Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= W03C9_5
(630 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17536699|ref|NP_496549.1| RAB family member (23.4 kD) (rab-7)... 375 e-103
gi|33621866|gb|AAQ23388.1| Rab7 [Aiptasia pulchella] 286 2e-76
gi|31242103|ref|XP_321482.1| ENSANGP00000018151 [Anopheles gambi... 285 7e-76
gi|31196841|ref|XP_307368.1| ENSANGP00000013739 [Anopheles gambi... 285 7e-76
gi|49078824|ref|XP_403126.1| RAB7_NEUCR Probable Ras-related pro... 283 3e-75
gi|50345016|ref|NP_001002178.1| zgc:91909 [Danio rerio] >gnl|BL_... 282 3e-75
gi|50255530|gb|EAL18265.1| hypothetical protein CNBK2830 [Crypto... 282 3e-75
gi|47229587|emb|CAG06783.1| unnamed protein product [Tetraodon n... 282 4e-75
gi|41055538|ref|NP_957222.1| RAB family member rab-7 [Danio reri... 281 7e-75
gi|548667|sp|P36411|RAB7_DICDI Ras-related protein Rab7 >gnl|BL_... 281 1e-74
gi|34147513|ref|NP_004628.4| RAB7, member RAS oncogene family; R... 280 2e-74
gi|13027392|ref|NP_076440.1| RAB7, member RAS oncogene family [R... 280 2e-74
gi|131797|sp|P18067|RAB7_CANFA Ras-related protein Rab-7 >gnl|BL... 280 2e-74
gi|1174149|gb|AAA86640.1| small GTP binding protein Rab7 [Homo s... 280 2e-74
gi|50754381|ref|XP_414359.1| PREDICTED: similar to Ras-related p... 279 3e-74
gi|17865835|ref|NP_524472.1| CG5915-PA [Drosophila melanogaster]... 279 4e-74
gi|6679599|ref|NP_033031.1| RAB7, member RAS oncogene family [Mu... 279 4e-74
gi|30024664|gb|AAP13582.1| Ras-related protein Rab7 [Lentinula e... 278 5e-74
gi|4105819|gb|AAD02565.1| Rab7 [Homo sapiens] 278 6e-74
gi|38014729|gb|AAH60401.1| MGC68523 protein [Xenopus laevis] 277 1e-73
gi|50414980|gb|AAH77884.1| Unknown (protein for MGC:80674) [Xeno... 275 5e-73
gi|92022|pir||S01934 GTP-binding protein, 23K - rat 273 2e-72
gi|47218980|emb|CAG02018.1| unnamed protein product [Tetraodon n... 273 3e-72
gi|32404800|ref|XP_323013.1| hypothetical protein [Neurospora cr... 271 8e-72
gi|38111623|gb|EAA57175.1| hypothetical protein MG08144.4 [Magna... 270 2e-71
gi|6685839|sp|O97572|RAB7_RABIT Ras-related protein Rab-7 >gnl|B... 268 5e-71
gi|19918938|dbj|BAB88682.1| small GTPase AvaA [Aspergillus nidul... 268 5e-71
gi|46121525|ref|XP_385317.1| RAB7_NEUCR Probable Ras-related pro... 267 1e-70
gi|3914539|sp|P93267|RAB7_MESCR Ras-related protein Rab7A >gnl|B... 258 9e-68
gi|3914557|sp|Q40787|RAB7_PENCL Ras-related protein Rab7 (Possib... 258 9e-68
gi|3914550|sp|O24461|RAB7_PRUAR Ras-related protein Rab7 >gnl|BL... 257 1e-67
gi|1370188|emb|CAA98171.1| RAB7D [Lotus corniculatus var. japoni... 257 1e-67
gi|15218194|ref|NP_175638.1| Ras-related GTP-binding protein, pu... 257 1e-67
gi|7388049|sp|Q9XER8|RAB7_GOSHI Ras-related protein Rab7 >gnl|BL... 256 2e-67
gi|49083980|ref|XP_404226.1| RAB7_NEUCR Probable Ras-related pro... 256 2e-67
gi|46575953|gb|AAT01314.1| putative GTP-binding protein Rab7a [O... 256 2e-67
gi|34904236|ref|NP_913465.1| RAS-related GTP-binding protein Rab... 256 2e-67
gi|34484308|gb|AAQ72787.1| putative GTP-binding protein [Cucumis... 256 3e-67
gi|29293694|gb|AAO67728.1| small GTP binding protein [Oryza sati... 256 3e-67
gi|15222098|ref|NP_175355.1| Ras-related GTP-binding protein, pu... 256 3e-67
gi|1370186|emb|CAA98170.1| RAB7C [Lotus corniculatus var. japoni... 254 1e-66
gi|400923|sp|P31022|RAB7_PEA Ras-related protein Rab7 >gnl|BL_OR... 254 1e-66
gi|34559282|gb|AAL08054.2| Rab7 protein [Paramecium aurelia] 253 2e-66
gi|2500075|sp|Q39573|YPT5_CHLRE GTP-binding protein YPTC5 >gnl|B... 253 2e-66
gi|19113099|ref|NP_596307.1| rab protein; involved in endocytosi... 253 3e-66
gi|15233284|ref|NP_188231.1| Ras-related GTP-binding family prot... 253 3e-66
gi|15230211|ref|NP_188512.1| Ras-related GTP-binding protein, pu... 253 3e-66
gi|49473687|gb|AAT66502.1| Rab7 protein [Paramecium aurelia] 252 5e-66
gi|549813|sp|P36864|YPT5_VOLCA GTP-binding protein yptV5 >gnl|BL... 249 4e-65
gi|13509187|emb|CAB92946.2| putative Rab7 GTPase [Plasmodium fal... 248 7e-65
gi|29841442|gb|AAP06474.1| similar to NM_079748 Rab7 protein in ... 248 9e-65
gi|21536526|gb|AAM60858.1| GTP binding protein, putative [Arabid... 247 1e-64
gi|7438408|pir||T03629 GTP-binding protein Rab7b - common tobacc... 246 2e-64
gi|7438407|pir||T03628 GTP-binding protein Rab7a - common tobacc... 246 2e-64
gi|15219943|ref|NP_173688.1| Ras-related protein (RAB7) / AtRab7... 246 2e-64
gi|3914558|sp|Q41640|RAB7_VIGAC Ras-related protein Rab7 >gnl|BL... 245 4e-64
gi|541949|pir||S39566 rab7 protein - soybean 244 8e-64
gi|1370182|emb|CAA98168.1| RAB7A [Lotus corniculatus var. japoni... 243 2e-63
gi|3914559|sp|Q43463|RAB7_SOYBN Ras-related protein Rab7 >gnl|BL... 242 4e-63
gi|18399819|ref|NP_565521.1| Ras-related GTP-binding protein, pu... 239 4e-62
gi|7438410|pir||T03630 GTP-binding protein Rab7c - common tobacc... 238 5e-62
gi|1370184|emb|CAA98169.1| RAB7B [Lotus corniculatus var. japoni... 236 2e-61
gi|50556440|ref|XP_505628.1| hypothetical protein [Yarrowia lipo... 235 5e-61
gi|32492056|gb|AAP85300.1| Rab7 [Babesia bovis] 235 5e-61
gi|15234026|ref|NP_192710.1| Ras-related GTP-binding protein, pu... 235 6e-61
gi|6682935|dbj|BAA88954.1| Rab7 [Tetrahymena thermophila] 234 8e-61
gi|25294161|pir||C84606 probable RAS type GTP-binding protein [i... 234 1e-60
gi|7438424|pir||T04019 rab7 protein homolog F17A8.70 - Arabidops... 228 6e-59
gi|13537439|dbj|BAB40674.1| small GTPase Rab7 [Entamoeba histoly... 226 3e-58
gi|6942102|gb|AAF32317.1| Rab7-like GTPase [Entamoeba histolytica] 225 6e-58
gi|45185690|ref|NP_983406.1| ACR003Cp [Eremothecium gossypii] >g... 224 1e-57
gi|6323642|ref|NP_013713.1| Gtp-binding protein of the rab famil... 224 1e-57
gi|47900425|gb|AAT39219.1| putative GTPase [Oryza sativa (japoni... 223 2e-57
gi|2350954|dbj|BAA22004.1| Ras-related protein RAB7 [Entamoeba h... 223 2e-57
gi|21465930|pdb|1KY2|A Chain A, Gppnhp-Bound Ypt7p At 1.6 A Reso... 223 3e-57
gi|50286745|ref|XP_445802.1| unnamed protein product [Candida gl... 221 7e-57
gi|34910572|ref|NP_916633.1| putative RAB7A protein (GTP-binding... 220 2e-56
gi|50306305|ref|XP_453125.1| unnamed protein product [Kluyveromy... 219 3e-56
gi|23487996|gb|EAA21195.1| putative Rab7 GTPase [Plasmodium yoel... 215 5e-55
gi|50420081|ref|XP_458573.1| unnamed protein product [Debaryomyc... 211 9e-54
gi|46436432|gb|EAK95794.1| hypothetical protein CaO19.2245 [Cand... 211 1e-53
gi|19114436|ref|NP_593524.1| ras-related protein rab-7 [Schizosa... 210 2e-53
gi|28892801|ref|NP_795945.1| RAB9B, member RAS oncogene family [... 199 3e-50
gi|45361063|ref|NP_989167.1| hypothetical protein MGC75872 [Xeno... 199 5e-50
gi|34881545|ref|XP_346352.1| similar to RIKEN cDNA 9330195C02 ge... 198 8e-50
gi|7705963|ref|NP_057454.1| RAB9-like protein [Homo sapiens] >gn... 196 3e-49
gi|50730261|ref|XP_416833.1| PREDICTED: similar to Ras-related p... 195 5e-49
gi|46249558|gb|AAH68782.1| MGC81321 protein [Xenopus laevis] 195 7e-49
gi|50745646|ref|XP_420182.1| PREDICTED: similar to RAB9B, member... 195 7e-49
gi|585773|sp|P24408|RB9A_CANFA Ras-related protein Rab-9A (Rab-9... 193 2e-48
gi|4759012|ref|NP_004242.1| RAB9A, member RAS oncogene family; R... 193 2e-48
gi|50513508|pdb|1S8F|A Chain A, Crystal Structure Of Rab9 Comple... 193 2e-48
gi|4895063|gb|AAD32707.1| GTP-binding protein [Trypanosoma cruzi] 192 3e-48
gi|18997099|gb|AAL83291.1| Rab7-like protein [Leishmania brazili... 192 6e-48
gi|49117011|gb|AAH72859.1| Unknown (protein for MGC:80259) [Xeno... 191 8e-48
gi|6983543|emb|CAB75350.1| LmRab7 GTP-binding protein [Leishmani... 190 2e-47
gi|9790227|ref|NP_062747.1| RAB9, member RAS oncogene family; SI... 190 2e-47
gi|47124150|gb|AAH70502.1| RAB9, member RAS oncogene family [Rat... 190 2e-47
gi|16758200|ref|NP_445910.1| RAB9, member RAS oncogene family [R... 189 4e-47
gi|23613553|ref|NP_704574.1| ras family GTP-ase, putative [Plasm... 187 1e-46
gi|47222954|emb|CAF99110.1| unnamed protein product [Tetraodon n... 186 4e-46
gi|33468618|emb|CAE30413.1| SI:zK13A21.4 (novel protein similar ... 185 5e-46
gi|30681167|ref|NP_849347.1| Ras-related GTP-binding protein, pu... 184 1e-45
gi|9758338|dbj|BAB08894.1| Ras-related protein RAB7-like [Arabid... 180 2e-44
gi|18421886|ref|NP_568566.1| Ras-related GTP-binding protein, pu... 180 2e-44
gi|50760525|ref|XP_425821.1| PREDICTED: similar to solute carrie... 174 1e-42
gi|48095428|ref|XP_394445.1| similar to Ras-related protein Rab-... 170 2e-41
gi|21704002|ref|NP_663484.1| RAB7-like protein [Mus musculus] >g... 167 1e-40
gi|34879705|ref|XP_222613.2| similar to solute carrier family 26... 167 2e-40
gi|50401122|sp|Q96AH8|RB7B_HUMAN Ras-related protein Rab-7b >gnl... 164 1e-39
gi|38490537|ref|NP_796377.2| RAB7B, member RAS oncogene family; ... 163 3e-39
gi|2190|emb|CAA39797.1| rab9 [Canis familiaris] 157 2e-37
gi|31233839|ref|XP_318959.1| ENSANGP00000015081 [Anopheles gambi... 156 3e-37
gi|49116806|gb|AAH73279.1| Unknown (protein for MGC:80651) [Xeno... 156 3e-37
gi|19921534|ref|NP_609966.1| CG9994-PA [Drosophila melanogaster]... 147 1e-34
gi|26348325|dbj|BAC37802.1| unnamed protein product [Mus musculus] 145 8e-34
gi|26331122|dbj|BAC29291.1| unnamed protein product [Mus musculus] 145 8e-34
gi|28828965|gb|AAO51546.1| similar to RAS-related protein [Caeno... 137 2e-31
gi|47227097|emb|CAG00459.1| unnamed protein product [Tetraodon n... 132 4e-30
gi|15217568|ref|NP_172434.1| Ras-related GTP-binding protein, pu... 132 4e-30
gi|3025293|sp|Q39572|YPT6_CHLRE Ras-related protein YPTC6 >gnl|B... 132 7e-30
gi|227603|prf||1707300A guanine nucleotide binding protein 130 2e-29
gi|15242483|ref|NP_199387.1| Ras-related GTP-binding protein, pu... 130 2e-29
gi|50511479|gb|AAT77401.1| putative GTP-binding protein [Oryza s... 130 3e-29
gi|32492050|gb|AAP85297.1| Rab1b [Babesia bovis] 130 3e-29
gi|1381678|gb|AAB97115.1| small GTP-binding protein [Glycine max] 129 4e-29
gi|1053063|gb|AAA80678.1| small GTP-binding protein 129 4e-29
gi|466170|sp|P16976|YPT1_MAIZE GTP-binding protein YPTM1 >gnl|BL... 129 4e-29
gi|21536533|gb|AAM60865.1| Rab-type small GTP-binding protein-li... 129 6e-29
gi|15232477|ref|NP_188124.1| Ras-related GTP-binding family prot... 129 6e-29
gi|49522606|gb|AAH75323.1| Unknown (protein for MGC:88997) [Xeno... 129 6e-29
gi|5738168|gb|AAD50281.1| putative intermediate compartment prot... 128 8e-29
gi|2118482|pir||I38703 ras-related small GTP binding protein Rab... 128 8e-29
gi|41393545|ref|NP_004574.2| RAB5C, member RAS oncogene family i... 128 8e-29
gi|15236555|ref|NP_193486.1| Ras-related GTP-binding protein, pu... 128 8e-29
gi|16974365|gb|AAL31108.1| AT4g17530/dl4800c [Arabidopsis thaliana] 128 8e-29
gi|50404925|ref|YP_054017.1| GTP-binding protein RAB2 homolog [P... 128 8e-29
gi|33416792|gb|AAH56058.1| Rab5-prov protein [Xenopus laevis] 128 8e-29
gi|14140133|emb|CAC39050.1| putative GTP-binding protein [Oryza ... 128 8e-29
gi|1616614|emb|CAA69701.1| small GTP-binding protein [Nicotiana ... 128 8e-29
gi|7438375|pir||H71444 GTP-binding protein - Arabidopsis thalian... 128 8e-29
gi|34906164|ref|NP_914429.1| putative GTP-binding protein [Oryza... 128 8e-29
gi|38258917|sp|P35278|RB5C_MOUSE Ras-related protein Rab-5C >gnl... 128 1e-28
gi|15239462|ref|NP_200894.1| Ras-related GTP-binding protein, pu... 128 1e-28
gi|1710027|sp|P51147|RB5C_CANFA Ras-related protein Rab-5C >gnl|... 128 1e-28
gi|27689505|ref|XP_213463.1| similar to Rab5c protein [Rattus no... 128 1e-28
gi|20072723|gb|AAH27378.1| Rab5c protein [Mus musculus] 128 1e-28
gi|13096181|pdb|1HUQ|A Chain A, 1.8a Crystal Structure Of The Mo... 128 1e-28
gi|49257311|gb|AAH73168.1| RAB13 protein [Homo sapiens] 127 1e-28
gi|18422766|ref|NP_568678.1| Ras-related GTP-binding protein, pu... 127 1e-28
gi|4506363|ref|NP_002861.1| RAB13, member RAS oncogene family; R... 127 1e-28
gi|29841143|gb|AAP06156.1| similar to NM_070996 RAS-related prot... 127 2e-28
gi|21592670|gb|AAM64619.1| putative Ras-like GTP-binding protein... 127 2e-28
gi|7438432|pir||T06447 GTP-binding protein - garden pea >gnl|BL_... 127 2e-28
gi|47225370|emb|CAG11853.1| unnamed protein product [Tetraodon n... 127 2e-28
gi|49257826|gb|AAH74632.1| Unknown (protein for MGC:69558) [Xeno... 127 2e-28
gi|12083645|ref|NP_073183.1| small GTP-binding protein rab5 [Rat... 127 2e-28
gi|7438389|pir||T12097 GTP-binding protein, ras-like (clone vfa-... 127 2e-28
gi|50744832|ref|XP_419896.1| PREDICTED: similar to small GTP bin... 127 2e-28
gi|3273209|dbj|BAA31150.1| Rab1C [Dictyostelium discoideum] 127 2e-28
gi|48103608|ref|XP_392879.1| similar to ENSANGP00000012769 [Apis... 127 2e-28
gi|541979|pir||S41431 GTP-binding protein, ras-like - fava bean ... 127 2e-28
gi|27066008|pdb|1N6H|A Chain A, Crystal Structure Of Human Rab5a... 127 2e-28
gi|17555956|ref|NP_499454.1| RAB family member (23.4 kD) (rab-35... 127 2e-28
gi|131794|sp|P18066|RB5A_CANFA Ras-related protein Rab-5A >gnl|B... 127 2e-28
gi|19923262|ref|NP_004153.2| RAB5A, member RAS oncogene family; ... 127 2e-28
gi|13385374|ref|NP_080163.1| RAB5A, member RAS oncogene family [... 127 2e-28
gi|12832758|dbj|BAB22245.1| unnamed protein product [Mus musculus] 127 2e-28
gi|50732756|ref|XP_418748.1| PREDICTED: similar to GTP-binding p... 127 2e-28
gi|1370170|emb|CAA98162.1| RAB1E [Lotus corniculatus var. japoni... 127 2e-28
gi|49333384|gb|AAT64023.1| putative GTP-binding protein [Gossypi... 126 3e-28
gi|49333370|gb|AAT64010.1| putative GTP-binding protein [Gossypi... 126 3e-28
gi|32492048|gb|AAP85296.1| Rab1a [Babesia bovis] 126 3e-28
gi|48716902|dbj|BAD23597.1| putative GTP-binding protein [Oryza ... 126 3e-28
gi|39584751|emb|CAE67646.1| Hypothetical protein CBG13205 [Caeno... 126 3e-28
gi|47228917|emb|CAG09432.1| unnamed protein product [Tetraodon n... 126 3e-28
gi|50404947|ref|YP_054039.1| Ras-related RAB, putative [Parameci... 126 3e-28
gi|13397937|emb|CAC34627.1| putative Rab2 GTPase [Plasmodium fal... 126 3e-28
gi|1370164|emb|CAA98159.1| RAB1B [Lotus corniculatus var. japoni... 126 4e-28
gi|40225607|gb|AAH09227.2| RAB13 protein [Homo sapiens] 126 4e-28
gi|27066009|pdb|1N6I|A Chain A, Crystal Structure Of Human Rab5a... 126 4e-28
gi|27066016|pdb|1N6N|A Chain A, Crystal Structure Of Human Rab5a... 126 4e-28
gi|27066019|pdb|1N6P|A Chain A, Crystal Structure Of Human Rab5a... 126 4e-28
gi|27066018|pdb|1N6O|A Chain A, Crystal Structure Of Human Rab5a... 126 4e-28
gi|11558647|emb|CAC17832.1| secretion related GTPase, (SrgA) [As... 126 4e-28
gi|4586580|dbj|BAA76422.1| rab-type small GTP-binding protein [C... 126 4e-28
gi|49118197|gb|AAH73193.1| Unknown (protein for MGC:80435) [Xeno... 126 4e-28
gi|49257196|gb|AAH71068.1| Unknown (protein for MGC:78967) [Xeno... 126 4e-28
gi|47210398|emb|CAF91320.1| unnamed protein product [Tetraodon n... 126 4e-28
gi|23480789|gb|EAA17254.1| putative Rab2 GTPase [Plasmodium yoel... 126 4e-28
gi|23508994|ref|NP_701662.1| Rab2 GTPase, putative [Plasmodium f... 126 4e-28
gi|6688535|emb|CAB65172.1| Rab11 GTPase [Lycopersicon esculentum] 125 5e-28
gi|15218719|ref|NP_174177.1| Ras-related GTP-binding protein, pu... 125 5e-28
gi|45383121|ref|NP_989856.1| rab5C-like protein [Gallus gallus] ... 125 5e-28
gi|27694927|gb|AAH43866.1| Rab5a-prov protein [Xenopus laevis] 125 5e-28
gi|46250314|gb|AAH68736.1| MGC81204 protein [Xenopus laevis] 125 5e-28
gi|17510659|ref|NP_493376.1| RAB family member (24.0 kD) (rab-27... 125 5e-28
gi|1370168|emb|CAA98161.1| RAB1D [Lotus corniculatus var. japoni... 125 5e-28
gi|421942|pir||S34253 GTP-binding protein, ras-related - common ... 125 5e-28
gi|41393159|ref|NP_958909.1| RAB5C, member RAS oncogene family [... 125 5e-28
gi|50258123|gb|EAL20817.1| hypothetical protein CNBE1790 [Crypto... 125 5e-28
gi|1370196|emb|CAA98175.1| RAB8D [Lotus corniculatus var. japoni... 125 7e-28
gi|30525051|ref|NP_766189.1| RAB2B protein [Mus musculus] >gnl|B... 125 7e-28
gi|26892279|gb|AAN86142.1| RAB2B [Homo sapiens] 125 7e-28
gi|21361884|ref|NP_116235.2| RAB2B protein; RAS family, member R... 125 7e-28
gi|549809|sp|P36861|YPT2_VOLCA GTP-binding protein yptV2 >gnl|BL... 125 7e-28
gi|3024504|sp|Q40521|R11B_TOBAC Ras-related protein Rab11B >gnl|... 125 7e-28
gi|27066021|pdb|1N6R|A Chain A, Crystal Structure Of Human Rab5a... 125 7e-28
gi|46359908|gb|AAS88840.1| putative GTP-binding protein [Oryza s... 125 7e-28
gi|541978|pir||S41430 GTP-binding protein, ras-like (clone vfa-y... 125 7e-28
gi|27675132|ref|XP_223991.1| similar to Ras-related protein Rab-... 125 7e-28
gi|32451720|gb|AAH54719.1| Unknown (protein for MGC:64765) [Mus ... 125 7e-28
gi|303732|dbj|BAA02117.1| GTP-binding protein [Pisum sativum] >g... 125 7e-28
gi|41469625|gb|AAS07348.1| putative GTP-binding protein [Oryza s... 125 9e-28
gi|49080386|ref|XP_403719.1| hypothetical protein UM06104.1 [Ust... 125 9e-28
gi|48102358|ref|XP_395340.1| similar to ENSANGP00000023894 [Apis... 125 9e-28
gi|39588485|emb|CAE58008.1| Hypothetical protein CBG01077 [Caeno... 125 9e-28
gi|17558550|ref|NP_503397.1| RAB family member (22.5 kD) (rab-1)... 125 9e-28
gi|1370156|emb|CAA98184.1| RAB11H [Lotus corniculatus var. japon... 125 9e-28
gi|41393127|ref|NP_958893.1| RAB5A, member RAS oncogene family; ... 125 9e-28
gi|1370190|emb|CAA98172.1| RAB8A [Lotus corniculatus var. japoni... 125 9e-28
gi|49102994|ref|XP_411111.1| hypothetical protein AN6974.2 [Aspe... 125 9e-28
gi|47209142|emb|CAF90455.1| unnamed protein product [Tetraodon n... 125 9e-28
gi|47218775|emb|CAG02761.1| unnamed protein product [Tetraodon n... 125 9e-28
gi|39592471|emb|CAE63548.1| Hypothetical protein CBG08034 [Caeno... 125 9e-28
gi|1053067|gb|AAA80680.1| small GTP-binding protein 125 9e-28
gi|7643790|gb|AAF65510.1| small GTP-binding protein [Capsicum an... 125 9e-28
gi|466172|sp|Q05737|YPT2_MAIZE GTP-binding protein YPTM2 >gnl|BL... 125 9e-28
gi|17506899|ref|NP_492481.1| RAB family member (22.8 kD) (rab-5)... 125 9e-28
gi|29791696|gb|AAH50558.1| RAB5B, member RAS oncogene family [Ho... 124 1e-27
gi|25304086|gb|AAH40143.1| Similar to RAB5B, member RAS oncogene... 124 1e-27
gi|15230422|ref|NP_187823.1| Ras-related GTP-binding family prot... 124 1e-27
gi|27817324|emb|CAD61089.1| SI:zC101N13.3 (novel protein similar... 124 1e-27
gi|92339|pir||S06147 GTP-binding protein rab1B - rat >gnl|BL_ORD... 124 1e-27
gi|4758988|ref|NP_004152.1| RAB1A, member RAS oncogene family; R... 124 1e-27
gi|5902803|sp|P28188|ARA5_ARATH Ras-related protein ARA-5 >gnl|B... 124 1e-27
gi|15242773|ref|NP_195972.1| Ras-related GTP-binding protein, pu... 124 1e-27
gi|34862219|ref|XP_213824.2| similar to RAB5B, member RAS oncoge... 124 1e-27
gi|349484|gb|AAA18826.1| GTP-binding protein homologue 124 1e-27
gi|303750|dbj|BAA02116.1| GTP-binding protein [Pisum sativum] >g... 124 1e-27
gi|131785|sp|P22125|RAB1_DISOM Ras-related protein ORAB-1 >gnl|B... 124 1e-27
gi|27924279|gb|AAH45014.1| Rab1-prov protein [Xenopus laevis] >g... 124 1e-27
gi|40807042|gb|AAH65298.1| Unknown (protein for IMAGE:6146668) [... 124 1e-27
gi|4506371|ref|NP_002859.1| RAB5B, member RAS oncogene family [H... 124 1e-27
gi|33991655|gb|AAH56422.1| RAB5B protein [Homo sapiens] 124 1e-27
gi|47211161|emb|CAF92536.1| unnamed protein product [Tetraodon n... 124 1e-27
gi|15217622|ref|NP_171715.1| Ras-related protein (ARA-5) / small... 124 1e-27
gi|50738954|ref|XP_419342.1| PREDICTED: similar to ras-related p... 124 1e-27
gi|15233367|ref|NP_195311.1| Ras-related GTP-binding protein, pu... 124 1e-27
gi|19114819|ref|NP_593907.1| endocytic rab protein [Schizosaccha... 124 1e-27
gi|3551877|gb|AAC34837.1| GTP binding protein RARE7L [Dictyostel... 124 1e-27
gi|50540176|ref|NP_001002555.1| zgc:92772 [Danio rerio] >gnl|BL_... 124 1e-27
gi|47216427|emb|CAG01978.1| unnamed protein product [Tetraodon n... 124 1e-27
gi|131849|sp|P22129|R11B_DISOM Ras-related protein Rab-11B (ORA3... 124 1e-27
gi|49671143|gb|AAH75268.1| Unknown (protein for MGC:88884) [Xeno... 124 1e-27
gi|46326983|gb|AAS88430.1| ethylene-responsive small GTP-binding... 124 1e-27
gi|41055758|ref|NP_957264.1| RAB5A, member RAS oncogene family l... 124 1e-27
gi|15219955|ref|NP_173136.1| Ras-related GTP-binding protein, pu... 124 1e-27
gi|12837642|dbj|BAB23894.1| unnamed protein product [Mus musculus] 124 1e-27
gi|22597170|gb|AAN03472.1| GTP-binding protein [Glycine max] 124 1e-27
gi|41152205|ref|NP_958486.1| RAB13, member RAS oncogene family [... 124 1e-27
gi|50760924|ref|XP_418183.1| PREDICTED: similar to GTP-binding p... 124 1e-27
gi|1370198|emb|CAA98176.1| RAB8E [Lotus corniculatus var. japoni... 124 1e-27
gi|38175435|dbj|BAC83185.2| putative ras-related protein [Oryza ... 124 1e-27
gi|106189|pir||F34323 GTP-binding protein Rab5 - human >gnl|BL_O... 124 1e-27
gi|2133238|pir||S51495 GTP-binding protein RYL1 - yeast (Yarrowi... 124 1e-27
gi|41152211|ref|NP_958489.1| RAB32, member RAS oncogene family [... 124 1e-27
gi|32766475|gb|AAH54969.1| MGC64433 protein [Xenopus laevis] 124 1e-27
gi|42542760|gb|AAH66502.1| Rab32 protein [Danio rerio] 124 1e-27
gi|34874893|ref|XP_346034.1| similar to Rab23 protein [Rattus no... 124 2e-27
gi|6841496|gb|AAF29101.1| HSPC137 [Homo sapiens] 124 2e-27
gi|13569962|ref|NP_112243.1| RAB1B, member RAS oncogene family; ... 124 2e-27
gi|49065350|emb|CAG38493.1| RAB1B [Homo sapiens] 124 2e-27
gi|464524|sp|Q05974|RAB1_LYMST Ras-related protein Rab-1A >gnl|B... 124 2e-27
gi|14249144|ref|NP_116006.1| RAB11B, member RAS oncogene family ... 124 2e-27
gi|49456343|emb|CAG46492.1| RAB11B [Homo sapiens] 124 2e-27
gi|6679583|ref|NP_033023.1| RAB11B, member RAS oncogene family [... 124 2e-27
gi|47086269|ref|NP_998050.1| hypothetical protein zgc:76978 [Dan... 124 2e-27
gi|29124128|gb|AAO65869.1| ethylene-responsive small GTP-binding... 124 2e-27
gi|15234020|ref|NP_193615.1| Ras-related GTP-binding family prot... 124 2e-27
gi|19114579|ref|NP_593667.1| YPT1-related rab subfamily protein ... 124 2e-27
gi|31324876|gb|AAP48704.1| rab11-2 [Limulus polyphemus] 124 2e-27
gi|1845598|gb|AAB47925.1| Rab3 [Loligo pealei] 124 2e-27
gi|50582491|dbj|BAD32700.1| Rab3 [Loligo pealei] 124 2e-27
gi|21311975|ref|NP_080953.1| RAS-associated protein RAB13 [Mus m... 124 2e-27
gi|1362067|pir||S57478 GTP-binding protein GTP13 - garden pea >g... 124 2e-27
gi|1362065|pir||S57462 GTP-binding protein GTP11 - garden pea >g... 124 2e-27
gi|47937791|gb|AAH72360.1| MGC83515 protein [Xenopus laevis] 124 2e-27
gi|50553762|ref|XP_504292.1| YlRYL1 [Yarrowia lipolytica] >gnl|B... 124 2e-27
gi|49115537|gb|AAH73442.1| Unknown (protein for MGC:80943) [Xeno... 124 2e-27
gi|8394142|ref|NP_059013.1| low Mr GTP-binding protein [Rattus n... 124 2e-27
gi|2500074|sp|Q39570|YPT4_CHLRE GTP-binding protein YPTC4 >gnl|B... 124 2e-27
gi|549811|sp|P36863|YPT4_VOLCA GTP-binding protein yptV4 (RAB2 h... 124 2e-27
gi|31225532|ref|XP_317584.1| ENSANGP00000022645 [Anopheles gambi... 123 3e-27
gi|20379078|gb|AAM21099.1| small GTP binding protein RAB23 [Homo... 123 3e-27
gi|34485714|ref|NP_057361.3| Ras-related protein Rab-23 [Homo sa... 123 3e-27
gi|42561732|ref|NP_563750.2| Ras-related protein (ARA-1) (ARA) /... 123 3e-27
gi|27709432|ref|XP_229035.1| similar to Ras-related protein Rab-... 123 3e-27
gi|2500076|sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT... 123 3e-27
gi|21313162|ref|NP_083852.1| RIKEN cDNA 1110011F09 [Mus musculus... 123 3e-27
gi|48104721|ref|XP_392967.1| similar to CG3320-PA [Apis mellifera] 123 3e-27
gi|114085|sp|P19892|ARA1_ARATH Ras-related protein ARA-1 >gnl|BL... 123 3e-27
gi|21555752|gb|AAM63927.1| guanine nucleotide regulatory protein... 123 3e-27
gi|15233873|ref|NP_193578.1| Ras-related GTP-binding protein, pu... 123 3e-27
gi|17737457|ref|NP_523687.1| CG7576-PA [Drosophila melanogaster]... 123 3e-27
gi|1370166|emb|CAA98160.1| RAB1C [Lotus corniculatus var. japoni... 123 3e-27
gi|31225537|ref|XP_317585.1| ENSANGP00000022624 [Anopheles gambi... 123 3e-27
gi|33146687|dbj|BAC80082.1| putative ethylene-responsive small G... 123 3e-27
gi|81634|pir||PS0279 GTP-binding protein ara-5 - Arabidopsis tha... 123 3e-27
gi|7438394|pir||T14405 small GTP-binding protein rab-1 - turnip ... 123 3e-27
gi|217841|dbj|BAA00832.1| small GTP-binding protein [Arabidopsis... 123 3e-27
gi|131803|sp|P10536|RB1B_RAT Ras-related protein Rab-1B >gnl|BL_... 123 3e-27
gi|4758986|ref|NP_004209.1| RAB11B, member RAS oncogene family; ... 123 3e-27
gi|47550807|ref|NP_999935.1| zgc:55760 [Danio rerio] >gnl|BL_ORD... 123 3e-27
gi|18376163|emb|CAD21237.1| probable GTP-binding protein Drab11 ... 123 3e-27
gi|18447921|dbj|BAB84326.1| ras-related protein RAB8-5 [Nicotian... 123 3e-27
gi|15238542|ref|NP_200792.1| Ras-related GTP-binding family prot... 123 3e-27
gi|47900325|gb|AAT39172.1| putative GTP-binding protein [Oryza s... 123 3e-27
gi|15231322|ref|NP_190192.1| Ras-related protein (ARA-3) / small... 123 3e-27
gi|49522135|gb|AAH75188.1| Unknown (protein for MGC:82152) [Xeno... 123 3e-27
gi|2623643|gb|AAB86480.1| GTP-binding protein [Entamoeba histoly... 123 3e-27
gi|1346956|sp|P49103|RB2A_MAIZE Ras-related protein Rab-2-A >gnl... 123 3e-27
gi|31208125|ref|XP_313029.1| ENSANGP00000011746 [Anopheles gambi... 123 3e-27
gi|49168452|emb|CAG38721.1| RAB5B [Homo sapiens] 123 3e-27
gi|1405561|emb|CAA67153.1| FSGTP1 [Fagus sylvatica] 123 3e-27
gi|3024527|sp|Q39433|RAB1_BETVU Ras-related protein RAB1BV >gnl|... 123 3e-27
gi|2500073|sp|Q39571|YPT1_CHLRE GTP-binding protein YPTC1 >gnl|B... 123 3e-27
gi|29789271|ref|NP_112354.1| RAB13 [Rattus norvegicus] >gnl|BL_O... 123 3e-27
gi|1710020|sp|P35288|RB23_MOUSE Ras-related protein Rab-23 (Rab-... 122 4e-27
gi|31543565|ref|NP_033025.2| RAB23, member RAS oncogene family; ... 122 4e-27
gi|48096697|ref|XP_392500.1| similar to Ras-related protein Rab-... 122 4e-27
gi|1370154|emb|CAA98183.1| RAB11G [Lotus corniculatus var. japon... 122 4e-27
gi|27370881|gb|AAH41250.1| Rab11b-prov protein [Xenopus laevis] 122 4e-27
gi|49168476|emb|CAG38733.1| RAB11B [Homo sapiens] 122 4e-27
gi|18447917|dbj|BAB84324.1| ras-related protein RAB8-3 [Nicotian... 122 4e-27
gi|18447913|dbj|BAB84322.1| ras-related protein RAB8-1 [Nicotian... 122 4e-27
gi|18447915|dbj|BAB84323.1| ras-related protein RAB8-2 [Nicotian... 122 4e-27
gi|421941|pir||S33160 GTP-binding protein, ras-related - common ... 122 4e-27
gi|46561764|gb|AAT01087.1| putative rab11 [Homalodisca coagulata] 122 4e-27
gi|23490566|gb|EAA22313.1| Rab1 protein [Plasmodium yoelii yoelii] 122 4e-27
gi|49250515|gb|AAH74609.1| Unknown (protein for MGC:69471) [Xeno... 122 4e-27
gi|32398960|emb|CAD98425.1| rab1a protein, probable [Cryptospori... 122 4e-27
gi|16755592|gb|AAL28022.1| small GTPase Rab2 [Nicotiana tabacum] 122 6e-27
gi|303748|dbj|BAA02115.1| GTP-binding protein [Pisum sativum] >g... 122 6e-27
gi|131787|sp|P05711|RB1A_RAT Ras-related protein Rab-1A >gnl|BL_... 122 6e-27
gi|17380746|gb|AAL36203.1| putative RAS-related protein ARA-1 [A... 122 6e-27
gi|29841162|gb|AAP06175.1| similar to NM_002868 RAB5B, member RA... 122 6e-27
gi|15224226|ref|NP_181842.1| Ras-related protein (ARA-4) / small... 122 6e-27
gi|479442|pir||S33900 GTP-binding protein ypt2 - tomato >gnl|BL_... 122 6e-27
gi|2808638|emb|CAA04701.1| small GTP-binding protein [Daucus car... 122 6e-27
gi|49074732|ref|XP_401480.1| hypothetical protein UM03865.1 [Ust... 122 6e-27
gi|27806111|ref|NP_776871.1| RAB3A, member RAS oncogene family [... 122 6e-27
gi|730510|sp|P40392|RIC1_ORYSA Ras-related protein RIC1 >gnl|BL_... 122 6e-27
gi|15235113|ref|NP_193699.1| Ras-related GTP-binding protein, pu... 122 6e-27
gi|23613148|ref|NP_703470.1| GTPase, putative [Plasmodium falcip... 122 6e-27
gi|47224601|emb|CAG03585.1| unnamed protein product [Tetraodon n... 122 6e-27
gi|34910940|ref|NP_916817.1| putative GTP-binding protein [Oryza... 122 6e-27
gi|31201989|ref|XP_309942.1| ENSANGP00000019806 [Anopheles gambi... 122 6e-27
gi|34914060|ref|NP_918377.1| putative RIC1_ORYSA RAS-RELATED PRO... 122 6e-27
gi|21361418|ref|NP_055303.2| RAB30, member RAS oncogene family [... 122 6e-27
gi|13128964|ref|NP_076124.1| RAB27A protein; ashen [Mus musculus... 122 6e-27
gi|15235981|ref|NP_193450.1| Rab2-like GTP-binding protein (RAB2... 122 7e-27
gi|1370176|emb|CAA98165.1| RAB2A [Lotus corniculatus var. japoni... 122 7e-27
gi|37360618|dbj|BAC98287.1| mKIAA3012 protein [Mus musculus] 122 7e-27
gi|392973|gb|AAA03315.1| Rab3 122 7e-27
gi|267527|sp|Q01111|YPT3_NICPL Ras-related protein YPT3 >gnl|BL_... 122 7e-27
gi|15232784|ref|NP_187601.1| Ras-related GTP-binding protein, pu... 122 7e-27
gi|46228121|gb|EAK89020.1| Rab5 like small GTpase [Cryptosporidi... 122 7e-27
gi|1362066|pir||S57471 GTP-binding protein GTP6 - garden pea >gn... 122 7e-27
gi|47216652|emb|CAG04850.1| unnamed protein product [Tetraodon n... 122 7e-27
gi|15242309|ref|NP_199326.1| Ras-related protein (RHA1) / small ... 122 7e-27
gi|50311935|ref|XP_455999.1| unnamed protein product [Kluyveromy... 122 7e-27
gi|7438428|pir||T06443 GTP-binding protein - garden pea >gnl|BL_... 122 7e-27
gi|1184985|gb|AAA87884.1| ATGB3 [Arabidopsis thaliana] 122 7e-27
gi|15236099|ref|NP_195709.1| Ras-related GTP-binding protein, pu... 122 7e-27
gi|21617896|gb|AAM66946.1| GTP-binding protein GB3 [Arabidopsis ... 122 7e-27
gi|32398899|emb|CAD98364.1| small GTP binding protein rab1a, pro... 122 7e-27
gi|7438379|pir||E71440 GTP-binding protein RAB2A - Arabidopsis t... 122 7e-27
gi|28556900|dbj|BAC57527.1| GTP-binding protein rab-2 homologue ... 122 7e-27
gi|3024505|sp|Q40522|R11D_TOBAC Ras-related protein Rab11D >gnl|... 121 1e-26
gi|50753230|ref|XP_413914.1| PREDICTED: similar to RAB11a, membe... 121 1e-26
gi|7677422|gb|AAF67162.1| GTPase Rab37 [Mus musculus] >gnl|BL_OR... 121 1e-26
gi|15225121|ref|NP_180726.1| Ras-related GTP-binding protein, pu... 121 1e-26
gi|32411557|ref|XP_326259.1| RAS-RELATED PROTEIN RAB1BV [Neurosp... 121 1e-26
gi|42543202|pdb|1OIV|A Chain A, X-Ray Structure Of The Small G P... 121 1e-26
gi|4758984|ref|NP_004654.1| Ras-related protein Rab-11A; RAB 11A... 121 1e-26
gi|7108528|gb|AAF36458.1| small GTPase [Mus musculus] 121 1e-26
gi|26337951|dbj|BAC32661.1| unnamed protein product [Mus musculus] 121 1e-26
gi|30584069|gb|AAP36283.1| Homo sapiens RAB11A, member RAS oncog... 121 1e-26
gi|38106736|gb|EAA53007.1| hypothetical protein MG06135.4 [Magna... 121 1e-26
gi|5764095|gb|AAD51132.1| small GTP-binding protein rab1 [Theile... 121 1e-26
gi|7438417|pir||JE0318 GTP-binding protein rabB - silkworm >gnl|... 121 1e-26
gi|1370194|emb|CAA98174.1| RAB8C [Lotus corniculatus var. japoni... 121 1e-26
gi|401686|sp|P31584|YPT1_VOLCA GTP-binding protein yptV1 >gnl|BL... 121 1e-26
gi|47213194|emb|CAF95985.1| unnamed protein product [Tetraodon n... 121 1e-26
gi|49069954|ref|XP_399266.1| hypothetical protein UM01651.1 [Ust... 121 1e-26
gi|38344743|emb|CAE03047.2| OSJNBa0089K21.1 [Oryza sativa (japon... 121 1e-26
gi|7438383|pir||S71559 GTP-binding protein rab2 - soybean >gnl|B... 121 1e-26
gi|31216369|ref|XP_316217.1| ENSANGP00000005948 [Anopheles gambi... 121 1e-26
gi|50752910|ref|XP_413795.1| PREDICTED: similar to Ras-related p... 121 1e-26
gi|29250860|gb|EAA42348.1| GLP_440_103492_104175 [Giardia lambli... 121 1e-26
gi|50292103|ref|XP_448484.1| unnamed protein product [Candida gl... 121 1e-26
gi|41055496|ref|NP_957436.1| similar to RAB1, member RAS oncogen... 121 1e-26
gi|26335369|dbj|BAC31385.1| unnamed protein product [Mus musculus] 121 1e-26
gi|22597172|gb|AAN03473.1| small GTP-binding protein [Glycine max] 121 1e-26
gi|3024528|sp|Q39434|RAB2_BETVU Ras-related protein Rab2BV >gnl|... 121 1e-26
gi|17507539|ref|NP_491233.1| RAB family member (23.6 kD) (rab-2)... 121 1e-26
gi|48766845|gb|AAT46563.1| Rab [Marsupenaeus japonicus] 121 1e-26
gi|15231847|ref|NP_190929.1| Ras-related GTP-binding protein, pu... 121 1e-26
gi|28376635|ref|NP_783865.1| RAB37, member RAS oncogene family; ... 121 1e-26
gi|7939615|gb|AAF70820.1| small GTPase Rab11 [Trypanosoma brucei... 121 1e-26
gi|15237828|ref|NP_200723.1| Ras-related GTP-binding protein, pu... 121 1e-26
gi|1588651|prf||2209256A rab2 gene 121 1e-26
gi|4506365|ref|NP_002856.1| RAB2, member RAS oncogene family [Ho... 121 1e-26
gi|10946940|ref|NP_067493.1| RAB2, member RAS oncogene family; G... 121 1e-26
gi|41393075|ref|NP_958862.1| RAB2, member RAS oncogene family [D... 121 1e-26
gi|34849826|gb|AAH58382.1| RAB2, member RAS oncogene family [Mus... 121 1e-26
gi|266878|sp|Q01971|RB2A_RABIT Ras-related protein Rab-2A >gnl|B... 121 1e-26
gi|45382561|ref|NP_990559.1| GTP-binding protein [Gallus gallus]... 121 1e-26
gi|50731203|ref|XP_417213.1| PREDICTED: similar to RAB30 [Gallus... 121 1e-26
gi|2118462|pir||S52646 GTP-binding protein gmr2 - soybean 120 2e-26
gi|541948|pir||S39565 GTP-binding protein rab1 - soybean >gnl|BL... 120 2e-26
gi|7438433|pir||T06448 GTP-binding protein - garden pea >gnl|BL_... 120 2e-26
gi|32414965|ref|XP_327962.1| hypothetical protein ( (NM_017382) ... 120 2e-26
gi|47216650|emb|CAG04848.1| unnamed protein product [Tetraodon n... 120 2e-26
gi|5669640|gb|AAD46405.1| ethylene-responsive small GTP-binding ... 120 2e-26
gi|14475537|emb|CAC41973.1| putative Rab/GTPase [Colletotrichum ... 120 2e-26
gi|106185|pir||B34323 GTP-binding protein Rab2 - human >gnl|BL_O... 120 2e-26
gi|31209781|ref|XP_313857.1| ENSANGP00000024287 [Anopheles gambi... 120 2e-26
gi|34897394|ref|NP_910043.1| Ras-related GTP-binding protein [Or... 120 2e-26
gi|18543235|ref|NP_569921.1| CG14791-PC [Drosophila melanogaster... 120 2e-26
gi|1346957|sp|P49104|RB2B_MAIZE Ras-related protein Rab-2-B >gnl... 120 2e-26
gi|49084594|ref|XP_404484.1| hypothetical protein AN0347.2 [Aspe... 120 2e-26
gi|7438425|pir||T07059 GTP-binding protein sra1 - soybean (fragm... 120 2e-26
gi|14573837|gb|AAK68195.1| Rab family protein 3, isoform a [Caen... 120 2e-26
gi|7438437|pir||T03767 GTP-binding protein rab2 - rice >gnl|BL_O... 120 2e-26
gi|17535675|ref|NP_495129.1| RAB family member, small GTP-bindin... 120 2e-26
gi|50418486|gb|AAH77124.1| Unknown (protein for MGC:100812) [Dan... 120 2e-26
gi|103720|pir||D38625 GTP-binding protein o-rab1 - electric ray ... 120 2e-26
gi|11558649|emb|CAC17833.1| secretion related GTPase (SrgB) [Asp... 120 2e-26
gi|24648682|ref|NP_732610.1| CG3320-PA [Drosophila melanogaster]... 120 2e-26
gi|3024529|sp|Q40195|R11E_LOTJA Ras-related protein Rab11E >gnl|... 120 2e-26
gi|38194437|gb|AAR13228.1| Rab family GTPase Rab8 [Fucus distichus] 120 2e-26
gi|13385282|ref|NP_085031.1| RAB27b, member RAS oncogene family ... 120 2e-26
gi|39586261|emb|CAE66672.1| Hypothetical protein CBG12011 [Caeno... 120 2e-26
gi|548673|sp|P36412|RB11_DICDI Ras-related protein Rab11 >gnl|BL... 120 2e-26
gi|37788823|gb|AAP51289.1| Rab11-1c [Limulus polyphemus] 120 2e-26
gi|629626|pir||S45023 GTP-binding protein Rab - alfalfa >gnl|BL_... 120 2e-26
gi|37788825|gb|AAP51290.1| Rab11-1a [Limulus polyphemus] >gnl|BL... 120 2e-26
gi|50550089|ref|XP_502517.1| hypothetical protein [Yarrowia lipo... 120 2e-26
gi|7438404|pir||T03626 GTP-binding protein Rab11e - common tobac... 120 2e-26
gi|47217560|emb|CAG02487.1| unnamed protein product [Tetraodon n... 120 2e-26
gi|7496249|pir||T15546 hypothetical protein C18A3.6 - Caenorhabd... 120 2e-26
gi|45201353|ref|NP_986923.1| AGR257Cp [Eremothecium gossypii] >g... 120 2e-26
gi|49093914|ref|XP_408418.1| YPT1_NEUCR GTP-binding protein ypt1... 120 2e-26
gi|50306647|ref|XP_453297.1| unnamed protein product [Kluyveromy... 120 2e-26
gi|464526|sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 >gnl|BL... 120 2e-26
gi|31199873|ref|XP_308884.1| ENSANGP00000012769 [Anopheles gambi... 120 2e-26
gi|1362064|pir||S57474 GTP-binding protein - garden pea >gnl|BL_... 120 2e-26
gi|38524287|emb|CAD57744.1| RAB-like small G-protein [Hordeum vu... 120 2e-26
gi|5738170|gb|AAD50282.1| putative intermediate compartment prot... 120 2e-26
gi|31227879|ref|XP_317957.1| ENSANGP00000020507 [Anopheles gambi... 120 2e-26
gi|12057010|emb|CAC19792.1| RAB5A protein [Oryza sativa] 120 2e-26
gi|4837727|gb|AAD30658.1| small GTP binding protein Rab2 [Sporob... 120 2e-26
gi|7438438|pir||T04362 GTP-binding protein yptm3 - maize >gnl|BL... 120 2e-26
gi|46806275|dbj|BAD17483.1| putative GTP-binding protein yptm3 [... 120 2e-26
gi|2689227|emb|CAA72627.1| rab7-like protein [Trichinella pseudo... 120 2e-26
gi|22651417|gb|AAL12244.1| Rab39 [Homo sapiens] 120 2e-26
gi|47087033|ref|NP_998530.1| zgc:63637 [Danio rerio] >gnl|BL_ORD... 120 3e-26
gi|20139581|sp|Q96AX2|RB37_HUMAN Ras-related protein Rab-37 >gnl... 120 3e-26
gi|4930237|pdb|3RAB|A Chain A, Gppnhp-Bound Rab3a At 2.0 A Resol... 120 3e-26
gi|15226182|ref|NP_180943.1| Ras-related GTP-binding protein, pu... 120 3e-26
gi|41148993|ref|XP_372086.1| similar to RAB1B, member RAS oncoge... 120 3e-26
gi|1370162|emb|CAA66447.1| RAB1A [Lotus corniculatus var. japoni... 120 3e-26
gi|17553774|ref|NP_498993.1| RAB family member (23.3 kD) (rab-6.... 120 3e-26
gi|32418088|ref|XP_329522.1| GTP-BINDING PROTEIN YPT1 [Neurospor... 120 3e-26
gi|17137216|ref|NP_477170.1| CG5771-PB [Drosophila melanogaster]... 120 3e-26
gi|730512|sp|P40393|RIC2_ORYSA Ras-related protein RIC2 >gnl|BL_... 120 3e-26
gi|13195452|gb|AAK15703.1| GTP-binding protein [Oryza sativa] 120 3e-26
gi|48096836|ref|XP_392533.1| similar to ENSANGP00000020507 [Apis... 120 3e-26
gi|39587673|emb|CAE58611.1| Hypothetical protein CBG01778 [Caeno... 120 3e-26
gi|39597496|emb|CAE59726.1| Hypothetical protein CBG03162 [Caeno... 120 3e-26
gi|7689363|gb|AAF67748.1| GTP-binding protein RAB3A [Homo sapiens] 120 3e-26
gi|6679593|ref|NP_033027.1| RAB3A, member RAS oncogene family [M... 120 3e-26
gi|4506367|ref|NP_002857.1| RAB3A, member RAS oncogene family; R... 120 3e-26
gi|6981452|ref|NP_037150.1| RAB3A, member RAS oncogene family; R... 120 3e-26
gi|89582|pir||A29224 GTP-binding protein smg-25A - bovine 120 3e-26
gi|13929006|ref|NP_113906.1| RAB2, member RAS oncogene family [R... 120 3e-26
gi|7438431|pir||T06446 GTP-binding protein - garden pea >gnl|BL_... 120 3e-26
gi|6323291|ref|NP_013363.1| Ras-like GTP binding protein involve... 120 3e-26
gi|31210411|ref|XP_314172.1| ENSANGP00000015837 [Anopheles gambi... 120 3e-26
gi|15224916|ref|NP_181989.1| Ras-related GTP-binding protein, pu... 120 3e-26
gi|17736973|ref|NP_523457.1| CG3664-PE [Drosophila melanogaster]... 119 4e-26
gi|499068|emb|CAA54506.1| GTPase [Glycine max] 119 4e-26
gi|50752811|ref|XP_413757.1| PREDICTED: similar to GTPase Rab8b ... 119 4e-26
gi|39585054|emb|CAE62705.1| Hypothetical protein CBG06854 [Caeno... 119 4e-26
gi|3024502|sp|Q40194|R11D_LOTJA Ras-related protein Rab11D >gnl|... 119 4e-26
gi|16758202|ref|NP_445911.1| RAB27B, member RAS oncogene family ... 119 4e-26
gi|50742500|ref|XP_419654.1| PREDICTED: similar to Ras-related p... 119 4e-26
gi|48106226|ref|XP_396069.1| similar to ENSANGP00000021516 [Apis... 119 4e-26
>gi|17536699|ref|NP_496549.1| RAB family member (23.4 kD) (rab-7)
[Caenorhabditis elegans]
gi|7508874|pir||T26119 hypothetical protein W03C9.3 -
Caenorhabditis elegans
gi|3880453|emb|CAA91357.1| C. elegans RAB-7 protein (corresponding
sequence W03C9.3) [Caenorhabditis elegans]
gi|39591357|emb|CAE73411.1| Hypothetical protein CBG20853
[Caenorhabditis briggsae]
Length = 209
Score = 375 bits (962), Expect = e-103
Identities = 189/209 (90%), Positives = 189/209 (90%)
Frame = -1
Query: 630 MSGTRKKALLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDDRTVTL 451
MSGTRKKALLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDDRTVTL
Sbjct: 1 MSGTRKKALLKVIILGDSGVGKTSLMNQYVNRRFSNQYKATIGADFLTRDVNIDDRTVTL 60
Query: 450 QIWDTAGQERFQSLGVAFYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFP 271
QIWDTAGQERFQSLGVAFYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFP
Sbjct: 61 QIWDTAGQERFQSLGVAFYRGADCCVLAFDVTNAASFKSLDSWRDEFLIQASPRDPDHFP 120
Query: 270 FVLLGNKVDLESQRAVSSKRAQSWCQTKGNIPYYEVSAKEALNVEXXXXXXXXXXXXRES 91
FVLLGNKVDLESQRAVSSKRAQSWCQTKGNIPYYEVSAKEALNVE RES
Sbjct: 121 FVLLGNKVDLESQRAVSSKRAQSWCQTKGNIPYYEVSAKEALNVEAAFLAIARDALARES 180
Query: 90 QETNDFPEFPDQIRLXXXXXXXXNSGCNC 4
QETNDFPEFPDQIRL NSGCNC
Sbjct: 181 QETNDFPEFPDQIRLNPNQQNQQNSGCNC 209