|emb|CAF94956.1| unnamed protein product [Tetraodon n...    50   5e-05
gi|5459418|emb|CAB50738.1| mannose binding lectin-associated ser...    50   5e-05
gi|27806097|ref|NP_776864.1| protease, serine, 7 [enterokinase] ...    50   5e-05
gi|34879457|ref|XP_344547.1| similar to CSMD1 [Rattus norvegicus]      50   5e-05
gi|47222331|emb|CAG05080.1| unnamed protein product [Tetraodon n...    50   6e-05
gi|50428577|ref|NP_001002268.1| RIKEN cDNA 1190004A11 gene; deve...    50   6e-05
gi|48095504|ref|XP_394461.1| similar to CG31149-PA [Apis mellifera]    50   6e-05
gi|50756527|ref|XP_415197.1| PREDICTED: similar to Seizure 6-lik...    50   6e-05
gi|47224752|emb|CAG00346.1| unnamed protein product [Tetraodon n...    50   6e-05
gi|38090959|ref|XP_136924.2| similar to putative vascular induci...    50   6e-05
gi|47221353|emb|CAF97271.1| unnamed protein product [Tetraodon n...    50   6e-05
gi|28838364|gb|AAH47716.1| ATRNL1 protein [Homo sapiens]               50   8e-05
gi|4506151|ref|NP_002763.1| enterokinase precursor; proenterokin...    50   8e-05
gi|7768763|dbj|BAA95557.1| enterokinase [Homo sapiens]                 50   8e-05
gi|47229457|emb|CAF99445.1| unnamed protein product [Tetraodon n...    50   8e-05
gi|42659385|ref|XP_049349.11| KIAA0534 protein [Homo sapiens] >g...    50   8e-05
gi|10800564|emb|CAC12966.1| bA338L11.1 (novel CUB domain protein...    50   8e-05
gi|20988615|gb|AAH29658.1| DCBLD2 protein [Homo sapiens]               50   8e-05
gi|21314772|ref|NP_563615.2| discoidin, CUB and LCCL domain cont...    50   8e-05
gi|16902435|gb|AAL30178.1| endothelial and smooth muscle cell-de...    50   8e-05
gi|50729442|ref|XP_416517.1| PREDICTED: similar to Complement C1...    49   1e-04
gi|39586019|emb|CAE69095.1| Hypothetical protein CBG15117 [Caeno...    49   1e-04
gi|45645033|gb|AAS73181.1| MAp19 [Gallus gallus]                       49   1e-04
gi|704441|dbj|BAA18909.1| unknown [Homo sapiens]                       49   1e-04
gi|50510519|dbj|BAD32245.1| mKIAA0534 protein [Mus musculus]           49   1e-04
gi|34864835|ref|XP_217657.2| similar to bA338L11.1 (novel CUB do...    49   1e-04
gi|50355941|ref|NP_940971.1| G protein-coupled receptor 126 beta...    49   1e-04
gi|37620169|ref|NP_065188.3| G protein-coupled receptor 126; dev...    49   1e-04
gi|50251164|dbj|BAD27571.1| developmentally regulated G-protein-...    49   1e-04
gi|34365166|emb|CAE45930.1| hypothetical protein [Homo sapiens]        49   1e-04
gi|50756555|ref|XP_415211.1| PREDICTED: similar to KREMEN1 prote...    49   1e-04
gi|47216228|emb|CAG01262.1| unnamed protein product [Tetraodon n...    49   1e-04
gi|26449263|dbj|BAC41759.1| hypothetical protein [Macaca fascicu...    49   1e-04


>gi|17565000|ref|NP_503727.1| cubilin precursor (31.6 kD) (5D147)
           [Caenorhabditis elegans]
 gi|7508857|pir||T33224 hypothetical protein W02G9.4 -
           Caenorhabditis elegans
 gi|3165568|gb|AAC17682.1| Hypothetical protein W02G9.4
           [Caenorhabditis elegans]
          Length = 288

 Score =  578 bits (1490), Expect = e-164
 Identities = 288/288 (100%), Positives = 288/288 (100%)
 Frame = +1

Query: 1   MKLVILLSFLALCRAQHLNFDGATGKLYSPNYPGNYDNNGDVVYTITIPVGNYIHLTFLD 180
           MKLVILLSFLALCRAQHLNFDGATGKLYSPNYPGNYDNNGDVVYTITIPVGNYIHLTFLD
Sbjct: 1   MKLVILLSFLALCRAQHLNFDGATGKLYSPNYPGNYDNNGDVVYTITIPVGNYIHLTFLD 60

Query: 181 FLTEDSYDVLTIENSTTVSGDKTGFALDIQASQVTLVFTSDLTNTFRGFLIRYDSVPVGS 360
           FLTEDSYDVLTIENSTTVSGDKTGFALDIQASQVTLVFTSDLTNTFRGFLIRYDSVPVGS
Sbjct: 61  FLTEDSYDVLTIENSTTVSGDKTGFALDIQASQVTLVFTSDLTNTFRGFLIRYDSVPVGS 120

Query: 361 VYMPTNLCSSILHNSEFDIITSPNFPYNYPDNISCAFLIKVSADRLISFQFVAFNTEDGY 540
           VYMPTNLCSSILHNSEFDIITSPNFPYNYPDNISCAFLIKVSADRLISFQFVAFNTEDGY
Sbjct: 121 VYMPTNLCSSILHNSEFDIITSPNFPYNYPDNISCAFLIKVSADRLISFQFVAFNTEDGY 180

Query: 541 DVVSVYDGANTSAPLIGHYSGKNMPAPITSTSNTLYLCFSSDLVTNFSGFSGLYTSFVSN 720
           DVVSVYDGANTSAPLIGHYSGKNMPAPITSTSNTLYLCFSSDLVTNFSGFSGLYTSFVSN
Sbjct: 181 DVVSVYDGANTSAPLIGHYSGKNMPAPITSTSNTLYLCFSSDLVTNFSGFSGLYTSFVSN 240

Query: 721 NFKRGVLPQSLTTDSVAIRRDKNILDWLKKKAEEKKLIGAAAAPVISI 864
           NFKRGVLPQSLTTDSVAIRRDKNILDWLKKKAEEKKLIGAAAAPVISI
Sbjct: 241 NFKRGVLPQSLTTDSVAIRRDKNILDWLKKKAEEKKLIGAAAAPVISI 288




[DB home][top]