Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= W04E12_7
(966 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17565058|ref|NP_507829.1| versican precursor family member (3... 612 e-174
gi|17557916|ref|NP_507547.1| versican precursor family member (5... 596 e-169
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe... 538 e-152
gi|39581146|emb|CAE71003.1| Hypothetical protein CBG17839 [Caeno... 523 e-147
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno... 176 5e-43
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb... 172 1e-41
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f... 164 2e-39
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb... 158 2e-37
gi|17553354|ref|NP_497168.1| predicted CDS, C type lectin (3A790... 109 1e-22
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep... 107 5e-22
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma... 100 4e-20
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n... 100 5e-20
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens] 99 1e-19
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]... 99 1e-19
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ... 99 1e-19
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ... 99 1e-19
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens] 98 2e-19
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti... 98 2e-19
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens] 98 2e-19
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le... 97 4e-19
gi|34877265|ref|XP_225585.2| similar to macrophage mannose recep... 95 2e-18
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor... 94 5e-18
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;... 94 5e-18
gi|6678932|ref|NP_032651.1| mannose receptor, C type 1 [Mus musc... 94 6e-18
gi|477362|pir||A48925 mannose receptor precursor, macrophage - m... 94 6e-18
gi|50732401|ref|XP_418618.1| PREDICTED: similar to Macrophage ma... 94 6e-18
gi|47218860|emb|CAG02845.1| unnamed protein product [Tetraodon n... 92 2e-17
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno... 91 3e-17
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa] 89 1e-16
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris] 88 3e-16
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica] 87 6e-16
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma... 87 7e-16
gi|46195838|ref|NP_996866.1| yolk sac IgY receptor [Gallus gallu... 85 2e-15
gi|47230595|emb|CAF99788.1| unnamed protein product [Tetraodon n... 84 5e-15
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]... 84 6e-15
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus] 84 6e-15
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ... 83 8e-15
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ... 83 8e-15
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ... 83 8e-15
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat... 83 8e-15
gi|47564066|ref|NP_001001158.1| DEC-205/CD205 protein [Bos tauru... 82 1e-14
gi|50750535|ref|XP_422038.1| PREDICTED: similar to Lymphocyte an... 82 1e-14
gi|39593681|emb|CAE61973.1| Hypothetical protein CBG05976 [Caeno... 82 1e-14
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus] 82 2e-14
gi|32565327|ref|NP_494426.2| c-type lectin and CUB domain contai... 82 2e-14
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B... 82 2e-14
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica] 81 4e-14
gi|47230594|emb|CAF99787.1| unnamed protein product [Tetraodon n... 80 7e-14
gi|34013700|gb|AAQ56013.1| lectin protein type II [Hippocampus c... 80 7e-14
gi|26340010|dbj|BAC33668.1| unnamed protein product [Mus musculus] 80 9e-14
gi|37360054|dbj|BAC98005.1| mKIAA0709 protein [Mus musculus] 80 9e-14
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (... 79 1e-13
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ... 79 1e-13
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi... 79 2e-13
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [... 79 2e-13
gi|47228322|emb|CAG07717.1| unnamed protein product [Tetraodon n... 79 2e-13
gi|39590314|emb|CAE66053.1| Hypothetical protein CBG11254 [Caeno... 79 2e-13
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote... 79 2e-13
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [... 79 2e-13
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga... 78 3e-13
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|... 77 4e-13
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens] 77 4e-13
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ... 77 4e-13
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus] 77 4e-13
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr... 77 4e-13
gi|833853|gb|AAA67565.1| versican V2 core protein precursor 77 4e-13
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ... 77 4e-13
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID... 77 4e-13
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ... 77 4e-13
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p... 77 4e-13
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens] 77 4e-13
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ... 77 4e-13
gi|47213064|emb|CAF91578.1| unnamed protein product [Tetraodon n... 77 8e-13
gi|47228554|emb|CAG05374.1| unnamed protein product [Tetraodon n... 76 1e-12
gi|45259478|dbj|BAD12391.1| aggrecan [Danio rerio] 76 1e-12
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec... 75 2e-12
gi|4808979|gb|AAD30040.1| receptor protein-tyrosine kinase; HTK2... 75 2e-12
gi|34013702|gb|AAQ56014.1| lectin protein type III [Hippocampus ... 75 3e-12
gi|39590308|emb|CAE66047.1| Hypothetical protein CBG11247 [Caeno... 74 5e-12
gi|34146972|gb|AAB37037.2| Hypothetical protein F52E1.2 [Caenorh... 74 5e-12
gi|28981404|gb|AAH48780.1| Similar to phospholipase A2, group IB... 74 6e-12
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas... 74 6e-12
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor... 74 6e-12
gi|17544700|ref|NP_502450.1| serum lectin like precursor family ... 73 8e-12
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_... 73 8e-12
gi|47214539|emb|CAG04559.1| unnamed protein product [Tetraodon n... 73 8e-12
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g... 73 1e-11
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens] 73 1e-11
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul... 73 1e-11
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_... 73 1e-11
gi|34013698|gb|AAQ56012.1| lectin protein type I [Hippocampus co... 73 1e-11
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s... 72 1e-11
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu... 72 1e-11
gi|47551177|ref|NP_999773.1| sperm receptor for egg jelly [Stron... 72 1e-11
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE... 72 1e-11
gi|26349637|dbj|BAC38458.1| unnamed protein product [Mus musculus] 72 2e-11
gi|39579883|emb|CAE56619.1| Hypothetical protein CBG24375 [Caeno... 72 2e-11
gi|17554488|ref|NP_497312.1| pancreatitis-associated protein pre... 72 2e-11
gi|25395663|pir||B88392 protein R06B10.3 [imported] - Caenorhabd... 72 2e-11
gi|7804476|dbj|BAA95671.1| C-type lectin [Cyprinus carpio] 72 2e-11
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n... 72 2e-11
gi|34555878|emb|CAB04417.2| Hypothetical protein F49A5.5 [Caenor... 71 3e-11
gi|691753|dbj|BAA06444.1| phospholipase A2 receptor [Homo sapiens] 71 3e-11
gi|39583088|emb|CAE60628.1| Hypothetical protein CBG04271 [Caeno... 71 4e-11
gi|28628340|gb|AAO43607.1| serum lectin isoform 3 precursor [Sal... 71 4e-11
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ... 70 5e-11
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic... 70 5e-11
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (... 70 5e-11
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr... 70 5e-11
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA... 70 5e-11
gi|28628336|gb|AAO43605.1| serum lectin isoform 1 precursor [Sal... 70 5e-11
gi|28628338|gb|AAO43606.1| serum lectin isoform 2 precursor [Sal... 70 5e-11
gi|28628334|gb|AAO43604.1| serum lectin isoform 5 precursor [Sal... 70 5e-11
gi|28628342|gb|AAO43608.1| serum lectin isoform 4 precursor [Sal... 70 5e-11
gi|181168|gb|AAA35726.1| proteoglycan core protein 70 5e-11
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ... 70 7e-11
gi|290002|gb|AAA49200.1| antifreeze protein >gnl|BL_ORD_ID|11388... 70 7e-11
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro... 70 7e-11
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus] 70 7e-11
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n... 70 7e-11
gi|17561226|ref|NP_505170.1| IgE receptor precursor (5I887) [Cae... 70 7e-11
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo... 70 7e-11
gi|32469212|dbj|BAC78902.1| C-type lectin [Echidna delicatula] 70 9e-11
gi|39586804|emb|CAE65847.1| Hypothetical protein CBG10980 [Caeno... 70 9e-11
gi|1083928|pir||JP0075 lectin CEL-IV, C-type - Cucumaria echinat... 70 9e-11
gi|13810902|gb|AAK40085.1| brevican soluble core protein precurs... 70 9e-11
gi|39586019|emb|CAE69095.1| Hypothetical protein CBG15117 [Caeno... 70 9e-11
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus] 70 9e-11
gi|1143285|gb|AAA87847.1| brevican core protein 70 9e-11
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_... 70 9e-11
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr... 69 1e-10
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B... 69 2e-10
gi|1352705|sp|P49260|PA2R_RABIT 180 kDa secretory phospholipase ... 69 2e-10
gi|47225543|emb|CAG12026.1| unnamed protein product [Tetraodon n... 69 2e-10
gi|691755|dbj|BAA06445.1| phospholipase A2 receptor [Rattus sp.] 69 2e-10
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus] 69 2e-10
gi|4808975|gb|AAD30038.1| receptor protein-tyrosine kinase; HTK2... 69 2e-10
gi|17544698|ref|NP_502451.1| phospholipase A2 receptor precursor... 67 5e-10
gi|211655|gb|AAA48720.1| proteoglycan core protein 67 5e-10
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co... 67 5e-10
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ... 67 5e-10
gi|10120636|pdb|1EGG|A Chain A, Structure Of A C-Type Carbohydra... 67 6e-10
gi|206105|gb|AAA41836.1| proteoglycan 67 6e-10
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr... 67 6e-10
gi|129887|sp|P07897|PGCA_RAT Aggrecan core protein precursor (Ca... 67 6e-10
gi|6671523|ref|NP_031450.1| aggrecan 1; aggrecan, structural pro... 67 6e-10
gi|47217439|emb|CAG10208.1| unnamed protein product [Tetraodon n... 67 8e-10
gi|4808977|gb|AAD30039.1| receptor protein-tyrosine kinase; HTK2... 67 8e-10
gi|38373928|gb|AAR19205.1| type II transmembrane C-type lectin [... 66 1e-09
gi|26000685|gb|AAN75192.1| C-type lectin [Carassius auratus] 66 1e-09
gi|17531345|ref|NP_494427.1| predicted CDS, c-type lectin and CU... 65 2e-09
gi|7959947|gb|AAF71144.1| low-affinity IgE receptor; CD23 [Equus... 65 2e-09
gi|39579732|emb|CAE56482.1| Hypothetical protein CBG24196 [Caeno... 65 3e-09
gi|39586117|emb|CAE69193.1| Hypothetical protein CBG15230 [Caeno... 65 3e-09
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno... 64 4e-09
gi|113926|sp|P05140|ANP_HEMAM Type II antifreeze protein precurs... 64 4e-09
gi|17551160|ref|NP_509202.1| lithostathine like precursor family... 64 4e-09
gi|213876|gb|AAA49618.1| antifreeze protein 64 4e-09
gi|7674107|sp|Q9YGP1|LECG_TRIST Galactose-binding lectin precurs... 64 4e-09
gi|39588702|emb|CAE58226.1| Hypothetical protein CBG01323 [Caeno... 64 4e-09
gi|6729952|pdb|2AFP|A Chain A, The Solution Structure Of Type Ii... 64 4e-09
gi|213874|gb|AAA49617.1| antifreeze polypeptide (AFP) precursor 64 4e-09
gi|39588321|emb|CAE72672.1| Hypothetical protein CBG19888 [Caeno... 64 5e-09
gi|5764609|gb|AAD51335.1| CD23 homolog [Ancylostoma ceylanicum] 64 5e-09
gi|47219432|emb|CAG10796.1| unnamed protein product [Tetraodon n... 64 5e-09
gi|17542436|ref|NP_500843.1| core protein (4G419) [Caenorhabditi... 64 5e-09
gi|85534|pir||JH0626 antifreeze protein II precursor - rainbow s... 64 5e-09
gi|4808981|gb|AAD30041.1| receptor protein-tyrosine kinase; HTK2... 64 5e-09
gi|32469210|dbj|BAC78901.1| C-type lectin [Gymnothorax flavimarg... 64 7e-09
gi|20196239|dbj|BAB47156.2| skin mucus 31.7 kDa lectin AJL-2 [An... 64 7e-09
gi|399040|sp|Q01758|ANP_OSMMO Type II antifreeze protein precurs... 64 7e-09
gi|47215081|emb|CAG04535.1| unnamed protein product [Tetraodon n... 64 7e-09
gi|20385163|gb|AAM21196.1| C-type mannose-binding lectin [Oncorh... 63 9e-09
gi|13236931|gb|AAB28793.2| low affinity IgE Fc receptor isoform ... 63 9e-09
gi|13236929|gb|AAB28791.2| low affinity IgE Fc receptor isoform ... 63 9e-09
gi|47227540|emb|CAG04688.1| unnamed protein product [Tetraodon n... 63 9e-09
gi|18476520|gb|AAL58516.1| Fc epsilon receptor II subtype b vari... 63 9e-09
gi|18476522|gb|AAL58517.1| Fc epsilon receptor II subtype b vari... 63 9e-09
gi|25090912|sp|P82596|PLC_HALLA Perlucin 63 9e-09
gi|13236930|gb|AAB28792.2| low affinity IgE Fc receptor isoform ... 63 9e-09
gi|41353970|gb|AAS01426.1| C-type lectin [Bothrops insularis] 63 9e-09
gi|37537732|gb|AAQ92957.1| BJcuL precursor [Bothrops jararacussu] 63 9e-09
gi|560482|emb|CAA45532.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m... 63 9e-09
gi|7305051|ref|NP_038545.1| Fc receptor, IgE, low affinity II, a... 63 9e-09
gi|560484|emb|CAA45533.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m... 63 9e-09
gi|16758588|ref|NP_446205.1| C-type lectin, superfamily member 1... 63 1e-08
gi|11277030|pir||S78774 perlucin - Haliotis laevigata 62 1e-08
gi|47203231|emb|CAF92548.1| unnamed protein product [Tetraodon n... 62 2e-08
gi|17559516|ref|NP_504865.1| c-type lectin and CUB domain contai... 62 2e-08
gi|50747976|ref|XP_421065.1| PREDICTED: similar to eosinophil ma... 62 3e-08
gi|34877879|ref|XP_341575.1| similar to collectin placenta 1 [Ra... 62 3e-08
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8... 62 3e-08
gi|17561194|ref|NP_507261.1| c-type lectin family member (5R343)... 62 3e-08
gi|13876737|gb|AAK43585.1| C-type lectin-like protein 2 [Bungaru... 62 3e-08
gi|47215901|emb|CAG12293.1| unnamed protein product [Tetraodon n... 62 3e-08
gi|19424220|ref|NP_598234.1| Fc receptor, IgE, low affinity II, ... 61 3e-08
gi|19070849|gb|AAL84004.1| CD23 [Rattus norvegicus] 61 3e-08
gi|32396016|gb|AAP42417.1| c-type lectin [Bothrops jararacussu] 61 4e-08
gi|17552510|ref|NP_498023.1| predicted CDS, c-type lectin and CU... 61 4e-08
gi|34922643|sp|Q9PSM4|LECG_LACST Galactose-specific lectin (Muti... 61 4e-08
gi|39590313|emb|CAE66052.1| Hypothetical protein CBG11253 [Caeno... 60 6e-08
gi|34003|emb|CAA28465.1| unnamed protein product [Homo sapiens] 60 6e-08
gi|20149533|ref|NP_001993.2| Fc fragment of IgE, low affinity II... 60 6e-08
gi|39585191|emb|CAE57434.1| Hypothetical protein CBG00395 [Caeno... 60 6e-08
gi|32450274|gb|AAH53817.1| MGC64513 protein [Xenopus laevis] 60 6e-08
gi|17565466|ref|NP_507951.1| lithostathine like family member (5... 60 7e-08
gi|31560464|ref|NP_058031.2| C-type lectin, superfamily member 1... 60 7e-08
gi|2497642|sp|P70194|KUCR_MOUSE C-type lectin 13 (Kupffer cell r... 60 7e-08
gi|1514645|emb|CAA42701.1| cartilage aggregating proteoglycan [S... 60 7e-08
gi|47551241|ref|NP_999805.1| C-type lectin domain protein; SpC-l... 60 7e-08
gi|26335321|dbj|BAC31361.1| unnamed protein product [Mus musculus] 60 1e-07
gi|21901969|dbj|BAC05523.1| collectin placenta 1 [Mus musculus] ... 60 1e-07
gi|47551311|ref|NP_999836.1| echinoidin [Strongylocentrotus purp... 60 1e-07
gi|39581281|emb|CAE60027.1| Hypothetical protein CBG03533 [Caeno... 60 1e-07
gi|17538888|ref|NP_503095.1| predicted CDS, c-type lectin family... 59 1e-07
gi|34922459|sp|P83519|LECG_BOTJR Galactose-specific lectin (BJcuL) 59 1e-07
gi|12841992|dbj|BAB25429.1| unnamed protein product [Mus musculu... 59 1e-07
gi|13385824|ref|NP_080604.1| regenerating islet-derived family, ... 59 1e-07
gi|10445213|gb|AAG16631.1| proteoglycan PG-M V3 isoform [Rattus ... 59 1e-07
gi|39586314|emb|CAE66725.1| Hypothetical protein CBG12071 [Caeno... 59 1e-07
gi|16923223|gb|AAL29940.1| lectin 1 [Girardia tigrina] 59 1e-07
gi|7497641|pir||T20063 hypothetical protein C49C3.13 - Caenorhab... 59 2e-07
gi|625318|pir||LNRC1 lectin BRA3-1 precursor - barnacle (Megabal... 59 2e-07
gi|34870066|ref|XP_221788.2| similar to SIGNR1 alpha [Rattus nor... 59 2e-07
gi|46396750|sp|P83514|STR1_STRCA Struthiocalcin-1 (SCA-1) 59 2e-07
gi|32566191|ref|NP_503091.2| c-type lectin family member (4S295)... 59 2e-07
gi|126130|sp|P21963|LECG_CROAT Galactose-specific lectin >gnl|BL... 59 2e-07
gi|126127|sp|P06027|LECE_ANTCR Echinoidin >gnl|BL_ORD_ID|1193382... 58 3e-07
gi|17554010|ref|NP_497267.1| predicted CDS, receptor II (3B447) ... 58 3e-07
gi|57839|emb|CAA31574.1| unnamed protein product [Rattus sp.] 58 4e-07
gi|225342|prf||1301209A lectin 58 4e-07
gi|20273044|gb|AAF26286.2| agkisacutacin A chain [Deinagkistrodo... 58 4e-07
gi|6707084|gb|AAF25588.1| low-affinity IgE receptor [Bos taurus] 58 4e-07
gi|625317|pir||LNRC3 lectin BRA3-2 precursor - barnacle (Megabal... 58 4e-07
gi|1730116|sp|P07439|LEC3_MEGRO Lectin BRA-3 precursor >gnl|BL_O... 58 4e-07
gi|34870118|ref|XP_221808.2| similar to DC-SIGN [Rattus norvegicus] 58 4e-07
gi|2134244|pir||JC5058 bitiscetin alpha chain - puff adder >gnl|... 58 4e-07
gi|50418093|gb|AAH77648.1| Unknown (protein for MGC:86525) [Xeno... 58 4e-07
gi|17506207|ref|NP_493162.1| c-type lectin and CUB domain contai... 57 5e-07
gi|18485494|ref|NP_569716.1| collectin sub-family member 12 [Mus... 57 5e-07
gi|7657291|ref|NP_056532.1| CD207 antigen, langerin; Langerhans ... 57 6e-07
gi|3378108|gb|AAC28441.1| secreted lectin homolog; HeEL-1 [Helio... 57 6e-07
gi|21553093|ref|NP_660119.1| macrophage galactose N-acetyl-galac... 57 6e-07
gi|9910162|ref|NP_064332.1| C-type lectin, superfamily member 9 ... 57 6e-07
gi|14719570|pdb|1IOD|A Chain A, Crystal Structure Of The Complex... 57 6e-07
gi|464483|sp|P35242|PSPA_MOUSE Pulmonary surfactant-associated p... 57 8e-07
gi|31543691|ref|NP_075623.2| surfactant associated protein A; su... 57 8e-07
gi|444733|prf||1908183A surfactant-associated protein SP-A 57 8e-07
gi|11277028|pir||JC7134 agkisacutacin alpha chain precursor - sh... 57 8e-07
gi|3212622|pdb|1TN3| The C-Type Lectin Carbohydrate Recognition... 57 8e-07
gi|4507557|ref|NP_003269.1| tetranectin (plasminogen binding pro... 57 8e-07
gi|18426875|ref|NP_550435.1| asialoglycoprotein receptor 2 isofo... 57 8e-07
gi|33328316|gb|AAQ09608.1| HBxAg-binding protein [Homo sapiens] 57 8e-07
gi|38174325|gb|AAH61096.1| Unknown (protein for MGC:74214) [Mus ... 57 8e-07
gi|31212725|ref|XP_315347.1| ENSANGP00000020910 [Anopheles gambi... 57 8e-07
gi|4502253|ref|NP_001172.1| asialoglycoprotein receptor 2 isofor... 57 8e-07
gi|18426877|ref|NP_550436.1| asialoglycoprotein receptor 2 isofo... 57 8e-07
gi|2781225|pdb|1HTN| Human Tetranectin, A Trimeric Plasminogen ... 57 8e-07
gi|34870122|ref|XP_221790.2| similar to SIGNR4 [Rattus norvegicus] 56 1e-06
gi|34922645|sp|Q9PSN0|LECG_BITAR Galactose-specific lectin (PAL)... 56 1e-06
gi|8394337|ref|NP_059025.1| pulmonary surfactant-associated glyc... 56 1e-06
gi|1709873|sp|P08427|PSPA_RAT Pulmonary surfactant-associated pr... 56 1e-06
gi|47208698|emb|CAF89942.1| unnamed protein product [Tetraodon n... 56 1e-06
gi|33341184|gb|AAQ15153.1| factor IX/X binding protein alpha cha... 56 1e-06
gi|19584340|emb|CAD28466.1| hypothetical protein [Homo sapiens] 55 2e-06
gi|16660119|gb|AAL27539.1| DC-SIGN neck-less isoform [Mus musculus] 55 2e-06
gi|18641360|ref|NP_569057.1| collectin sub-family member 12 isof... 55 2e-06
gi|25392184|pir||JC7595 scavenger receptor with C-type lectin ty... 55 2e-06
gi|38174510|gb|AAH60789.1| Collectin sub-family member 12, isofo... 55 2e-06
gi|18875404|ref|NP_573501.1| CD209a antigen [Mus musculus] >gnl|... 55 2e-06
gi|33341210|gb|AAQ15166.1| stejaggregin-A alpha chain [Trimeresu... 55 2e-06
gi|48375116|gb|AAT42221.1| mannan-binding C-type lectin [Stichop... 55 2e-06
gi|25245527|gb|AAN72437.1| flavocetin-A beta chain [Trimeresurus... 55 2e-06
gi|39654792|pdb|1R13|A Chain A, Carbohydrate Recognition And Nec... 55 2e-06
gi|17568961|ref|NP_508518.1| conglutinin like family member (35.... 55 2e-06
gi|48476218|gb|AAT44384.1| REJ3CRD [Strongylocentrotus droebachi... 55 2e-06
gi|34858419|ref|XP_232393.2| similar to dendritic cell immunorec... 55 2e-06
gi|15928688|gb|AAH14811.1| Macrophage galactose N-acetyl-galacto... 55 2e-06
gi|6754688|ref|NP_034926.1| macrophage galactose N-acetyl-galact... 55 2e-06
gi|25777773|gb|AAN75590.1| SIGNR1 alpha [Mus musculus] 55 2e-06
gi|10121695|gb|AAG13327.1| mannose receptor C type 2 [Gillichthy... 55 3e-06
gi|45382743|ref|NP_990815.1| hepatic lectin [Gallus gallus] >gnl... 55 3e-06
gi|135619|sp|P26258|TETN_CARSP Tetranectin-like protein >gnl|BL_... 55 3e-06
gi|13876735|gb|AAK43584.1| C-type lectin-like protein 1 [Bungaru... 55 3e-06
gi|18777739|ref|NP_570975.1| Cd209e antigen [Mus musculus] >gnl|... 55 3e-06
gi|38503140|sp|Q95LG1|LEM2_HORSE E-selectin precursor (Endotheli... 55 3e-06
gi|1478015|gb|AAB36402.1| ECLV IX/X-bp beta subunit=Ca(2+)-depen... 54 4e-06
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h... 54 4e-06
gi|27691552|ref|XP_221781.1| similar to SIGNR2 [Rattus norvegicus] 54 4e-06
gi|47523602|ref|NP_999433.1| E-selectin [Sus scrofa] >gnl|BL_ORD... 54 4e-06
gi|1346436|sp|P98110|LEM2_PIG E-selectin precursor (Endothelial ... 54 4e-06
gi|2136497|pir||JC5092 E-selectin - pig >gnl|BL_ORD_ID|1017740 g... 54 4e-06
gi|50355694|ref|NP_001002237.1| collectin-43 [Bos taurus] >gnl|B... 54 4e-06
gi|20129719|ref|NP_610208.1| CG11211-PA [Drosophila melanogaster... 54 4e-06
gi|6680734|ref|NP_031519.1| asialoglycoprotein receptor 2 [Mus m... 54 4e-06
gi|444786|prf||1908220B pancreatitis-associated protein 54 4e-06
gi|1083017|pir||A53570 collectin-43 - bovine 54 4e-06
gi|7416083|dbj|BAA93691.1| C-type lectin expressed in mouthparts... 54 5e-06
gi|13898378|gb|AAK48711.1| E-selectin [Ovis aries] 54 5e-06
gi|4337050|gb|AAD18055.1| fibrinogen clotting inhibitor A chain ... 54 5e-06
gi|27806407|ref|NP_776606.1| selectin E [endothelial adhesion mo... 54 5e-06
gi|1478014|gb|AAB36401.1| ECLV IX/X-bp alpha subunit=coagulation... 54 5e-06
gi|23321263|gb|AAN23126.1| agglucetin-beta 1 subunit precursor [... 54 5e-06
gi|6754980|ref|NP_035166.1| pancreatitis-associated protein; Reg... 54 5e-06
gi|1364010|pir||JC4329 coagulation factor IX-binding protein A c... 54 5e-06
gi|71970|pir||LNDGPS pulmonary surfactant protein A precursor - dog 54 7e-06
gi|17564166|ref|NP_506744.1| low affinity IgE Fc receptor B fami... 54 7e-06
gi|1172693|sp|P06908|PSPA_CANFA Pulmonary surfactant-associated ... 54 7e-06
gi|46118092|ref|ZP_00174642.2| COG3209: Rhs family protein [Croc... 54 7e-06
gi|20562937|gb|AAM22786.1| ACF 1/2 A-chain [Deinagkistrodon acutus] 54 7e-06
gi|8980619|dbj|BAA99281.1| anticoagulant protein A [Deinagkistro... 54 7e-06
gi|39585604|emb|CAE65364.1| Hypothetical protein CBG10309 [Caeno... 54 7e-06
gi|50737082|ref|XP_419148.1| PREDICTED: similar to collectin sub... 54 7e-06
gi|29570599|emb|CAD69922.1| surfactant protein D [Bos taurus] 54 7e-06
gi|499385|emb|CAA53511.1| collectin-43 [Bos taurus] 54 7e-06
gi|50750998|ref|XP_422224.1| PREDICTED: similar to regenerating ... 53 9e-06
gi|50771662|ref|XP_423145.1| PREDICTED: similar to E-selectin pr... 53 9e-06
gi|13898376|gb|AAK48710.1| E-selectin [Odocoileus hemionus] 53 9e-06
gi|6715115|gb|AAF26287.1| agkisacutacin B chain [Deinagkistrodon... 53 9e-06
gi|47218445|emb|CAG03717.1| unnamed protein product [Tetraodon n... 53 9e-06
gi|7657333|ref|NP_055173.1| C-type lectin, superfamily member 9;... 53 9e-06
gi|7497310|pir||T32326 hypothetical protein C41H7.7 - Caenorhabd... 53 9e-06
gi|6677921|ref|NP_033186.1| surfactant associated protein D [Mus... 53 1e-05
gi|50751073|ref|XP_422246.1| PREDICTED: similar to E-selectin pr... 53 1e-05
gi|38493056|pdb|1UKM|B Chain B, Crystal Structure Of Ems16, An A... 53 1e-05
gi|14042980|ref|NP_114433.1| regenerating islet-derived family, ... 53 1e-05
gi|5031637|ref|NP_005743.1| C-type lectin, superfamily member 1 ... 53 1e-05
gi|37181877|gb|AAQ88742.1| CLECSF1 [Homo sapiens] 53 1e-05
gi|11277029|pir||JC7135 agkisacutacin beta chain precursor - sha... 53 1e-05
gi|18777733|ref|NP_570973.1| CD209c antigen [Mus musculus] >gnl|... 53 1e-05
gi|7245413|pdb|1C3A|B Chain B, Crystal Structure Of Flavocetin-A... 53 1e-05
gi|39597674|emb|CAE68365.1| Hypothetical protein CBG14118 [Caeno... 53 1e-05
gi|25777787|gb|AAN75597.1| SIGNR1 [Mus musculus] 53 1e-05
gi|38422762|emb|CAB07697.2| Hypothetical protein Y48E1B.9 [Caeno... 53 1e-05
gi|50507459|emb|CAA80162.2| Hypothetical protein F58A4.5 [Caenor... 53 1e-05
gi|17537259|ref|NP_496854.1| agkisacutacin like (2N882) [Caenorh... 53 1e-05
gi|25777777|gb|AAN75592.1| SIGNR1 beta [Mus musculus] >gnl|BL_OR... 52 2e-05
gi|17559402|ref|NP_506589.1| c-type lectin and CUB domain contai... 52 2e-05
gi|46395849|sp|Q8CJ91|209B_MOUSE CD209 antigen-like protein B (D... 52 2e-05
gi|6755821|ref|NP_035736.1| tetranectin (plasminogen binding pro... 52 2e-05
gi|23272041|gb|AAH35043.1| Tetranectin (plasminogen binding prot... 52 2e-05
gi|30794342|ref|NP_851369.1| surfactant, pulmonary-associated pr... 52 2e-05
gi|423283|pir||S33603 surfactant protein D - bovine 52 2e-05
gi|2627436|gb|AAB86683.1| PKD1 gene product [Takifugu rubripes] 52 2e-05
gi|33332305|gb|AAQ11364.1| crotocetin-1 [Crotalus durissus terri... 52 2e-05
gi|640384|pdb|1ESL| E-Selectin (Lectin And Egf Domains, Residue... 52 2e-05
gi|25777775|gb|AAN75591.1| SIGNR1 alpha [Mus musculus] 52 2e-05
gi|25777765|gb|AAN75586.1| SIGNR1 alpha [Mus musculus] 52 2e-05
gi|16660122|gb|AAL27540.1| SIGNR1 TM-less isoform [Mus musculus] 52 2e-05
gi|20271378|gb|AAM18623.1| C-type lectin domain protein [Heterod... 52 2e-05
gi|16975299|pdb|1G1T|A Chain A, Crystal Structure Of E-Selectin ... 52 2e-05
gi|33667103|ref|NP_878910.1| C-type lectin, superfamily member 1... 52 2e-05
gi|18698684|ref|NP_081248.1| CD209b antigen [Mus musculus] >gnl|... 52 2e-05
gi|5453684|ref|NP_006335.1| C-type (calcium dependent, carbohydr... 52 2e-05
gi|126180|sp|P16581|LEM2_HUMAN E-selectin precursor (Endothelial... 52 2e-05
gi|25777783|gb|AAN75595.1| SIGNR1 [Mus musculus] >gnl|BL_ORD_ID|... 52 2e-05
gi|38089049|ref|XP_284386.2| RIKEN cDNA 1810029C22 [Mus musculus] 52 2e-05
gi|4506871|ref|NP_000441.1| selectin E precursor; leukocyte endo... 52 2e-05
gi|31127172|gb|AAH52782.1| Unknown (protein for IMAGE:3371321) [... 52 2e-05
gi|28374182|gb|AAH46292.1| Similar to RIKEN cDNA 1810029C22 gene... 52 2e-05
gi|34870126|ref|XP_221778.2| similar to DC-SIGN [Rattus norvegicus] 52 2e-05
gi|7416081|dbj|BAA93690.1| haustellum specific protein A [Sarcop... 52 2e-05
gi|206459|gb|AAA41972.1| prepulmonary surfactant-associated prot... 52 2e-05
gi|13876739|gb|AAK43586.1| C-type lectin-like protein 1 [Bungaru... 52 2e-05
gi|25777767|gb|AAN75587.1| SIGNR1 alpha [Mus musculus] 52 2e-05
gi|31203403|ref|XP_310650.1| ENSANGP00000020762 [Anopheles gambi... 52 2e-05
gi|5453619|ref|NP_006429.1| collectin sub-family member 10; coll... 52 2e-05
gi|39591271|emb|CAE73324.1| Hypothetical protein CBG20753 [Caeno... 52 2e-05
gi|31746685|gb|AAB54131.2| Hypothetical protein C09D1.2 [Caenorh... 52 3e-05
gi|665485|gb|AAA96811.1| tetranectin 52 3e-05
gi|47206963|emb|CAF90480.1| unnamed protein product [Tetraodon n... 52 3e-05
gi|46395880|sp|Q8HY11|209L_HYLSY CD209 antigen-like protein 1 >g... 52 3e-05
gi|48476210|gb|AAT44380.1| REJ2CRD [Strongylocentrotus francisca... 52 3e-05
gi|33243082|gb|AAQ01211.1| C-type lectin CTL-1 [Echis ocellatus] 52 3e-05
gi|38176036|gb|AAB66231.2| Hypothetical protein R07C3.1 [Caenorh... 52 3e-05
gi|6601484|gb|AAF18995.1| pulmonary surfactant protein A [Ovis a... 51 3e-05
gi|27465527|ref|NP_775120.1| pancreatitis-associated protein 3 [... 51 3e-05
gi|38089051|ref|XP_284376.2| RIKEN cDNA 2310066I10 [Mus musculus] 51 3e-05
gi|31879371|dbj|BAC77707.1| EMS16 B chain [Echis multisquamatus] 51 3e-05
gi|17543580|ref|NP_500257.1| c-type lectin precursor family memb... 51 3e-05
gi|17538882|ref|NP_503093.1| predicted CDS, c-type lectin family... 51 3e-05
gi|46396751|sp|P83515|STR2_STRCA Struthiocalcin-2 (SCA-2) 51 3e-05
gi|2773355|gb|AAB96779.1| excretory/secretory C-type lectin TES-... 51 3e-05
gi|27718901|ref|XP_235330.1| similar to collectin liver 1; colle... 51 3e-05
gi|8918631|dbj|BAA97976.1| pulmonary surfactant protein A [Equus... 51 4e-05
gi|2851435|sp|P23806|IXA_TRIFL Coagulation factor IX/factor X-bi... 51 4e-05
gi|15788236|gb|AAL07690.1| pulmonary surfactant-associated prote... 51 4e-05
gi|202988|gb|AAA40764.1| asialoglycoprotein receptor 51 4e-05
gi|34555879|emb|CAB04422.2| Hypothetical protein Y102A5B.1 [Caen... 51 4e-05
gi|4586556|dbj|BAA31253.2| proteoglycan core protein [Toxocara c... 51 4e-05
gi|1685117|gb|AAB36703.1| furrowed [Drosophila melanogaster] 51 4e-05
gi|7705290|ref|NP_036635.1| asialoglycoprotein receptor 1 (hepat... 51 4e-05
gi|47551233|ref|NP_999801.1| receptor for egg jelly 3 [Strongylo... 51 4e-05
gi|17566358|ref|NP_507257.1| c-type lectin family member (5R335)... 51 4e-05
gi|12583677|dbj|BAB21452.1| factor XI/factor X binding protein A... 51 4e-05
gi|6755452|ref|NP_035475.1| selectin, endothelial cell [Mus musc... 51 4e-05
gi|20562943|gb|AAM22789.1| ACF 1/2 B-chain [Deinagkistrodon acutus] 51 4e-05
gi|45382787|ref|NP_989997.1| tetranectin [Gallus gallus] >gnl|BL... 51 4e-05
gi|2773304|gb|AAB96767.1| aggrecan core protein [Equus caballus] 51 4e-05
gi|554190|gb|AAA75651.1| lymphocyte homing receptor 51 4e-05
gi|39587019|emb|CAE62954.1| Hypothetical protein CBG07168 [Caeno... 51 4e-05
gi|34870064|ref|XP_221789.2| similar to DC-SIGN [Rattus norvegicus] 51 4e-05
gi|20562941|gb|AAM22788.1| C-type lectin [Deinagkistrodon acutus] 51 4e-05
gi|6755454|ref|NP_035476.1| selectin, lymphocyte [Mus musculus] ... 51 4e-05
gi|266458|sp|Q00690|LEM2_MOUSE E-selectin precursor (Endothelial... 51 4e-05
gi|3212543|pdb|1IXX|A Chain A, Crystal Structure Of Coagulation ... 51 4e-05
gi|47523028|ref|NP_999275.1| lung surfactant protein D [Sus scro... 50 6e-05
gi|34870060|ref|XP_341024.1| similar to CD209 antigen; dendritic... 50 6e-05
gi|27721871|ref|XP_236746.1| similar to tetranectin [Rattus norv... 50 6e-05
gi|33863107|ref|NP_894667.1| C-type lectin domain [Prochlorococc... 50 6e-05
gi|25777763|gb|AAN75585.1| SIGNR1 [Mus musculus] 50 6e-05
gi|462500|sp|P33730|LEM2_CANFA E-selectin precursor (Endothelial... 50 6e-05
gi|21541951|sp|P83300|ACAL_ANSAN Ansocalcin 50 6e-05
gi|4838459|gb|AAD31000.1| C-type lectin Tc-ctl-4 [Toxocara canis] 50 6e-05
gi|9965313|gb|AAG10039.1| E-selectin [Canis familiaris] 50 6e-05
gi|47778940|ref|NP_775806.2| C-type lectin, superfamily member 1... 50 6e-05
gi|34870062|ref|XP_221810.2| similar to CD209 antigen; dendritic... 50 6e-05
gi|399126|sp|P22030|BOTB_BOTJA Botrocetin, beta chain (Platelet ... 50 6e-05
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans] 50 6e-05
gi|37183194|gb|AAQ89397.1| COLEC10 [Homo sapiens] 50 6e-05
gi|6782434|gb|AAF28384.1| lung surfactant protein A [Sus scrofa] 50 8e-05
gi|33243078|gb|AAQ01209.1| C-type lectin CTL-6 [Bitis arietans] 50 8e-05
gi|1709871|sp|P50403|PSPA_CAVPO Pulmonary surfactant-associated ... 50 8e-05
gi|17561482|ref|NP_503676.1| c-type lectin precursor family memb... 50 8e-05
gi|17553738|ref|NP_499125.1| reverse transcriptase like family m... 50 8e-05
gi|6633978|dbj|BAA88566.1| Islet neogenesis associated protein [... 50 1e-04
gi|6755310|ref|NP_035390.1| regenerating islet-derived 3 gamma; ... 50 1e-04
gi|46395871|sp|Q8HXZ7|C209_PANTR CD209 antigen (Dendritic cell-s... 50 1e-04
gi|27356928|gb|AAL89544.1| putative CD209 protein [Pan troglodytes] 50 1e-04
gi|1514682|gb|AAB86497.1| pancreatic beta cell growth factor [Me... 50 1e-04
gi|2326381|emb|CAA62217.1| C-type lectin [Botryllus schlosseri] 50 1e-04
gi|46395881|sp|Q8HY12|209L_HYLLA CD209 antigen-like protein 1 >g... 50 1e-04
gi|46395879|sp|Q8HY10|209L_HYLCO CD209 antigen-like protein 1 >g... 50 1e-04
gi|33243094|gb|AAQ01217.1| C-type lectin CTL-9 [Echis carinatus ... 50 1e-04
gi|17559406|ref|NP_506591.1| c-type lectin and CUB domain contai... 50 1e-04
gi|15420782|gb|AAK97458.1| dendritic cell-specific ICAM-3 grabbi... 50 1e-04
gi|6686332|sp|Q92778|PBCG_MESAU Pancreatic beta cell growth fact... 50 1e-04
gi|27530341|dbj|BAC53954.1| collectin-L1 [Mus musculus] 50 1e-04
gi|27734138|ref|NP_775598.1| collectin liver 1; collectin-L1 [Mu... 50 1e-04
gi|7949133|ref|NP_037010.1| surfactant associated protein D; Pul... 49 1e-04
gi|15218209|ref|NP_175641.1| protein kinase family protein / C-t... 49 1e-04
gi|33341200|gb|AAQ15161.1| stejaggregin-B alpha chain-2 [Trimere... 49 1e-04
gi|33341208|gb|AAQ15165.1| stejaggregin-B alpha chain-4 [Trimere... 49 1e-04
gi|33341198|gb|AAQ15160.1| stejaggregin-B alpha chain-1 [Trimere... 49 1e-04
gi|18157520|dbj|BAB83835.1| supported by GENSCAN and partially h... 49 1e-04
gi|27901801|ref|NP_776607.1| selectin L [lymphocyte adhesion mol... 49 1e-04
gi|33416211|gb|AAQ18640.1| factor IX binding protein A chain [Gl... 49 1e-04
gi|50786686|ref|XP_423496.1| PREDICTED: similar to amino acid fe... 49 2e-04
gi|17017253|gb|AAL33584.1| SIGNR3 [Mus musculus] 49 2e-04
gi|7705338|ref|NP_057268.1| C-type lectin, superfamily member 6 ... 49 2e-04
gi|18777736|ref|NP_570974.1| CD209d antigen [Mus musculus] >gnl|... 49 2e-04
gi|25392205|pir||JC7608 type II lectin-like immunoreceptor - hum... 49 2e-04
gi|37577119|ref|NP_919432.1| C-type lectin, superfamily member 6... 49 2e-04
gi|11493654|gb|AAG35593.1| C-type lectin DDB27 short form [Homo ... 49 2e-04
gi|37577115|ref|NP_919429.1| C-type lectin, superfamily member 6... 49 2e-04
gi|34098769|sp|Q9YGG9|MMHA_AGKHA Mamushigin alpha chain precurso... 49 2e-04
gi|47208122|emb|CAF91040.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|32450776|gb|AAP41219.2| echicetin B-chain [Echis carinatus] 49 2e-04
gi|2073142|dbj|BAA19861.1| Incilarin A [Incilaria fruhstorferi] 49 2e-04
gi|40889261|pdb|1OZ7|B Chain B, Crystal Structure Of Echicetin F... 49 2e-04
gi|33243092|gb|AAQ01216.1| C-type lectin CTL-27 [Echis ocellatus] 49 2e-04
gi|33243086|gb|AAQ01213.1| C-type lectin CTL-3 [Echis carinatus ... 49 2e-04
gi|33243080|gb|AAQ01210.1| C-type lectin CTL-8 [Bitis arietans] ... 49 2e-04
gi|33243098|gb|AAQ01219.1| C-type lectin CTL-4 [Echis pyramidum ... 49 2e-04
gi|33341212|gb|AAQ15167.1| stejaggregin-A beta chain-1 [Trimeres... 49 2e-04
gi|33243090|gb|AAQ01215.1| C-type lectin CTL-8 [Echis carinatus ... 49 2e-04
gi|37577117|ref|NP_919430.1| C-type lectin, superfamily member 6... 49 2e-04
gi|2073146|dbj|BAA19863.1| Incilarin C [Incilaria fruhstorferi] 49 2e-04
gi|39585193|emb|CAE57436.1| Hypothetical protein CBG00397 [Caeno... 49 2e-04
gi|17509297|ref|NP_493166.1| predicted CDS, tolloid like family ... 49 2e-04
gi|6753126|ref|NP_033844.1| asialoglycoprotein receptor 1 [Mus m... 49 2e-04
gi|3041697|sp|P34927|LECH_MOUSE Asialoglycoprotein receptor 1 (H... 49 2e-04
gi|1091923|prf||2022211A asialoglycoprotein receptor 49 2e-04
gi|37993391|gb|AAR06851.1| C-type lectin-1 [Bitis gabonica] 49 2e-04
gi|48476186|gb|AAT44368.1| REJ1CRD2 [Allocentrotus fragilis] 49 2e-04
gi|38493076|pdb|1UOS|B Chain B, The Crystal Structure Of The Sna... 49 2e-04
gi|39654959|pdb|1UMR|C Chain C, Crystal Structure Of The Platele... 49 2e-04
gi|33332301|gb|AAQ11362.1| convulxin subunit b [Crotalus durissu... 49 2e-04
gi|25090034|sp|O93427|CVXB_CRODU Convulxin beta precursor (CVX b... 49 2e-04
gi|9800611|gb|AAB33848.2| peptide 23; pancreatitis-associated pr... 49 2e-04
gi|6677703|ref|NP_033068.1| regenerating islet-derived 1; rat re... 49 2e-04
gi|16923225|gb|AAL29932.1| lectin 2a [Girardia tigrina] 49 2e-04
gi|15281085|gb|AAK91852.1| sDC-SIGN1A type III isoform [Homo sap... 48 3e-04
gi|31541842|ref|NP_083962.1| polycystin 1-like 2; polycystic kid... 48 3e-04
gi|11693134|ref|NP_071788.1| Gal/GalNAc-specific lectin; monogly... 48 3e-04
gi|31978955|gb|AAP58453.1| dendritic cell immuno-activating rece... 48 3e-04
gi|18158883|pdb|1K9I|A Chain A, Complex Of Dc-Sign And Glcnac2ma... 48 3e-04
gi|15281077|gb|AAK91848.1| mDC-SIGN1A type III isoform [Homo sap... 48 3e-04
gi|27356854|gb|AAL89535.1| putative CD209L1 protein [Pan troglod... 48 3e-04
gi|38085039|ref|XP_355810.1| similar to dendritic cell immuno-ac... 48 3e-04
gi|50513580|pdb|1SL5|A Chain A, Crystal Structure Of Dc-Sign Car... 48 3e-04
gi|15281091|gb|AAK91855.1| sDC-SIGN1B type I isoform [Homo sapiens] 48 3e-04
gi|15281081|gb|AAK91850.1| sDC-SIGN1A type I isoform [Homo sapiens] 48 3e-04
gi|39587014|emb|CAE62949.1| Hypothetical protein CBG07162 [Caeno... 48 3e-04
gi|15281093|gb|AAK91856.1| sDC-SIGN1B type II isoform [Homo sapi... 48 3e-04
gi|27356910|gb|AAL89542.1| putative CD209 protein [Pongo pygmaeus] 48 3e-04
gi|15281089|gb|AAK91854.1| mDC-SIGN1B type I isoform [Homo sapiens] 48 3e-04
gi|15281083|gb|AAK91851.1| sDC-SIGN1A TYPE II isoform [Homo sapi... 48 3e-04
gi|46395873|sp|Q8HY00|C209_PONPY CD209 antigen (Dendritic cell-s... 48 3e-04
gi|10863957|ref|NP_066978.1| CD209 antigen; dendritic cell-speci... 48 3e-04
>gi|17565058|ref|NP_507829.1| versican precursor family member (35.8
kD) (5U220) [Caenorhabditis elegans]
gi|7508969|pir||T26153 hypothetical protein W04E12.6 -
Caenorhabditis elegans
gi|3880537|emb|CAB04910.1| Hypothetical protein W04E12.6
[Caenorhabditis elegans]
Length = 321
Score = 612 bits (1578), Expect = e-174
Identities = 286/321 (89%), Positives = 286/321 (89%)
Frame = -1
Query: 966 MTRXXXXXXXXXXXXXAQTCNTGGIYNEQFNRCYQYFTAPAQFSFAEQQCNLLGGHLASV 787
MTR AQTCNTGGIYNEQFNRCYQYFTAPAQFSFAEQQCNLLGGHLASV
Sbjct: 1 MTRLTLLLFGLLGAATAQTCNTGGIYNEQFNRCYQYFTAPAQFSFAEQQCNLLGGHLASV 60
Query: 786 QNGQENALLQSNAANSFKRSNYSDYWIGATDLETSGTWKWTDPSVTFDYSNWQLGEPQSG 607
QNGQENALLQSNAANSFKRSNYSDYWIGATDLETSGTWKWTDPSVTFDYSNWQLGEPQSG
Sbjct: 61 QNGQENALLQSNAANSFKRSNYSDYWIGATDLETSGTWKWTDPSVTFDYSNWQLGEPQSG 120
Query: 606 SDCAIQDKGDGTWSAIGCTSYRPYVCVTPVIMXXXXXXXXXXXXXXXXXXXXXXIKQCVP 427
SDCAIQDKGDGTWSAIGCTSYRPYVCVTPVIM IKQCVP
Sbjct: 121 SDCAIQDKGDGTWSAIGCTSYRPYVCVTPVIMTATCPPITTPIPTTCPTPAPCPIKQCVP 180
Query: 426 SCDQGWTYFSPTDFCYRVYHGEKFNDAEASCVLLGGHLASIHSLTENTFVNNIASCGIKE 247
SCDQGWTYFSPTDFCYRVYHGEKFNDAEASCVLLGGHLASIHSLTENTFVNNIASCGIKE
Sbjct: 181 SCDQGWTYFSPTDFCYRVYHGEKFNDAEASCVLLGGHLASIHSLTENTFVNNIASCGIKE 240
Query: 246 GKYEHLAWIGMRKVGQDWVWTDGTPSDYFNWAPKQPDNPKKELCVQTAPDLSHDKWYENW 67
GKYEHLAWIGMRKVGQDWVWTDGTPSDYFNWAPKQPDNPKKELCVQTAPDLSHDKWYENW
Sbjct: 241 GKYEHLAWIGMRKVGQDWVWTDGTPSDYFNWAPKQPDNPKKELCVQTAPDLSHDKWYENW 300
Query: 66 NNLECNEVMRAYICKKASIHN 4
NNLECNEVMRAYICKKASIHN
Sbjct: 301 NNLECNEVMRAYICKKASIHN 321