Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= W04E12_7
         (966 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17565058|ref|NP_507829.1| versican precursor family member (3...   612   e-174
gi|17557916|ref|NP_507547.1| versican precursor family member (5...   596   e-169
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe...   538   e-152
gi|39581146|emb|CAE71003.1| Hypothetical protein CBG17839 [Caeno...   523   e-147
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno...   176   5e-43
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb...   172   1e-41
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f...   164   2e-39
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb...   158   2e-37
gi|17553354|ref|NP_497168.1| predicted CDS, C type lectin (3A790...   109   1e-22
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep...   107   5e-22
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma...   100   4e-20
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n...   100   5e-20
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens]                     99   1e-19
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]...    99   1e-19
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ...    99   1e-19
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ...    99   1e-19
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens]            98   2e-19
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti...    98   2e-19
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens]    98   2e-19
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le...    97   4e-19
gi|34877265|ref|XP_225585.2| similar to macrophage mannose recep...    95   2e-18
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor...    94   5e-18
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;...    94   5e-18
gi|6678932|ref|NP_032651.1| mannose receptor, C type 1 [Mus musc...    94   6e-18
gi|477362|pir||A48925 mannose receptor precursor, macrophage - m...    94   6e-18
gi|50732401|ref|XP_418618.1| PREDICTED: similar to Macrophage ma...    94   6e-18
gi|47218860|emb|CAG02845.1| unnamed protein product [Tetraodon n...    92   2e-17
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno...    91   3e-17
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa]            89   1e-16
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris]    88   3e-16
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica]        87   6e-16
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma...    87   7e-16
gi|46195838|ref|NP_996866.1| yolk sac IgY receptor [Gallus gallu...    85   2e-15
gi|47230595|emb|CAF99788.1| unnamed protein product [Tetraodon n...    84   5e-15
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]...    84   6e-15
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus]                      84   6e-15
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ...    83   8e-15
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ...    83   8e-15
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ...    83   8e-15
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat...    83   8e-15
gi|47564066|ref|NP_001001158.1| DEC-205/CD205 protein [Bos tauru...    82   1e-14
gi|50750535|ref|XP_422038.1| PREDICTED: similar to Lymphocyte an...    82   1e-14
gi|39593681|emb|CAE61973.1| Hypothetical protein CBG05976 [Caeno...    82   1e-14
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus]                 82   2e-14
gi|32565327|ref|NP_494426.2| c-type lectin and CUB domain contai...    82   2e-14
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B...    82   2e-14
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica]        81   4e-14
gi|47230594|emb|CAF99787.1| unnamed protein product [Tetraodon n...    80   7e-14
gi|34013700|gb|AAQ56013.1| lectin protein type II [Hippocampus c...    80   7e-14
gi|26340010|dbj|BAC33668.1| unnamed protein product [Mus musculus]     80   9e-14
gi|37360054|dbj|BAC98005.1| mKIAA0709 protein [Mus musculus]           80   9e-14
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (...    79   1e-13
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ...    79   1e-13
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi...    79   2e-13
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [...    79   2e-13
gi|47228322|emb|CAG07717.1| unnamed protein product [Tetraodon n...    79   2e-13
gi|39590314|emb|CAE66053.1| Hypothetical protein CBG11254 [Caeno...    79   2e-13
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote...    79   2e-13
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [...    79   2e-13
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga...    78   3e-13
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|...    77   4e-13
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens]        77   4e-13
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ...    77   4e-13
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus]        77   4e-13
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr...    77   4e-13
gi|833853|gb|AAA67565.1| versican V2 core protein precursor            77   4e-13
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ...    77   4e-13
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID...    77   4e-13
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ...    77   4e-13
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p...    77   4e-13
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens]        77   4e-13
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ...    77   4e-13
gi|47213064|emb|CAF91578.1| unnamed protein product [Tetraodon n...    77   8e-13
gi|47228554|emb|CAG05374.1| unnamed protein product [Tetraodon n...    76   1e-12
gi|45259478|dbj|BAD12391.1| aggrecan [Danio rerio]                     76   1e-12
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec...    75   2e-12
gi|4808979|gb|AAD30040.1| receptor protein-tyrosine kinase; HTK2...    75   2e-12
gi|34013702|gb|AAQ56014.1| lectin protein type III [Hippocampus ...    75   3e-12
gi|39590308|emb|CAE66047.1| Hypothetical protein CBG11247 [Caeno...    74   5e-12
gi|34146972|gb|AAB37037.2| Hypothetical protein F52E1.2 [Caenorh...    74   5e-12
gi|28981404|gb|AAH48780.1| Similar to phospholipase A2, group IB...    74   6e-12
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas...    74   6e-12
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor...    74   6e-12
gi|17544700|ref|NP_502450.1| serum lectin like precursor family ...    73   8e-12
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_...    73   8e-12
gi|47214539|emb|CAG04559.1| unnamed protein product [Tetraodon n...    73   8e-12
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g...    73   1e-11
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens]          73   1e-11
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul...    73   1e-11
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_...    73   1e-11
gi|34013698|gb|AAQ56012.1| lectin protein type I [Hippocampus co...    73   1e-11
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s...    72   1e-11
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu...    72   1e-11
gi|47551177|ref|NP_999773.1| sperm receptor for egg jelly [Stron...    72   1e-11
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE...    72   1e-11
gi|26349637|dbj|BAC38458.1| unnamed protein product [Mus musculus]     72   2e-11
gi|39579883|emb|CAE56619.1| Hypothetical protein CBG24375 [Caeno...    72   2e-11
gi|17554488|ref|NP_497312.1| pancreatitis-associated protein pre...    72   2e-11
gi|25395663|pir||B88392 protein R06B10.3 [imported] - Caenorhabd...    72   2e-11
gi|7804476|dbj|BAA95671.1| C-type lectin [Cyprinus carpio]             72   2e-11
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n...    72   2e-11
gi|34555878|emb|CAB04417.2| Hypothetical protein F49A5.5 [Caenor...    71   3e-11
gi|691753|dbj|BAA06444.1| phospholipase A2 receptor [Homo sapiens]     71   3e-11
gi|39583088|emb|CAE60628.1| Hypothetical protein CBG04271 [Caeno...    71   4e-11
gi|28628340|gb|AAO43607.1| serum lectin isoform 3 precursor [Sal...    71   4e-11
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ...    70   5e-11
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic...    70   5e-11
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (...    70   5e-11
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr...    70   5e-11
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA...    70   5e-11
gi|28628336|gb|AAO43605.1| serum lectin isoform 1 precursor [Sal...    70   5e-11
gi|28628338|gb|AAO43606.1| serum lectin isoform 2 precursor [Sal...    70   5e-11
gi|28628334|gb|AAO43604.1| serum lectin isoform 5 precursor [Sal...    70   5e-11
gi|28628342|gb|AAO43608.1| serum lectin isoform 4 precursor [Sal...    70   5e-11
gi|181168|gb|AAA35726.1| proteoglycan core protein                     70   5e-11
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ...    70   7e-11
gi|290002|gb|AAA49200.1| antifreeze protein >gnl|BL_ORD_ID|11388...    70   7e-11
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro...    70   7e-11
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus]                       70   7e-11
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n...    70   7e-11
gi|17561226|ref|NP_505170.1| IgE receptor precursor (5I887) [Cae...    70   7e-11
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo...    70   7e-11
gi|32469212|dbj|BAC78902.1| C-type lectin [Echidna delicatula]         70   9e-11
gi|39586804|emb|CAE65847.1| Hypothetical protein CBG10980 [Caeno...    70   9e-11
gi|1083928|pir||JP0075 lectin CEL-IV, C-type - Cucumaria echinat...    70   9e-11
gi|13810902|gb|AAK40085.1| brevican soluble core protein precurs...    70   9e-11
gi|39586019|emb|CAE69095.1| Hypothetical protein CBG15117 [Caeno...    70   9e-11
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus]                     70   9e-11
gi|1143285|gb|AAA87847.1| brevican core protein                        70   9e-11
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_...    70   9e-11
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr...    69   1e-10
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B...    69   2e-10
gi|1352705|sp|P49260|PA2R_RABIT 180 kDa secretory phospholipase ...    69   2e-10
gi|47225543|emb|CAG12026.1| unnamed protein product [Tetraodon n...    69   2e-10
gi|691755|dbj|BAA06445.1| phospholipase A2 receptor [Rattus sp.]       69   2e-10
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus]     69   2e-10
gi|4808975|gb|AAD30038.1| receptor protein-tyrosine kinase; HTK2...    69   2e-10
gi|17544698|ref|NP_502451.1| phospholipase A2 receptor precursor...    67   5e-10
gi|211655|gb|AAA48720.1| proteoglycan core protein                     67   5e-10
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co...    67   5e-10
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ...    67   5e-10
gi|10120636|pdb|1EGG|A Chain A, Structure Of A C-Type Carbohydra...    67   6e-10
gi|206105|gb|AAA41836.1| proteoglycan                                  67   6e-10
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr...    67   6e-10
gi|129887|sp|P07897|PGCA_RAT Aggrecan core protein precursor (Ca...    67   6e-10
gi|6671523|ref|NP_031450.1| aggrecan 1; aggrecan, structural pro...    67   6e-10
gi|47217439|emb|CAG10208.1| unnamed protein product [Tetraodon n...    67   8e-10
gi|4808977|gb|AAD30039.1| receptor protein-tyrosine kinase; HTK2...    67   8e-10
gi|38373928|gb|AAR19205.1| type II transmembrane C-type lectin [...    66   1e-09
gi|26000685|gb|AAN75192.1| C-type lectin [Carassius auratus]           66   1e-09
gi|17531345|ref|NP_494427.1| predicted CDS, c-type lectin and CU...    65   2e-09
gi|7959947|gb|AAF71144.1| low-affinity IgE receptor; CD23 [Equus...    65   2e-09
gi|39579732|emb|CAE56482.1| Hypothetical protein CBG24196 [Caeno...    65   3e-09
gi|39586117|emb|CAE69193.1| Hypothetical protein CBG15230 [Caeno...    65   3e-09
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno...    64   4e-09
gi|113926|sp|P05140|ANP_HEMAM Type II antifreeze protein precurs...    64   4e-09
gi|17551160|ref|NP_509202.1| lithostathine like precursor family...    64   4e-09
gi|213876|gb|AAA49618.1| antifreeze protein                            64   4e-09
gi|7674107|sp|Q9YGP1|LECG_TRIST Galactose-binding lectin precurs...    64   4e-09
gi|39588702|emb|CAE58226.1| Hypothetical protein CBG01323 [Caeno...    64   4e-09
gi|6729952|pdb|2AFP|A Chain A, The Solution Structure Of Type Ii...    64   4e-09
gi|213874|gb|AAA49617.1| antifreeze polypeptide (AFP) precursor        64   4e-09
gi|39588321|emb|CAE72672.1| Hypothetical protein CBG19888 [Caeno...    64   5e-09
gi|5764609|gb|AAD51335.1| CD23 homolog [Ancylostoma ceylanicum]        64   5e-09
gi|47219432|emb|CAG10796.1| unnamed protein product [Tetraodon n...    64   5e-09
gi|17542436|ref|NP_500843.1| core protein (4G419) [Caenorhabditi...    64   5e-09
gi|85534|pir||JH0626 antifreeze protein II precursor - rainbow s...    64   5e-09
gi|4808981|gb|AAD30041.1| receptor protein-tyrosine kinase; HTK2...    64   5e-09
gi|32469210|dbj|BAC78901.1| C-type lectin [Gymnothorax flavimarg...    64   7e-09
gi|20196239|dbj|BAB47156.2| skin mucus 31.7 kDa lectin AJL-2 [An...    64   7e-09
gi|399040|sp|Q01758|ANP_OSMMO Type II antifreeze protein precurs...    64   7e-09
gi|47215081|emb|CAG04535.1| unnamed protein product [Tetraodon n...    64   7e-09
gi|20385163|gb|AAM21196.1| C-type mannose-binding lectin [Oncorh...    63   9e-09
gi|13236931|gb|AAB28793.2| low affinity IgE Fc receptor isoform ...    63   9e-09
gi|13236929|gb|AAB28791.2| low affinity IgE Fc receptor isoform ...    63   9e-09
gi|47227540|emb|CAG04688.1| unnamed protein product [Tetraodon n...    63   9e-09
gi|18476520|gb|AAL58516.1| Fc epsilon receptor II subtype b vari...    63   9e-09
gi|18476522|gb|AAL58517.1| Fc epsilon receptor II subtype b vari...    63   9e-09
gi|25090912|sp|P82596|PLC_HALLA Perlucin                               63   9e-09
gi|13236930|gb|AAB28792.2| low affinity IgE Fc receptor isoform ...    63   9e-09
gi|41353970|gb|AAS01426.1| C-type lectin [Bothrops insularis]          63   9e-09
gi|37537732|gb|AAQ92957.1| BJcuL precursor [Bothrops jararacussu]      63   9e-09
gi|560482|emb|CAA45532.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m...    63   9e-09
gi|7305051|ref|NP_038545.1| Fc receptor, IgE, low affinity II, a...    63   9e-09
gi|560484|emb|CAA45533.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m...    63   9e-09
gi|16758588|ref|NP_446205.1| C-type lectin, superfamily member 1...    63   1e-08
gi|11277030|pir||S78774 perlucin - Haliotis laevigata                  62   1e-08
gi|47203231|emb|CAF92548.1| unnamed protein product [Tetraodon n...    62   2e-08
gi|17559516|ref|NP_504865.1| c-type lectin and CUB domain contai...    62   2e-08
gi|50747976|ref|XP_421065.1| PREDICTED: similar to eosinophil ma...    62   3e-08
gi|34877879|ref|XP_341575.1| similar to collectin placenta 1 [Ra...    62   3e-08
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8...    62   3e-08
gi|17561194|ref|NP_507261.1| c-type lectin family member (5R343)...    62   3e-08
gi|13876737|gb|AAK43585.1| C-type lectin-like protein 2 [Bungaru...    62   3e-08
gi|47215901|emb|CAG12293.1| unnamed protein product [Tetraodon n...    62   3e-08
gi|19424220|ref|NP_598234.1| Fc receptor, IgE, low affinity II, ...    61   3e-08
gi|19070849|gb|AAL84004.1| CD23 [Rattus norvegicus]                    61   3e-08
gi|32396016|gb|AAP42417.1| c-type lectin [Bothrops jararacussu]        61   4e-08
gi|17552510|ref|NP_498023.1| predicted CDS, c-type lectin and CU...    61   4e-08
gi|34922643|sp|Q9PSM4|LECG_LACST Galactose-specific lectin (Muti...    61   4e-08
gi|39590313|emb|CAE66052.1| Hypothetical protein CBG11253 [Caeno...    60   6e-08
gi|34003|emb|CAA28465.1| unnamed protein product [Homo sapiens]        60   6e-08
gi|20149533|ref|NP_001993.2| Fc fragment of IgE, low affinity II...    60   6e-08
gi|39585191|emb|CAE57434.1| Hypothetical protein CBG00395 [Caeno...    60   6e-08
gi|32450274|gb|AAH53817.1| MGC64513 protein [Xenopus laevis]           60   6e-08
gi|17565466|ref|NP_507951.1| lithostathine like family member (5...    60   7e-08
gi|31560464|ref|NP_058031.2| C-type lectin, superfamily member 1...    60   7e-08
gi|2497642|sp|P70194|KUCR_MOUSE C-type lectin 13 (Kupffer cell r...    60   7e-08
gi|1514645|emb|CAA42701.1| cartilage aggregating proteoglycan [S...    60   7e-08
gi|47551241|ref|NP_999805.1| C-type lectin domain protein; SpC-l...    60   7e-08
gi|26335321|dbj|BAC31361.1| unnamed protein product [Mus musculus]     60   1e-07
gi|21901969|dbj|BAC05523.1| collectin placenta 1 [Mus musculus] ...    60   1e-07
gi|47551311|ref|NP_999836.1| echinoidin [Strongylocentrotus purp...    60   1e-07
gi|39581281|emb|CAE60027.1| Hypothetical protein CBG03533 [Caeno...    60   1e-07
gi|17538888|ref|NP_503095.1| predicted CDS, c-type lectin family...    59   1e-07
gi|34922459|sp|P83519|LECG_BOTJR Galactose-specific lectin (BJcuL)     59   1e-07
gi|12841992|dbj|BAB25429.1| unnamed protein product [Mus musculu...    59   1e-07
gi|13385824|ref|NP_080604.1| regenerating islet-derived family, ...    59   1e-07
gi|10445213|gb|AAG16631.1| proteoglycan PG-M V3 isoform [Rattus ...    59   1e-07
gi|39586314|emb|CAE66725.1| Hypothetical protein CBG12071 [Caeno...    59   1e-07
gi|16923223|gb|AAL29940.1| lectin 1 [Girardia tigrina]                 59   1e-07
gi|7497641|pir||T20063 hypothetical protein C49C3.13 - Caenorhab...    59   2e-07
gi|625318|pir||LNRC1 lectin BRA3-1 precursor - barnacle (Megabal...    59   2e-07
gi|34870066|ref|XP_221788.2| similar to SIGNR1 alpha [Rattus nor...    59   2e-07
gi|46396750|sp|P83514|STR1_STRCA Struthiocalcin-1 (SCA-1)              59   2e-07
gi|32566191|ref|NP_503091.2| c-type lectin family member (4S295)...    59   2e-07
gi|126130|sp|P21963|LECG_CROAT Galactose-specific lectin >gnl|BL...    59   2e-07
gi|126127|sp|P06027|LECE_ANTCR Echinoidin >gnl|BL_ORD_ID|1193382...    58   3e-07
gi|17554010|ref|NP_497267.1| predicted CDS, receptor II (3B447) ...    58   3e-07
gi|57839|emb|CAA31574.1| unnamed protein product [Rattus sp.]          58   4e-07
gi|225342|prf||1301209A lectin                                         58   4e-07
gi|20273044|gb|AAF26286.2| agkisacutacin A chain [Deinagkistrodo...    58   4e-07
gi|6707084|gb|AAF25588.1| low-affinity IgE receptor [Bos taurus]       58   4e-07
gi|625317|pir||LNRC3 lectin BRA3-2 precursor - barnacle (Megabal...    58   4e-07
gi|1730116|sp|P07439|LEC3_MEGRO Lectin BRA-3 precursor >gnl|BL_O...    58   4e-07
gi|34870118|ref|XP_221808.2| similar to DC-SIGN [Rattus norvegicus]    58   4e-07
gi|2134244|pir||JC5058 bitiscetin alpha chain - puff adder >gnl|...    58   4e-07
gi|50418093|gb|AAH77648.1| Unknown (protein for MGC:86525) [Xeno...    58   4e-07
gi|17506207|ref|NP_493162.1| c-type lectin and CUB domain contai...    57   5e-07
gi|18485494|ref|NP_569716.1| collectin sub-family member 12 [Mus...    57   5e-07
gi|7657291|ref|NP_056532.1| CD207 antigen, langerin; Langerhans ...    57   6e-07
gi|3378108|gb|AAC28441.1| secreted lectin homolog; HeEL-1 [Helio...    57   6e-07
gi|21553093|ref|NP_660119.1| macrophage galactose N-acetyl-galac...    57   6e-07
gi|9910162|ref|NP_064332.1| C-type lectin, superfamily member 9 ...    57   6e-07
gi|14719570|pdb|1IOD|A Chain A, Crystal Structure Of The Complex...    57   6e-07
gi|464483|sp|P35242|PSPA_MOUSE Pulmonary surfactant-associated p...    57   8e-07
gi|31543691|ref|NP_075623.2| surfactant associated protein A; su...    57   8e-07
gi|444733|prf||1908183A surfactant-associated protein SP-A             57   8e-07
gi|11277028|pir||JC7134 agkisacutacin alpha chain precursor - sh...    57   8e-07
gi|3212622|pdb|1TN3|  The C-Type Lectin Carbohydrate Recognition...    57   8e-07
gi|4507557|ref|NP_003269.1| tetranectin (plasminogen binding pro...    57   8e-07
gi|18426875|ref|NP_550435.1| asialoglycoprotein receptor 2 isofo...    57   8e-07
gi|33328316|gb|AAQ09608.1| HBxAg-binding protein [Homo sapiens]        57   8e-07
gi|38174325|gb|AAH61096.1| Unknown (protein for MGC:74214) [Mus ...    57   8e-07
gi|31212725|ref|XP_315347.1| ENSANGP00000020910 [Anopheles gambi...    57   8e-07
gi|4502253|ref|NP_001172.1| asialoglycoprotein receptor 2 isofor...    57   8e-07
gi|18426877|ref|NP_550436.1| asialoglycoprotein receptor 2 isofo...    57   8e-07
gi|2781225|pdb|1HTN|  Human Tetranectin, A Trimeric Plasminogen ...    57   8e-07
gi|34870122|ref|XP_221790.2| similar to SIGNR4 [Rattus norvegicus]     56   1e-06
gi|34922645|sp|Q9PSN0|LECG_BITAR Galactose-specific lectin (PAL)...    56   1e-06
gi|8394337|ref|NP_059025.1| pulmonary surfactant-associated glyc...    56   1e-06
gi|1709873|sp|P08427|PSPA_RAT Pulmonary surfactant-associated pr...    56   1e-06
gi|47208698|emb|CAF89942.1| unnamed protein product [Tetraodon n...    56   1e-06
gi|33341184|gb|AAQ15153.1| factor IX/X binding protein alpha cha...    56   1e-06
gi|19584340|emb|CAD28466.1| hypothetical protein [Homo sapiens]        55   2e-06
gi|16660119|gb|AAL27539.1| DC-SIGN neck-less isoform [Mus musculus]    55   2e-06
gi|18641360|ref|NP_569057.1| collectin sub-family member 12 isof...    55   2e-06
gi|25392184|pir||JC7595 scavenger receptor with C-type lectin ty...    55   2e-06
gi|38174510|gb|AAH60789.1| Collectin sub-family member 12, isofo...    55   2e-06
gi|18875404|ref|NP_573501.1| CD209a antigen [Mus musculus] >gnl|...    55   2e-06
gi|33341210|gb|AAQ15166.1| stejaggregin-A alpha chain [Trimeresu...    55   2e-06
gi|48375116|gb|AAT42221.1| mannan-binding C-type lectin [Stichop...    55   2e-06
gi|25245527|gb|AAN72437.1| flavocetin-A beta chain [Trimeresurus...    55   2e-06
gi|39654792|pdb|1R13|A Chain A, Carbohydrate Recognition And Nec...    55   2e-06
gi|17568961|ref|NP_508518.1| conglutinin like family member (35....    55   2e-06
gi|48476218|gb|AAT44384.1| REJ3CRD [Strongylocentrotus droebachi...    55   2e-06
gi|34858419|ref|XP_232393.2| similar to dendritic cell immunorec...    55   2e-06
gi|15928688|gb|AAH14811.1| Macrophage galactose N-acetyl-galacto...    55   2e-06
gi|6754688|ref|NP_034926.1| macrophage galactose N-acetyl-galact...    55   2e-06
gi|25777773|gb|AAN75590.1| SIGNR1 alpha [Mus musculus]                 55   2e-06
gi|10121695|gb|AAG13327.1| mannose receptor C type 2 [Gillichthy...    55   3e-06
gi|45382743|ref|NP_990815.1| hepatic lectin [Gallus gallus] >gnl...    55   3e-06
gi|135619|sp|P26258|TETN_CARSP Tetranectin-like protein >gnl|BL_...    55   3e-06
gi|13876735|gb|AAK43584.1| C-type lectin-like protein 1 [Bungaru...    55   3e-06
gi|18777739|ref|NP_570975.1| Cd209e antigen [Mus musculus] >gnl|...    55   3e-06
gi|38503140|sp|Q95LG1|LEM2_HORSE E-selectin precursor (Endotheli...    55   3e-06
gi|1478015|gb|AAB36402.1| ECLV IX/X-bp beta subunit=Ca(2+)-depen...    54   4e-06
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h...    54   4e-06
gi|27691552|ref|XP_221781.1| similar to SIGNR2 [Rattus norvegicus]     54   4e-06
gi|47523602|ref|NP_999433.1| E-selectin [Sus scrofa] >gnl|BL_ORD...    54   4e-06
gi|1346436|sp|P98110|LEM2_PIG E-selectin precursor (Endothelial ...    54   4e-06
gi|2136497|pir||JC5092 E-selectin - pig >gnl|BL_ORD_ID|1017740 g...    54   4e-06
gi|50355694|ref|NP_001002237.1| collectin-43 [Bos taurus] >gnl|B...    54   4e-06
gi|20129719|ref|NP_610208.1| CG11211-PA [Drosophila melanogaster...    54   4e-06
gi|6680734|ref|NP_031519.1| asialoglycoprotein receptor 2 [Mus m...    54   4e-06
gi|444786|prf||1908220B pancreatitis-associated protein                54   4e-06
gi|1083017|pir||A53570 collectin-43 - bovine                           54   4e-06
gi|7416083|dbj|BAA93691.1| C-type lectin expressed in mouthparts...    54   5e-06
gi|13898378|gb|AAK48711.1| E-selectin [Ovis aries]                     54   5e-06
gi|4337050|gb|AAD18055.1| fibrinogen clotting inhibitor A chain ...    54   5e-06
gi|27806407|ref|NP_776606.1| selectin E [endothelial adhesion mo...    54   5e-06
gi|1478014|gb|AAB36401.1| ECLV IX/X-bp alpha subunit=coagulation...    54   5e-06
gi|23321263|gb|AAN23126.1| agglucetin-beta 1 subunit precursor [...    54   5e-06
gi|6754980|ref|NP_035166.1| pancreatitis-associated protein; Reg...    54   5e-06
gi|1364010|pir||JC4329 coagulation factor IX-binding protein A c...    54   5e-06
gi|71970|pir||LNDGPS pulmonary surfactant protein A precursor - dog    54   7e-06
gi|17564166|ref|NP_506744.1| low affinity IgE Fc receptor B fami...    54   7e-06
gi|1172693|sp|P06908|PSPA_CANFA Pulmonary surfactant-associated ...    54   7e-06
gi|46118092|ref|ZP_00174642.2| COG3209: Rhs family protein [Croc...    54   7e-06
gi|20562937|gb|AAM22786.1| ACF 1/2 A-chain [Deinagkistrodon acutus]    54   7e-06
gi|8980619|dbj|BAA99281.1| anticoagulant protein A [Deinagkistro...    54   7e-06
gi|39585604|emb|CAE65364.1| Hypothetical protein CBG10309 [Caeno...    54   7e-06
gi|50737082|ref|XP_419148.1| PREDICTED: similar to collectin sub...    54   7e-06
gi|29570599|emb|CAD69922.1| surfactant protein D [Bos taurus]          54   7e-06
gi|499385|emb|CAA53511.1| collectin-43 [Bos taurus]                    54   7e-06
gi|50750998|ref|XP_422224.1| PREDICTED: similar to regenerating ...    53   9e-06
gi|50771662|ref|XP_423145.1| PREDICTED: similar to E-selectin pr...    53   9e-06
gi|13898376|gb|AAK48710.1| E-selectin [Odocoileus hemionus]            53   9e-06
gi|6715115|gb|AAF26287.1| agkisacutacin B chain [Deinagkistrodon...    53   9e-06
gi|47218445|emb|CAG03717.1| unnamed protein product [Tetraodon n...    53   9e-06
gi|7657333|ref|NP_055173.1| C-type lectin, superfamily member 9;...    53   9e-06
gi|7497310|pir||T32326 hypothetical protein C41H7.7 - Caenorhabd...    53   9e-06
gi|6677921|ref|NP_033186.1| surfactant associated protein D [Mus...    53   1e-05
gi|50751073|ref|XP_422246.1| PREDICTED: similar to E-selectin pr...    53   1e-05
gi|38493056|pdb|1UKM|B Chain B, Crystal Structure Of Ems16, An A...    53   1e-05
gi|14042980|ref|NP_114433.1| regenerating islet-derived family, ...    53   1e-05
gi|5031637|ref|NP_005743.1| C-type lectin, superfamily member 1 ...    53   1e-05
gi|37181877|gb|AAQ88742.1| CLECSF1 [Homo sapiens]                      53   1e-05
gi|11277029|pir||JC7135 agkisacutacin beta chain precursor - sha...    53   1e-05
gi|18777733|ref|NP_570973.1| CD209c antigen [Mus musculus] >gnl|...    53   1e-05
gi|7245413|pdb|1C3A|B Chain B, Crystal Structure Of Flavocetin-A...    53   1e-05
gi|39597674|emb|CAE68365.1| Hypothetical protein CBG14118 [Caeno...    53   1e-05
gi|25777787|gb|AAN75597.1| SIGNR1 [Mus musculus]                       53   1e-05
gi|38422762|emb|CAB07697.2| Hypothetical protein Y48E1B.9 [Caeno...    53   1e-05
gi|50507459|emb|CAA80162.2| Hypothetical protein F58A4.5 [Caenor...    53   1e-05
gi|17537259|ref|NP_496854.1| agkisacutacin like (2N882) [Caenorh...    53   1e-05
gi|25777777|gb|AAN75592.1| SIGNR1 beta [Mus musculus] >gnl|BL_OR...    52   2e-05
gi|17559402|ref|NP_506589.1| c-type lectin and CUB domain contai...    52   2e-05
gi|46395849|sp|Q8CJ91|209B_MOUSE CD209 antigen-like protein B (D...    52   2e-05
gi|6755821|ref|NP_035736.1| tetranectin (plasminogen binding pro...    52   2e-05
gi|23272041|gb|AAH35043.1| Tetranectin (plasminogen binding prot...    52   2e-05
gi|30794342|ref|NP_851369.1| surfactant, pulmonary-associated pr...    52   2e-05
gi|423283|pir||S33603 surfactant protein D - bovine                    52   2e-05
gi|2627436|gb|AAB86683.1| PKD1 gene product [Takifugu rubripes]        52   2e-05
gi|33332305|gb|AAQ11364.1| crotocetin-1 [Crotalus durissus terri...    52   2e-05
gi|640384|pdb|1ESL|  E-Selectin (Lectin And Egf Domains, Residue...    52   2e-05
gi|25777775|gb|AAN75591.1| SIGNR1 alpha [Mus musculus]                 52   2e-05
gi|25777765|gb|AAN75586.1| SIGNR1 alpha [Mus musculus]                 52   2e-05
gi|16660122|gb|AAL27540.1| SIGNR1 TM-less isoform [Mus musculus]       52   2e-05
gi|20271378|gb|AAM18623.1| C-type lectin domain protein [Heterod...    52   2e-05
gi|16975299|pdb|1G1T|A Chain A, Crystal Structure Of E-Selectin ...    52   2e-05
gi|33667103|ref|NP_878910.1| C-type lectin, superfamily member 1...    52   2e-05
gi|18698684|ref|NP_081248.1| CD209b antigen [Mus musculus] >gnl|...    52   2e-05
gi|5453684|ref|NP_006335.1| C-type (calcium dependent, carbohydr...    52   2e-05
gi|126180|sp|P16581|LEM2_HUMAN E-selectin precursor (Endothelial...    52   2e-05
gi|25777783|gb|AAN75595.1| SIGNR1 [Mus musculus] >gnl|BL_ORD_ID|...    52   2e-05
gi|38089049|ref|XP_284386.2| RIKEN cDNA 1810029C22 [Mus musculus]      52   2e-05
gi|4506871|ref|NP_000441.1| selectin E precursor; leukocyte endo...    52   2e-05
gi|31127172|gb|AAH52782.1| Unknown (protein for IMAGE:3371321) [...    52   2e-05
gi|28374182|gb|AAH46292.1| Similar to RIKEN cDNA 1810029C22 gene...    52   2e-05
gi|34870126|ref|XP_221778.2| similar to DC-SIGN [Rattus norvegicus]    52   2e-05
gi|7416081|dbj|BAA93690.1| haustellum specific protein A [Sarcop...    52   2e-05
gi|206459|gb|AAA41972.1| prepulmonary surfactant-associated prot...    52   2e-05
gi|13876739|gb|AAK43586.1| C-type lectin-like protein 1 [Bungaru...    52   2e-05
gi|25777767|gb|AAN75587.1| SIGNR1 alpha [Mus musculus]                 52   2e-05
gi|31203403|ref|XP_310650.1| ENSANGP00000020762 [Anopheles gambi...    52   2e-05
gi|5453619|ref|NP_006429.1| collectin sub-family member 10; coll...    52   2e-05
gi|39591271|emb|CAE73324.1| Hypothetical protein CBG20753 [Caeno...    52   2e-05
gi|31746685|gb|AAB54131.2| Hypothetical protein C09D1.2 [Caenorh...    52   3e-05
gi|665485|gb|AAA96811.1| tetranectin                                   52   3e-05
gi|47206963|emb|CAF90480.1| unnamed protein product [Tetraodon n...    52   3e-05
gi|46395880|sp|Q8HY11|209L_HYLSY CD209 antigen-like protein 1 >g...    52   3e-05
gi|48476210|gb|AAT44380.1| REJ2CRD [Strongylocentrotus francisca...    52   3e-05
gi|33243082|gb|AAQ01211.1| C-type lectin CTL-1 [Echis ocellatus]       52   3e-05
gi|38176036|gb|AAB66231.2| Hypothetical protein R07C3.1 [Caenorh...    52   3e-05
gi|6601484|gb|AAF18995.1| pulmonary surfactant protein A [Ovis a...    51   3e-05
gi|27465527|ref|NP_775120.1| pancreatitis-associated protein 3 [...    51   3e-05
gi|38089051|ref|XP_284376.2| RIKEN cDNA 2310066I10 [Mus musculus]      51   3e-05
gi|31879371|dbj|BAC77707.1| EMS16 B chain [Echis multisquamatus]       51   3e-05
gi|17543580|ref|NP_500257.1| c-type lectin precursor family memb...    51   3e-05
gi|17538882|ref|NP_503093.1| predicted CDS, c-type lectin family...    51   3e-05
gi|46396751|sp|P83515|STR2_STRCA Struthiocalcin-2 (SCA-2)              51   3e-05
gi|2773355|gb|AAB96779.1| excretory/secretory C-type lectin TES-...    51   3e-05
gi|27718901|ref|XP_235330.1| similar to collectin liver 1; colle...    51   3e-05
gi|8918631|dbj|BAA97976.1| pulmonary surfactant protein A [Equus...    51   4e-05
gi|2851435|sp|P23806|IXA_TRIFL Coagulation factor IX/factor X-bi...    51   4e-05
gi|15788236|gb|AAL07690.1| pulmonary surfactant-associated prote...    51   4e-05
gi|202988|gb|AAA40764.1| asialoglycoprotein receptor                   51   4e-05
gi|34555879|emb|CAB04422.2| Hypothetical protein Y102A5B.1 [Caen...    51   4e-05
gi|4586556|dbj|BAA31253.2| proteoglycan core protein [Toxocara c...    51   4e-05
gi|1685117|gb|AAB36703.1| furrowed [Drosophila melanogaster]           51   4e-05
gi|7705290|ref|NP_036635.1| asialoglycoprotein receptor 1 (hepat...    51   4e-05
gi|47551233|ref|NP_999801.1| receptor for egg jelly 3 [Strongylo...    51   4e-05
gi|17566358|ref|NP_507257.1| c-type lectin family member (5R335)...    51   4e-05
gi|12583677|dbj|BAB21452.1| factor XI/factor X binding protein A...    51   4e-05
gi|6755452|ref|NP_035475.1| selectin, endothelial cell [Mus musc...    51   4e-05
gi|20562943|gb|AAM22789.1| ACF 1/2 B-chain [Deinagkistrodon acutus]    51   4e-05
gi|45382787|ref|NP_989997.1| tetranectin [Gallus gallus] >gnl|BL...    51   4e-05
gi|2773304|gb|AAB96767.1| aggrecan core protein [Equus caballus]       51   4e-05
gi|554190|gb|AAA75651.1| lymphocyte homing receptor                    51   4e-05
gi|39587019|emb|CAE62954.1| Hypothetical protein CBG07168 [Caeno...    51   4e-05
gi|34870064|ref|XP_221789.2| similar to DC-SIGN [Rattus norvegicus]    51   4e-05
gi|20562941|gb|AAM22788.1| C-type lectin [Deinagkistrodon acutus]      51   4e-05
gi|6755454|ref|NP_035476.1| selectin, lymphocyte [Mus musculus] ...    51   4e-05
gi|266458|sp|Q00690|LEM2_MOUSE E-selectin precursor (Endothelial...    51   4e-05
gi|3212543|pdb|1IXX|A Chain A, Crystal Structure Of Coagulation ...    51   4e-05
gi|47523028|ref|NP_999275.1| lung surfactant protein D [Sus scro...    50   6e-05
gi|34870060|ref|XP_341024.1| similar to CD209 antigen; dendritic...    50   6e-05
gi|27721871|ref|XP_236746.1| similar to tetranectin [Rattus norv...    50   6e-05
gi|33863107|ref|NP_894667.1| C-type lectin domain [Prochlorococc...    50   6e-05
gi|25777763|gb|AAN75585.1| SIGNR1 [Mus musculus]                       50   6e-05
gi|462500|sp|P33730|LEM2_CANFA E-selectin precursor (Endothelial...    50   6e-05
gi|21541951|sp|P83300|ACAL_ANSAN Ansocalcin                            50   6e-05
gi|4838459|gb|AAD31000.1| C-type lectin Tc-ctl-4 [Toxocara canis]      50   6e-05
gi|9965313|gb|AAG10039.1| E-selectin [Canis familiaris]                50   6e-05
gi|47778940|ref|NP_775806.2| C-type lectin, superfamily member 1...    50   6e-05
gi|34870062|ref|XP_221810.2| similar to CD209 antigen; dendritic...    50   6e-05
gi|399126|sp|P22030|BOTB_BOTJA Botrocetin, beta chain (Platelet ...    50   6e-05
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans]        50   6e-05
gi|37183194|gb|AAQ89397.1| COLEC10 [Homo sapiens]                      50   6e-05
gi|6782434|gb|AAF28384.1| lung surfactant protein A [Sus scrofa]       50   8e-05
gi|33243078|gb|AAQ01209.1| C-type lectin CTL-6 [Bitis arietans]        50   8e-05
gi|1709871|sp|P50403|PSPA_CAVPO Pulmonary surfactant-associated ...    50   8e-05
gi|17561482|ref|NP_503676.1| c-type lectin precursor family memb...    50   8e-05
gi|17553738|ref|NP_499125.1| reverse transcriptase like family m...    50   8e-05
gi|6633978|dbj|BAA88566.1| Islet neogenesis associated protein [...    50   1e-04
gi|6755310|ref|NP_035390.1| regenerating islet-derived 3 gamma; ...    50   1e-04
gi|46395871|sp|Q8HXZ7|C209_PANTR CD209 antigen (Dendritic cell-s...    50   1e-04
gi|27356928|gb|AAL89544.1| putative CD209 protein [Pan troglodytes]    50   1e-04
gi|1514682|gb|AAB86497.1| pancreatic beta cell growth factor [Me...    50   1e-04
gi|2326381|emb|CAA62217.1| C-type lectin [Botryllus schlosseri]        50   1e-04
gi|46395881|sp|Q8HY12|209L_HYLLA CD209 antigen-like protein 1 >g...    50   1e-04
gi|46395879|sp|Q8HY10|209L_HYLCO CD209 antigen-like protein 1 >g...    50   1e-04
gi|33243094|gb|AAQ01217.1| C-type lectin CTL-9 [Echis carinatus ...    50   1e-04
gi|17559406|ref|NP_506591.1| c-type lectin and CUB domain contai...    50   1e-04
gi|15420782|gb|AAK97458.1| dendritic cell-specific ICAM-3 grabbi...    50   1e-04
gi|6686332|sp|Q92778|PBCG_MESAU Pancreatic beta cell growth fact...    50   1e-04
gi|27530341|dbj|BAC53954.1| collectin-L1 [Mus musculus]                50   1e-04
gi|27734138|ref|NP_775598.1| collectin liver 1; collectin-L1 [Mu...    50   1e-04
gi|7949133|ref|NP_037010.1| surfactant associated protein D; Pul...    49   1e-04
gi|15218209|ref|NP_175641.1| protein kinase family protein / C-t...    49   1e-04
gi|33341200|gb|AAQ15161.1| stejaggregin-B alpha chain-2 [Trimere...    49   1e-04
gi|33341208|gb|AAQ15165.1| stejaggregin-B alpha chain-4 [Trimere...    49   1e-04
gi|33341198|gb|AAQ15160.1| stejaggregin-B alpha chain-1 [Trimere...    49   1e-04
gi|18157520|dbj|BAB83835.1| supported by GENSCAN and partially h...    49   1e-04
gi|27901801|ref|NP_776607.1| selectin L [lymphocyte adhesion mol...    49   1e-04
gi|33416211|gb|AAQ18640.1| factor IX binding protein A chain [Gl...    49   1e-04
gi|50786686|ref|XP_423496.1| PREDICTED: similar to amino acid fe...    49   2e-04
gi|17017253|gb|AAL33584.1| SIGNR3 [Mus musculus]                       49   2e-04
gi|7705338|ref|NP_057268.1| C-type lectin, superfamily member 6 ...    49   2e-04
gi|18777736|ref|NP_570974.1| CD209d antigen [Mus musculus] >gnl|...    49   2e-04
gi|25392205|pir||JC7608 type II lectin-like immunoreceptor - hum...    49   2e-04
gi|37577119|ref|NP_919432.1| C-type lectin, superfamily member 6...    49   2e-04
gi|11493654|gb|AAG35593.1| C-type lectin DDB27 short form [Homo ...    49   2e-04
gi|37577115|ref|NP_919429.1| C-type lectin, superfamily member 6...    49   2e-04
gi|34098769|sp|Q9YGG9|MMHA_AGKHA Mamushigin alpha chain precurso...    49   2e-04
gi|47208122|emb|CAF91040.1| unnamed protein product [Tetraodon n...    49   2e-04
gi|32450776|gb|AAP41219.2| echicetin B-chain [Echis carinatus]         49   2e-04
gi|2073142|dbj|BAA19861.1| Incilarin A [Incilaria fruhstorferi]        49   2e-04
gi|40889261|pdb|1OZ7|B Chain B, Crystal Structure Of Echicetin F...    49   2e-04
gi|33243092|gb|AAQ01216.1| C-type lectin CTL-27 [Echis ocellatus]      49   2e-04
gi|33243086|gb|AAQ01213.1| C-type lectin CTL-3 [Echis carinatus ...    49   2e-04
gi|33243080|gb|AAQ01210.1| C-type lectin CTL-8 [Bitis arietans] ...    49   2e-04
gi|33243098|gb|AAQ01219.1| C-type lectin CTL-4 [Echis pyramidum ...    49   2e-04
gi|33341212|gb|AAQ15167.1| stejaggregin-A beta chain-1 [Trimeres...    49   2e-04
gi|33243090|gb|AAQ01215.1| C-type lectin CTL-8 [Echis carinatus ...    49   2e-04
gi|37577117|ref|NP_919430.1| C-type lectin, superfamily member 6...    49   2e-04
gi|2073146|dbj|BAA19863.1| Incilarin C [Incilaria fruhstorferi]        49   2e-04
gi|39585193|emb|CAE57436.1| Hypothetical protein CBG00397 [Caeno...    49   2e-04
gi|17509297|ref|NP_493166.1| predicted CDS, tolloid like family ...    49   2e-04
gi|6753126|ref|NP_033844.1| asialoglycoprotein receptor 1 [Mus m...    49   2e-04
gi|3041697|sp|P34927|LECH_MOUSE Asialoglycoprotein receptor 1 (H...    49   2e-04
gi|1091923|prf||2022211A asialoglycoprotein receptor                   49   2e-04
gi|37993391|gb|AAR06851.1| C-type lectin-1 [Bitis gabonica]            49   2e-04
gi|48476186|gb|AAT44368.1| REJ1CRD2 [Allocentrotus fragilis]           49   2e-04
gi|38493076|pdb|1UOS|B Chain B, The Crystal Structure Of The Sna...    49   2e-04
gi|39654959|pdb|1UMR|C Chain C, Crystal Structure Of The Platele...    49   2e-04
gi|33332301|gb|AAQ11362.1| convulxin subunit b [Crotalus durissu...    49   2e-04
gi|25090034|sp|O93427|CVXB_CRODU Convulxin beta precursor (CVX b...    49   2e-04
gi|9800611|gb|AAB33848.2| peptide 23; pancreatitis-associated pr...    49   2e-04
gi|6677703|ref|NP_033068.1| regenerating islet-derived 1; rat re...    49   2e-04
gi|16923225|gb|AAL29932.1| lectin 2a [Girardia tigrina]                49   2e-04
gi|15281085|gb|AAK91852.1| sDC-SIGN1A type III isoform [Homo sap...    48   3e-04
gi|31541842|ref|NP_083962.1| polycystin 1-like 2; polycystic kid...    48   3e-04
gi|11693134|ref|NP_071788.1| Gal/GalNAc-specific lectin; monogly...    48   3e-04
gi|31978955|gb|AAP58453.1| dendritic cell immuno-activating rece...    48   3e-04
gi|18158883|pdb|1K9I|A Chain A, Complex Of Dc-Sign And Glcnac2ma...    48   3e-04
gi|15281077|gb|AAK91848.1| mDC-SIGN1A type III isoform [Homo sap...    48   3e-04
gi|27356854|gb|AAL89535.1| putative CD209L1 protein [Pan troglod...    48   3e-04
gi|38085039|ref|XP_355810.1| similar to dendritic cell immuno-ac...    48   3e-04
gi|50513580|pdb|1SL5|A Chain A, Crystal Structure Of Dc-Sign Car...    48   3e-04
gi|15281091|gb|AAK91855.1| sDC-SIGN1B type I isoform [Homo sapiens]    48   3e-04
gi|15281081|gb|AAK91850.1| sDC-SIGN1A type I isoform [Homo sapiens]    48   3e-04
gi|39587014|emb|CAE62949.1| Hypothetical protein CBG07162 [Caeno...    48   3e-04
gi|15281093|gb|AAK91856.1| sDC-SIGN1B type II isoform [Homo sapi...    48   3e-04
gi|27356910|gb|AAL89542.1| putative CD209 protein [Pongo pygmaeus]     48   3e-04
gi|15281089|gb|AAK91854.1| mDC-SIGN1B type I isoform [Homo sapiens]    48   3e-04
gi|15281083|gb|AAK91851.1| sDC-SIGN1A TYPE II isoform [Homo sapi...    48   3e-04
gi|46395873|sp|Q8HY00|C209_PONPY CD209 antigen (Dendritic cell-s...    48   3e-04
gi|10863957|ref|NP_066978.1| CD209 antigen; dendritic cell-speci...    48   3e-04


>gi|17565058|ref|NP_507829.1| versican precursor family member (35.8
           kD) (5U220) [Caenorhabditis elegans]
 gi|7508969|pir||T26153 hypothetical protein W04E12.6 -
           Caenorhabditis elegans
 gi|3880537|emb|CAB04910.1| Hypothetical protein W04E12.6
           [Caenorhabditis elegans]
          Length = 321

 Score =  612 bits (1578), Expect = e-174
 Identities = 286/321 (89%), Positives = 286/321 (89%)
 Frame = -1

Query: 966 MTRXXXXXXXXXXXXXAQTCNTGGIYNEQFNRCYQYFTAPAQFSFAEQQCNLLGGHLASV 787
           MTR             AQTCNTGGIYNEQFNRCYQYFTAPAQFSFAEQQCNLLGGHLASV
Sbjct: 1   MTRLTLLLFGLLGAATAQTCNTGGIYNEQFNRCYQYFTAPAQFSFAEQQCNLLGGHLASV 60

Query: 786 QNGQENALLQSNAANSFKRSNYSDYWIGATDLETSGTWKWTDPSVTFDYSNWQLGEPQSG 607
           QNGQENALLQSNAANSFKRSNYSDYWIGATDLETSGTWKWTDPSVTFDYSNWQLGEPQSG
Sbjct: 61  QNGQENALLQSNAANSFKRSNYSDYWIGATDLETSGTWKWTDPSVTFDYSNWQLGEPQSG 120

Query: 606 SDCAIQDKGDGTWSAIGCTSYRPYVCVTPVIMXXXXXXXXXXXXXXXXXXXXXXIKQCVP 427
           SDCAIQDKGDGTWSAIGCTSYRPYVCVTPVIM                      IKQCVP
Sbjct: 121 SDCAIQDKGDGTWSAIGCTSYRPYVCVTPVIMTATCPPITTPIPTTCPTPAPCPIKQCVP 180

Query: 426 SCDQGWTYFSPTDFCYRVYHGEKFNDAEASCVLLGGHLASIHSLTENTFVNNIASCGIKE 247
           SCDQGWTYFSPTDFCYRVYHGEKFNDAEASCVLLGGHLASIHSLTENTFVNNIASCGIKE
Sbjct: 181 SCDQGWTYFSPTDFCYRVYHGEKFNDAEASCVLLGGHLASIHSLTENTFVNNIASCGIKE 240

Query: 246 GKYEHLAWIGMRKVGQDWVWTDGTPSDYFNWAPKQPDNPKKELCVQTAPDLSHDKWYENW 67
           GKYEHLAWIGMRKVGQDWVWTDGTPSDYFNWAPKQPDNPKKELCVQTAPDLSHDKWYENW
Sbjct: 241 GKYEHLAWIGMRKVGQDWVWTDGTPSDYFNWAPKQPDNPKKELCVQTAPDLSHDKWYENW 300

Query: 66  NNLECNEVMRAYICKKASIHN 4
           NNLECNEVMRAYICKKASIHN
Sbjct: 301 NNLECNEVMRAYICKKASIHN 321




[DB home][top]