Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= W03G11_3
(999 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ... 411 e-113
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno... 348 8e-95
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab... 310 3e-83
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 109 5e-48
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 141 3e-32
gi|687634|gb|AAA62504.1| collagen 140 6e-32
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno... 119 1e-25
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 117 5e-25
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [... 116 7e-25
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 116 7e-25
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e... 109 1e-22
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 74 1e-22
gi|39594818|emb|CAE70686.1| Hypothetical protein CBG17403 [Caeno... 106 9e-22
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [... 104 4e-21
gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD) ... 103 6e-21
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 102 1e-20
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ... 102 2e-20
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 100 5e-20
gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179) ... 100 5e-20
gi|39594817|emb|CAE70685.1| Hypothetical protein CBG17402 [Caeno... 99 2e-19
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno... 98 3e-19
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p... 97 4e-19
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 96 2e-18
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 91 5e-17
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 91 5e-17
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 90 7e-17
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 87 6e-16
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 86 1e-15
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 86 1e-15
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 86 2e-15
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno... 86 2e-15
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 86 2e-15
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 85 2e-15
gi|1813688|gb|AAC47626.1| unknown [Brugia malayi] >gnl|BL_ORD_ID... 84 4e-15
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 84 7e-15
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 83 1e-14
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 83 1e-14
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 83 1e-14
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 83 1e-14
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 82 1e-14
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 82 2e-14
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 82 2e-14
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 82 2e-14
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 81 3e-14
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 81 3e-14
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 80 7e-14
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 79 1e-13
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 79 1e-13
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [... 79 2e-13
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 76 1e-12
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 76 1e-12
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 74 7e-12
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 73 9e-12
gi|39579268|emb|CAE56955.1| Hypothetical protein CBG24805 [Caeno... 73 1e-11
gi|39579438|emb|CAE56766.1| Hypothetical protein CBG24569 [Caeno... 72 2e-11
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 72 2e-11
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40 72 2e-11
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl... 72 2e-11
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 72 2e-11
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 72 2e-11
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 72 2e-11
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 72 2e-11
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 71 3e-11
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 71 4e-11
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 70 1e-10
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 69 2e-10
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 69 2e-10
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 68 3e-10
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 68 3e-10
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 68 3e-10
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 68 3e-10
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 68 4e-10
gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ... 67 5e-10
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 66 1e-09
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 66 1e-09
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 66 1e-09
gi|1222642|emb|CAA63070.1| collagen [Brugia pahangi] 65 2e-09
gi|17507553|ref|NP_490679.1| COLlagen structural gene (col-45) [... 65 2e-09
gi|17551374|ref|NP_510617.1| COLlagen structural gene (col-186) ... 65 2e-09
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd... 65 3e-09
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 65 3e-09
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 64 4e-09
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno... 64 4e-09
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 64 5e-09
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 64 5e-09
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 64 5e-09
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 64 7e-09
gi|39591241|emb|CAE73294.1| Hypothetical protein CBG20714 [Caeno... 64 7e-09
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 63 9e-09
gi|320995|pir||A44982 collagen UCOL1 - pig roundworm (fragment) ... 63 1e-08
gi|32567349|ref|NP_872207.1| COLlagen structural gene (col-42) [... 62 2e-08
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 62 2e-08
gi|39595279|emb|CAE60316.1| Hypothetical protein CBG03907 [Caeno... 62 3e-08
gi|33589142|emb|CAE45096.1| Hypothetical protein Y51H4A.28 [Caen... 61 3e-08
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 61 5e-08
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 61 5e-08
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 60 6e-08
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [... 60 6e-08
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 60 6e-08
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd... 60 6e-08
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno... 60 6e-08
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para... 60 8e-08
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 60 8e-08
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 60 1e-07
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno... 60 1e-07
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 59 1e-07
gi|15077111|gb|AAK83075.1| collagen [Meloidogyne javanica] 59 2e-07
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 59 2e-07
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi... 58 3e-07
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate... 58 3e-07
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 58 3e-07
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (... 58 4e-07
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 58 4e-07
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 58 4e-07
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]... 57 5e-07
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 57 5e-07
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 57 5e-07
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 57 7e-07
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 57 7e-07
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 57 9e-07
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 57 9e-07
gi|17536751|ref|NP_495952.1| predicted CDS, COLlagen structural ... 56 1e-06
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 56 1e-06
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 56 1e-06
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 56 1e-06
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 56 1e-06
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 56 1e-06
gi|38603523|dbj|BAD02898.1| bacteriolytic enzyme [Bacillus clausii] 56 1e-06
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 56 1e-06
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo... 55 2e-06
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 55 2e-06
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her... 55 3e-06
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr... 54 6e-06
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 54 6e-06
gi|13182946|gb|AAK14999.1| centromere binding protein 1 [Candida... 54 7e-06
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 54 7e-06
gi|50288897|ref|XP_446878.1| unnamed protein product [Candida gl... 54 7e-06
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a... 43 9e-06
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633... 53 1e-05
gi|38110797|gb|EAA56463.1| hypothetical protein MG06434.4 [Magna... 53 1e-05
gi|42528111|ref|NP_973209.1| conserved hypothetical protein [Tre... 53 1e-05
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 53 1e-05
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 53 1e-05
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 53 1e-05
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 52 2e-05
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (... 52 2e-05
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid... 52 2e-05
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (... 52 2e-05
gi|6319766|ref|NP_009848.1| Involved in global regulation of tra... 52 2e-05
gi|172638|gb|AAA35062.1| SNF5 protein 52 2e-05
gi|32453015|gb|AAP82656.1| Collagen protein 172, isoform b [Caen... 52 2e-05
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand... 52 2e-05
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand... 52 2e-05
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 52 2e-05
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 52 2e-05
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 52 3e-05
gi|419944|pir||B44982 collagen COLA4 - pig roundworm >gnl|BL_ORD... 51 4e-05
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (... 51 4e-05
gi|38567183|emb|CAE76476.1| related to zinc finger protein crol ... 51 4e-05
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa... 51 4e-05
gi|32422843|ref|XP_331865.1| hypothetical protein [Neurospora cr... 51 4e-05
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ... 51 4e-05
gi|22324231|emb|CAD44395.1| hypothetical protein [Enterococcus f... 51 5e-05
gi|32411243|ref|XP_326102.1| hypothetical protein [Neurospora cr... 50 6e-05
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 50 6e-05
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1 50 6e-05
gi|23479635|gb|EAA16409.1| glutamic acid-rich protein precursor,... 50 6e-05
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 50 6e-05
gi|48763005|ref|ZP_00267562.1| hypothetical protein Rrub02003719... 50 8e-05
gi|42660863|ref|XP_064152.5| sarcalumenin [Homo sapiens] 50 8e-05
gi|47115570|sp|O00841|CUDA_DICDI Putative transcriptional regula... 50 1e-04
gi|28830026|gb|AAO52516.1| similar to Kaposi's sarcoma-associate... 50 1e-04
gi|17543368|ref|NP_501338.1| COLlagen structural gene (col-115) ... 49 1e-04
gi|39595057|emb|CAE70925.1| Hypothetical protein CBG17725 [Caeno... 49 1e-04
gi|79960|pir||JH0204 hypothetical 30.5K protein precursor - Ente... 49 1e-04
gi|49069208|ref|XP_398893.1| hypothetical protein UM01278.1 [Ust... 49 1e-04
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]... 49 1e-04
gi|6680506|ref|NP_032438.1| involucrin [Mus musculus] >gnl|BL_OR... 49 1e-04
gi|14164561|gb|AAK55123.1| Swift [Xenopus laevis] 49 1e-04
gi|32403428|ref|XP_322327.1| predicted protein [Neurospora crass... 49 1e-04
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat... 49 2e-04
gi|46228478|gb|EAK89348.1| hypothetical protein with glutamine r... 49 2e-04
gi|6322796|ref|NP_012869.1| RNAPII degradation factor, forms a c... 49 2e-04
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno... 49 2e-04
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno... 49 2e-04
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 49 2e-04
gi|17551704|ref|NP_508747.1| COLlagen structural gene (33.9 kD) ... 49 2e-04
gi|34865500|ref|XP_345960.1| similar to hypothetical protein [Ra... 49 2e-04
gi|42374898|gb|AAS13449.1| merozoite surface protein 6 [Plasmodi... 49 2e-04
gi|11345234|gb|AAG34655.1| involucrin [Mus musculus] 49 2e-04
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 49 2e-04
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno... 49 2e-04
gi|46227023|gb|EAK87973.1| ubiquitin C-terminal hydrolase of the... 48 3e-04
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi... 48 3e-04
gi|124738|sp|P24711|INVO_TARBA Involucrin >gnl|BL_ORD_ID|1371644... 48 3e-04
gi|50758913|ref|XP_417476.1| PREDICTED: similar to Hypothetical ... 48 3e-04
gi|45515101|ref|ZP_00166657.1| hypothetical protein Raeut561901 ... 48 3e-04
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 48 3e-04
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [... 48 3e-04
gi|29290093|gb|AAO67564.1| Pol protein [Drosophila virilis] 48 3e-04
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ... 48 3e-04
gi|27367908|ref|NP_763435.1| TPR repeat containing protein [Vibr... 48 3e-04
gi|39597872|emb|CAE68564.1| Hypothetical protein CBG14399 [Caeno... 48 3e-04
gi|42374890|gb|AAS13445.1| merozoite surface protein 6 [Plasmodi... 48 4e-04
gi|34854792|ref|XP_218287.2| similar to putative odorant recepto... 48 4e-04
gi|21231078|ref|NP_636995.1| unknown acidic aa rich protein [Xan... 48 4e-04
gi|11346371|pir||T47235 sex determining protein [imported] - wes... 48 4e-04
gi|42374902|gb|AAS13451.1| merozoite surface protein 6 [Plasmodi... 48 4e-04
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis] 48 4e-04
gi|42374896|gb|AAS13448.1| merozoite surface protein 6 [Plasmodi... 48 4e-04
gi|48771947|ref|ZP_00276289.1| hypothetical protein Reut02000697... 48 4e-04
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand... 48 4e-04
gi|11345236|gb|AAG34656.1| involucrin [Mus musculus] 48 4e-04
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 48 4e-04
gi|1684847|gb|AAB48304.1| pinin [Homo sapiens] 47 5e-04
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy... 47 5e-04
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi... 47 5e-04
gi|46444158|gb|EAL03435.1| hypothetical protein CaO19.4998 [Cand... 47 5e-04
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno... 47 5e-04
gi|24286732|gb|AAN46886.1| nucleotide exchange factor RasGEF R [... 47 5e-04
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu... 47 5e-04
gi|24648119|ref|NP_650778.1| CG6026-PA [Drosophila melanogaster]... 47 7e-04
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 47 7e-04
gi|38084908|ref|XP_357051.1| similar to sperm protein SSP3111; s... 47 7e-04
gi|42519751|ref|NP_965681.1| hypothetical protein LJ0574 [Lactob... 47 7e-04
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno... 47 7e-04
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec... 47 7e-04
gi|39597352|emb|CAE59580.1| Hypothetical protein CBG02980 [Caeno... 47 7e-04
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ... 47 7e-04
gi|47214987|emb|CAG01321.1| unnamed protein product [Tetraodon n... 47 9e-04
gi|15242707|ref|NP_198861.1| expressed protein [Arabidopsis thal... 47 9e-04
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi... 47 9e-04
gi|4154097|gb|AAD04750.1| unknown [Human herpesvirus 8] 47 9e-04
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ... 47 9e-04
gi|50550493|ref|XP_502719.1| hypothetical protein [Yarrowia lipo... 47 9e-04
gi|17506747|ref|NP_492013.1| COLlagen structural gene (col-60) [... 47 9e-04
gi|1076839|pir||S49313 protein kinase - slime mold (Dictyosteliu... 47 9e-04
gi|17533645|ref|NP_496367.1| COLlagen structural gene (col-83) [... 47 9e-04
gi|17507951|ref|NP_491958.1| COLlagen structural gene (col-59) [... 47 9e-04
gi|33589138|emb|CAB82206.2| C. elegans COL-83 protein (correspon... 47 9e-04
gi|39595798|emb|CAE67301.1| Hypothetical protein CBG12754 [Caeno... 47 9e-04
gi|11345240|gb|AAG34658.1| involucrin [Mus musculus] 46 0.001
gi|23508149|ref|NP_700819.1| merozoite surface protein 6 [Plasmo... 46 0.001
gi|6325066|ref|NP_015134.1| May be required for packaging pre-mR... 46 0.001
gi|1235750|dbj|BAA07154.1| RNA binding protein [Saccharomyces ce... 46 0.001
gi|42374892|gb|AAS13446.1| merozoite surface protein 6 [Plasmodi... 46 0.001
gi|23507947|ref|NP_700617.1| ADA2-like protein [Plasmodium falci... 46 0.001
gi|23508651|ref|NP_701320.1| hypothetical protein [Plasmodium fa... 46 0.001
gi|39579513|emb|CAE56338.1| Hypothetical protein CBG24007 [Caeno... 46 0.001
gi|25411550|pir||F84514 hypothetical protein At2g14140 [imported... 46 0.001
gi|15600941|ref|NP_232571.1| conserved hypothetical protein [Vib... 46 0.001
gi|11345242|gb|AAG34659.1| involucrin [Mus musculus] 46 0.001
gi|45198327|ref|NP_985356.1| AFL194Wp [Eremothecium gossypii] >g... 46 0.001
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 46 0.001
gi|5924306|gb|AAD56544.1| ADA2-like protein [Plasmodium falciparum] 46 0.001
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 46 0.001
gi|1498641|gb|AAB06444.1| extracellular matrix associated protei... 46 0.001
gi|23396860|sp|P70663|SPL1_MOUSE SPARC-like protein 1 precursor ... 46 0.001
gi|31982800|ref|NP_034227.2| SPARC-like 1 (mast9, hevin); extrac... 46 0.001
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [... 46 0.001
gi|11345238|gb|AAG34657.1| involucrin [Mus musculus] 46 0.001
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [... 46 0.001
gi|786136|gb|AAA99499.1| polymorphic immunodominant molecule 46 0.002
gi|31198353|ref|XP_308124.1| ENSANGP00000017797 [Anopheles gambi... 46 0.002
gi|47213005|emb|CAF95397.1| unnamed protein product [Tetraodon n... 46 0.002
gi|50289215|ref|XP_447038.1| unnamed protein product [Candida gl... 46 0.002
gi|23508379|ref|NP_701048.1| heat shock protein 90, putative [Pl... 46 0.002
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha... 46 0.002
gi|628967|pir||S45091 hypothetical protein iota - Streptococcus ... 46 0.002
gi|39581950|emb|CAE73812.1| Hypothetical protein CBG21362 [Caeno... 46 0.002
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis] 46 0.002
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 46 0.002
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis] 46 0.002
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno... 46 0.002
gi|39598239|emb|CAE68931.1| Hypothetical protein CBG14911 [Caeno... 46 0.002
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (... 46 0.002
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 46 0.002
gi|27882420|gb|AAH44688.1| Ncoa5-prov protein [Xenopus laevis] 45 0.002
gi|17508885|ref|NP_492556.1| complex locus; 3' and 5' of differe... 45 0.002
gi|47208936|emb|CAF90803.1| unnamed protein product [Tetraodon n... 45 0.002
gi|50309575|ref|XP_454799.1| unnamed protein product [Kluyveromy... 45 0.002
gi|31210793|ref|XP_314363.1| ENSANGP00000012739 [Anopheles gambi... 45 0.002
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ... 45 0.002
gi|7486768|pir||T08588 hypothetical protein L23H3.30 - Arabidops... 45 0.002
gi|28850391|gb|AAO53165.1| similar to midasin, a large protein w... 45 0.002
gi|42734273|emb|CAF31485.1| Hypothetical protein T05F1.6 [Caenor... 45 0.002
gi|38049260|gb|AAR10431.1| hypothetical protein [Enterococcus fa... 45 0.002
gi|28377133|ref|NP_784025.1| cell surface protein precursor [Lac... 45 0.002
gi|23508548|ref|NP_701217.1| hypothetical protein [Plasmodium fa... 45 0.002
gi|18418034|ref|NP_567896.1| WD-40 repeat family protein (LEUNIG... 45 0.002
gi|12957024|emb|CAC29194.1| hypothetical protein [Enterococcus f... 45 0.002
gi|11141605|gb|AAG32022.1| LEUNIG [Arabidopsis thaliana] 45 0.002
gi|23510031|ref|NP_702697.1| hypothetical protein [Plasmodium fa... 45 0.002
gi|24641056|ref|NP_572641.1| CG15295-PA [Drosophila melanogaster... 45 0.002
gi|39588000|emb|CAE57231.1| Hypothetical protein CBG00101 [Caeno... 45 0.002
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 45 0.002
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 45 0.002
gi|28828976|gb|AAO51556.1| similar to Plasmodium falciparum. Pro... 45 0.003
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno... 45 0.003
gi|7494765|pir||T29837 hypothetical protein B0222.6 - Caenorhabd... 45 0.003
gi|124734|sp|P14591|INVO_PANPA Involucrin >gnl|BL_ORD_ID|553935 ... 45 0.003
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ... 45 0.003
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 45 0.003
gi|33636671|gb|AAQ23633.1| AT27514p [Drosophila melanogaster] 45 0.003
gi|39590923|emb|CAE58703.1| Hypothetical protein CBG01887 [Caeno... 45 0.003
gi|24653657|ref|NP_725398.1| CG8787-PA [Drosophila melanogaster]... 45 0.003
gi|32565355|ref|NP_491651.2| predicted CDS, COLlagen structural ... 45 0.003
gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10) [... 45 0.003
gi|7505851|pir||T25835 hypothetical protein M01A12.1 - Caenorhab... 45 0.003
gi|39594542|emb|CAE72120.1| Hypothetical protein CBG19216 [Caeno... 45 0.003
gi|39938533|ref|NP_950299.1| conserved hypothetical protein [Oni... 45 0.003
gi|2144790|pir||I37060 involucrin L - gorilla >gnl|BL_ORD_ID|150... 45 0.003
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ... 45 0.003
gi|26000384|gb|AAN75474.1| dentin matrix protein 1 [Pteronotus p... 45 0.003
gi|24461867|gb|AAN62354.1| CTV.22 [Poncirus trifoliata] 45 0.003
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno... 45 0.003
gi|32408173|ref|XP_324568.1| hypothetical protein [Neurospora cr... 45 0.003
gi|7512029|pir||T13748 sex comb protein - fruit fly (Drosophila ... 45 0.003
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp... 45 0.003
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno... 45 0.003
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C... 45 0.003
gi|124731|sp|P07476|INVO_HUMAN Involucrin >gnl|BL_ORD_ID|1848736... 45 0.003
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [... 45 0.003
gi|45185544|ref|NP_983260.1| ACL144Cp [Eremothecium gossypii] >g... 45 0.003
gi|2144789|pir||I37061 involucrin M - gorilla >gnl|BL_ORD_ID|838... 45 0.003
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 45 0.003
gi|15924471|ref|NP_372005.1| elastin binding protein [Staphyloco... 45 0.003
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno... 45 0.003
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno... 45 0.003
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p... 45 0.003
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det... 45 0.003
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd... 45 0.003
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 45 0.003
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ... 45 0.003
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo... 45 0.003
gi|47217435|emb|CAG10204.1| unnamed protein product [Tetraodon n... 45 0.003
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 44 0.004
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ... 44 0.004
gi|50420779|ref|XP_458929.1| unnamed protein product [Debaryomyc... 44 0.004
gi|46320109|ref|ZP_00220502.1| COG1530: Ribonucleases G and E [B... 44 0.004
gi|26000358|gb|AAN75475.1| dentin matrix protein 1 [Myzopoda aur... 44 0.004
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 44 0.004
gi|32410297|ref|XP_325629.1| predicted protein [Neurospora crass... 44 0.004
gi|13173388|gb|AAK14386.1| lysine/glutamic acid-rich protein [Ca... 44 0.004
gi|47208417|emb|CAF92198.1| unnamed protein product [Tetraodon n... 44 0.004
gi|28828961|gb|AAO51542.1| similar to Dictyostelium discoideum (... 44 0.004
gi|15238181|ref|NP_198994.1| COP1-interactive protein 1 / CIP1 [... 44 0.004
gi|39596499|emb|CAE63118.1| Hypothetical protein CBG07415 [Caeno... 44 0.004
gi|39593374|emb|CAE64844.1| Hypothetical protein CBG09640 [Caeno... 44 0.004
gi|50551605|ref|XP_503277.1| hypothetical protein [Yarrowia lipo... 44 0.004
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C... 44 0.004
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ... 44 0.004
gi|38089141|ref|XP_146248.3| MYST histone acetyltransferase (mon... 44 0.004
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 44 0.004
gi|42733783|gb|AAS38704.1| similar to Dictyostelium discoideum (... 44 0.004
gi|71414|pir||CGBO2S collagen alpha 2(I) chain - bovine (fragment) 44 0.004
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 44 0.004
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ... 44 0.004
gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54) [... 44 0.004
gi|42733801|gb|AAS38719.1| similar to Dictyostelium discoideum (... 44 0.004
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 44 0.004
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 44 0.004
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 44 0.004
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 44 0.004
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 44 0.004
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 44 0.004
gi|39596084|emb|CAE69720.1| Hypothetical protein CBG15991 [Caeno... 44 0.004
gi|6110362|gb|AAF03788.1| Traf2 and NCK interacting kinase, spli... 44 0.006
gi|20521083|dbj|BAA25477.2| KIAA0551 protein [Homo sapiens] 44 0.006
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster... 44 0.006
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna... 44 0.006
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ... 44 0.006
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 44 0.006
gi|437639|gb|AAA72295.1| [Plasmodium falciparum 3' end.], gene p... 44 0.006
gi|6110352|gb|AAF03784.1| Traf2 and NCK interacting kinase, spli... 44 0.006
gi|23612220|ref|NP_703800.1| myosin-like protein, putative [Plas... 44 0.006
gi|23619293|ref|NP_705255.1| reticulocyte binding protein 2 homo... 44 0.006
gi|13345187|gb|AAK19244.1| reticulocyte binding protein 2 homolo... 44 0.006
gi|50417567|gb|AAH77588.1| K14 protein [Xenopus laevis] 44 0.006
gi|24649755|ref|NP_651279.1| CG13627-PA [Drosophila melanogaster... 44 0.006
gi|6110355|gb|AAF03785.1| Traf2 and NCK interacting kinase, spli... 44 0.006
gi|25012526|gb|AAN71366.1| RE32656p [Drosophila melanogaster] 44 0.006
gi|29728547|ref|XP_039796.7| KIAA0551 protein [Homo sapiens] >gn... 44 0.006
gi|45551964|ref|NP_733032.2| CG13627-PB [Drosophila melanogaster... 44 0.006
gi|26356668|dbj|BAC24997.1| unnamed protein product [Mus musculus] 44 0.006
gi|50551493|ref|XP_503220.1| hypothetical protein [Yarrowia lipo... 44 0.006
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g... 44 0.006
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 44 0.006
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 44 0.006
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 44 0.006
gi|40849890|gb|AAR95657.1| plectin 3 [Rattus norvegicus] 44 0.008
gi|50306605|ref|XP_453276.1| unnamed protein product [Kluyveromy... 44 0.008
gi|32403550|ref|XP_322388.1| hypothetical protein [Neurospora cr... 44 0.008
gi|34856763|ref|XP_215530.2| similar to misshapen/NIK-related ki... 44 0.008
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 44 0.008
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ... 44 0.008
gi|40849904|gb|AAR95664.1| plectin 10 [Rattus norvegicus] 44 0.008
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ... 44 0.008
gi|40849906|gb|AAR95665.1| plectin 11 [Rattus norvegicus] 44 0.008
gi|40849900|gb|AAR95662.1| plectin 8 [Rattus norvegicus] 44 0.008
gi|40849892|gb|AAR95658.1| plectin 4 [Rattus norvegicus] >gnl|BL... 44 0.008
gi|21283098|ref|NP_646186.1| elastin binding protein [Staphyloco... 44 0.008
gi|13021654|gb|AAK11505.1| procollagen alpha1(III) [Xenopus laevis] 44 0.008
gi|24659567|ref|NP_648056.1| CG10107-PA [Drosophila melanogaster... 44 0.008
gi|40849886|gb|AAR95655.1| plectin 1 [Rattus norvegicus] 44 0.008
gi|40849888|gb|AAR95656.1| plectin 2 [Rattus norvegicus] 44 0.008
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ... 44 0.008
gi|30689268|ref|NP_173925.3| phytochrome and flowering time regu... 44 0.008
gi|4379341|emb|CAA08789.1| fibrillar collagen [Podocoryne carnea] 44 0.008
gi|26000366|gb|AAN75481.1| dentin matrix protein 1 [Desmodus rot... 44 0.008
gi|40849896|gb|AAR95660.1| plectin 6 [Rattus norvegicus] 44 0.008
gi|20066260|gb|AAM09367.1| similar to Dictyostelium discoideum (... 44 0.008
gi|17506297|ref|NP_492086.1| COLlagen structural gene (col-35) [... 44 0.008
gi|32566102|ref|NP_508100.2| COLlagen structural gene (col-19) [... 44 0.008
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >... 44 0.008
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa... 44 0.008
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi] 44 0.008
gi|46434724|gb|EAK94126.1| hypothetical protein CaO19.2410 [Cand... 44 0.008
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno... 44 0.008
gi|28569857|dbj|BAC57901.1| gag-like protein [Anopheles gambiae] 44 0.008
gi|13540714|ref|NP_071796.1| plectin [Rattus norvegicus] >gnl|BL... 44 0.008
gi|40849898|gb|AAR95661.1| plectin 7 [Rattus norvegicus] 44 0.008
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA... 44 0.008
gi|17566482|ref|NP_507901.1| plasmodium falciparum trophozoite a... 44 0.008
gi|50750041|ref|XP_421846.1| PREDICTED: similar to procollagen t... 44 0.008
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ... 44 0.008
gi|20152065|gb|AAM11392.1| RE06823p [Drosophila melanogaster] 44 0.008
gi|18858039|ref|NP_572400.1| CG15478-PA [Drosophila melanogaster... 44 0.008
gi|50421413|ref|XP_459257.1| unnamed protein product [Debaryomyc... 44 0.008
gi|46434778|gb|EAK94179.1| hypothetical protein CaO19.9948 [Cand... 44 0.008
gi|25518714|pir||G86385 hypothetical protein F2J7.4 [imported] -... 44 0.008
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli... 44 0.008
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 44 0.008
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 44 0.008
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 44 0.008
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 44 0.008
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 44 0.008
gi|584868|sp|P17140|CA24_CAEEL Collagen alpha 2(IV) chain precur... 43 0.010
gi|17568911|ref|NP_510664.1| CoLlagen, Basement membrane type, L... 43 0.010
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno... 43 0.010
gi|23509422|ref|NP_702089.1| hypothetical protein [Plasmodium fa... 43 0.010
gi|39593739|emb|CAE62032.1| Hypothetical protein CBG06046 [Caeno... 43 0.010
gi|47228710|emb|CAG07442.1| unnamed protein product [Tetraodon n... 43 0.010
gi|47222238|emb|CAG11117.1| unnamed protein product [Tetraodon n... 43 0.010
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ... 43 0.010
gi|953173|emb|CAA80537.1| a2(IV) collagen [Caenorhabditis elegans] 43 0.010
gi|17568913|ref|NP_510663.1| CoLlagen, Basement membrane type, L... 43 0.010
gi|48825238|ref|ZP_00286509.1| COG1196: Chromosome segregation A... 43 0.010
gi|134874|sp|P16230|SRCH_RABIT Sarcoplasmic reticulum histidine-... 43 0.010
gi|732526|gb|AAA64312.1| alpha2(IV) collagen 43 0.010
gi|45554124|ref|NP_996345.1| CG32776-PB [Drosophila melanogaster... 43 0.010
gi|121857|sp|P20398|GV7_XENLA Developmental protein xLGV7 >gnl|B... 43 0.010
gi|27806661|ref|NP_776463.1| dentin matrix acidic phosphoprotein... 43 0.010
gi|50258980|gb|EAL21661.1| hypothetical protein CNBC6970 [Crypto... 43 0.010
gi|28830050|gb|AAO52540.1| similar to Entamoeba histolytica. Myo... 43 0.010
gi|17570601|ref|NP_509692.1| COLlagen structural gene (28.7 kD) ... 43 0.010
gi|28573157|ref|NP_731291.2| CG31349-PA [Drosophila melanogaster... 43 0.010
gi|28829971|gb|AAO52461.1| similar to Plasmodium falciparum. Hyp... 43 0.010
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno... 43 0.010
gi|45185072|ref|NP_982789.1| ABL158Cp [Eremothecium gossypii] >g... 43 0.010
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri... 43 0.010
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno... 43 0.010
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 43 0.010
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno... 43 0.010
gi|32422023|ref|XP_331455.1| hypothetical protein [Neurospora cr... 43 0.010
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 43 0.010
gi|37676035|ref|NP_936431.1| TPR repeat containing protein [Vibr... 43 0.010
gi|32421759|ref|XP_331323.1| hypothetical protein [Neurospora cr... 43 0.010
gi|39593742|emb|CAE62035.1| Hypothetical protein CBG06051 [Caeno... 43 0.010
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 43 0.010
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 43 0.010
gi|17557099|ref|NP_499700.1| COLlagen structural gene (30.3 kD) ... 43 0.010
gi|39588941|emb|CAE69571.1| Hypothetical protein CBG15783 [Caeno... 43 0.010
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 43 0.010
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 43 0.010
gi|11423493|ref|XP_001677.1| similar to Involucrin [Homo sapiens... 43 0.013
gi|423123|pir||S33124 tpr protein - human 43 0.013
gi|39930375|ref|NP_060682.2| enabled homolog [Homo sapiens] >gnl... 43 0.013
gi|38102578|gb|EAA49399.1| hypothetical protein MG01057.4 [Magna... 43 0.013
gi|42784018|ref|NP_981265.1| S-layer homology domain protein [Ba... 43 0.013
gi|48428086|sp|Q8N8S7|ENAH_HUMAN Enabled protein homolog >gnl|BL... 43 0.013
gi|39588149|emb|CAE68073.1| Hypothetical protein CBG13703 [Caeno... 43 0.013
gi|15238640|ref|NP_197870.1| expressed protein [Arabidopsis thal... 43 0.013
gi|39580381|emb|CAE71741.1| Hypothetical protein CBG18725 [Caeno... 43 0.013
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can... 43 0.013
gi|40850918|gb|AAH65238.1| ENAH protein [Homo sapiens] 43 0.013
gi|4507659|ref|NP_003283.1| translocated promoter region (to act... 43 0.013
gi|34856350|ref|XP_344903.1| similar to nucleosome binding prote... 43 0.013
gi|31207045|ref|XP_312489.1| ENSANGP00000021340 [Anopheles gambi... 43 0.013
gi|50288457|ref|XP_446658.1| unnamed protein product [Candida gl... 43 0.013
gi|13435127|ref|NP_079504.1| TRAF3-interacting JNK-activating mo... 43 0.013
gi|23613570|ref|NP_704591.1| E1-E2_ATPase/hydrolase, putative [P... 43 0.013
gi|39583277|emb|CAE60069.1| Hypothetical protein CBG03586 [Caeno... 43 0.013
gi|6678908|ref|NP_032639.1| meiosis-specific nuclear structural ... 43 0.013
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ... 43 0.013
gi|17509325|ref|NP_491190.1| MDIG like (86.0 kD) (1E200) [Caenor... 43 0.013
gi|39594465|emb|CAE72043.1| Hypothetical protein CBG19125 [Caeno... 43 0.013
gi|21755689|dbj|BAC04736.1| unnamed protein product [Homo sapiens] 43 0.013
gi|38173761|gb|AAH60753.1| MGC69046 protein [Xenopus laevis] 43 0.013
gi|32417560|ref|XP_329258.1| predicted protein [Neurospora crass... 43 0.013
>gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181)
[Caenorhabditis elegans]
gi|13548415|emb|CAA91544.2| Hypothetical protein W03G11.1
[Caenorhabditis elegans]
Length = 332
Score = 411 bits (1057), Expect = e-113
Identities = 223/332 (67%), Positives = 223/332 (67%)
Frame = +1
Query: 1 MRAKRRRLSIHKTILCNVSVTINSYPQSELYIKAGDVTSNVSVPSFLLFSKMTMDKKFET 180
MRAKRRRLSIHKTILCNVSVTINSYPQSELYIKAGDVTSNVSVPSFLLFSKMTMDKKFET
Sbjct: 1 MRAKRRRLSIHKTILCNVSVTINSYPQSELYIKAGDVTSNVSVPSFLLFSKMTMDKKFET 60
Query: 181 EKVKRFAFFGIAVSTVSTLTAIVAVPMLCLYLQSVSSSLQDEVNFCRVRATSLEGELAKL 360
EKVKRFAFFGIAVSTVSTLTAIVAVPMLCLYLQSVSSSLQDEVNFCRVRATSLEGELAKL
Sbjct: 61 EKVKRFAFFGIAVSTVSTLTAIVAVPMLCLYLQSVSSSLQDEVNFCRVRATSLEGELAKL 120
Query: 361 NVVRAPRKARAAEGTXXXXXXXXXXXXXXXXXXXXXXKDGSNGRPGNPGEDADGDDYKPD 540
NVVRAPRKARAAEGT KDGSNGRPGNPGEDADGDDYKPD
Sbjct: 121 NVVRAPRKARAAEGTCCSCGVGSAGPPGPPGFDGSAGKDGSNGRPGNPGEDADGDDYKPD 180
Query: 541 ASQFCFDCXXXXXXXXXXXXXXXXXXXXXXXXXXXLXXXXXXXXXXXXXXXXXXXXXDGP 720
ASQFCFDC L DGP
Sbjct: 181 ASQFCFDCPEAPAGPPGRPGPDGENGGAGEPGRDGLAGRPGARGSPGPRGPSGNPGADGP 240
Query: 721 AGQLGPQGGSNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENGPDGAPG 900
AGQLGPQGGSNV ENGPDGAPG
Sbjct: 241 AGQLGPQGGSNVAPSPAGEPGAPGAQGPKGPPGAAGRPGRDGQPGAPGDQGENGPDGAPG 300
Query: 901 KSGSDGQPGAPGKEGSRGGCDHCPPPRTAPGY 996
KSGSDGQPGAPGKEGSRGGCDHCPPPRTAPGY
Sbjct: 301 KSGSDGQPGAPGKEGSRGGCDHCPPPRTAPGY 332