Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= W05G11_2
         (909 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ...   317   2e-85
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno...   137   3e-31
gi|687634|gb|AAA62504.1| collagen                                     100   8e-20
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [...    98   3e-19
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno...    96   1e-18
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans]             95   2e-18
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ...    91   5e-17
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno...    87   7e-16
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [...    81   3e-14
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ...    80   6e-14
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ...    80   6e-14
gi|39587940|emb|CAE67959.1| Hypothetical protein CBG13563 [Caeno...    79   1e-13
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno...    76   1e-12
gi|17539720|ref|NP_502372.1| COLlagen structural gene (28.8 kD) ...    75   2e-12
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno...    74   5e-12
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ...    73   8e-12
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [...    72   1e-11
gi|25385147|pir||A88640 protein C34H4.4 [imported] - Caenorhabdi...    72   2e-11
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi...    71   4e-11
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p...    71   4e-11
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno...    71   4e-11
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ...    70   5e-11
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8]                 70   8e-11
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ...    69   1e-10
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8]                  69   1e-10
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv...    69   2e-10
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno...    69   2e-10
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre...    68   2e-10
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno...    68   3e-10
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ...    67   4e-10
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel...    67   6e-10
gi|17506643|ref|NP_492948.1| predicted CDS, COLlagen structural ...    65   2e-09
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C...    65   3e-09
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno...    64   5e-09
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno...    64   6e-09
gi|39596974|emb|CAE59201.1| Hypothetical protein CBG02512 [Caeno...    63   8e-09
gi|17538077|ref|NP_495159.1| COLlagen structural gene (col-74) [...    63   8e-09
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ...    63   8e-09
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [...    62   1e-08
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ...    62   2e-08
gi|50806838|ref|XP_428858.1| PREDICTED: similar to tumor-related...    61   3e-08
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno...    61   3e-08
gi|79960|pir||JH0204 hypothetical 30.5K protein precursor - Ente...    61   4e-08
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno...    61   4e-08
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ...    60   7e-08
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ...    60   7e-08
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [...    60   7e-08
gi|22324231|emb|CAD44395.1| hypothetical protein [Enterococcus f...    60   9e-08
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno...    60   9e-08
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno...    60   9e-08
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [...    60   9e-08
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g...    59   1e-07
gi|17539868|ref|NP_501416.1| predicted CDS, COLlagen structural ...    59   1e-07
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a...    45   1e-07
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno...    59   1e-07
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (...    59   1e-07
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno...    59   1e-07
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ...    59   1e-07
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno...    59   1e-07
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno...    59   1e-07
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ...    59   2e-07
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi...    58   3e-07
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ...    58   3e-07
gi|17506747|ref|NP_492013.1| COLlagen structural gene (col-60) [...    58   3e-07
gi|17506297|ref|NP_492086.1| COLlagen structural gene (col-35) [...    58   3e-07
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel...    57   4e-07
gi|7619739|emb|CAB88203.1| putative cuticular collagen [Globoder...    57   4e-07
gi|31126963|ref|NP_852105.1| glutamine/glutamic acid-rich protei...    57   6e-07
gi|628967|pir||S45091 hypothetical protein iota - Streptococcus ...    57   6e-07
gi|1170022|sp|P08568|GRPA_RAT Submandibular gland secretory Glx-...    57   6e-07
gi|39582634|emb|CAE73738.1| Hypothetical protein CBG21264 [Caeno...    57   6e-07
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ...    57   7e-07
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno...    57   7e-07
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc...    56   1e-06
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ...    56   1e-06
gi|46048571|ref|NP_976077.1| hypothetical gene supported by M310...    56   1e-06
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno...    56   1e-06
gi|39593742|emb|CAE62035.1| Hypothetical protein CBG06051 [Caeno...    56   1e-06
gi|39583705|emb|CAE63809.1| Hypothetical protein CBG08355 [Caeno...    56   1e-06
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ...    56   1e-06
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa]                    55   2e-06
gi|92319|pir||A29573 Glx-rich protein - rat (fragment) >gnl|BL_O...    55   2e-06
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g...    55   2e-06
gi|39595378|emb|CAE60416.1| Hypothetical protein CBG04022 [Caeno...    55   2e-06
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno...    55   2e-06
gi|17508941|ref|NP_491800.1| COLlagen structural gene (col-56) [...    55   2e-06
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno...    55   2e-06
gi|39593374|emb|CAE64844.1| Hypothetical protein CBG09640 [Caeno...    55   2e-06
gi|459931|gb|AAA40971.1| contiguous repeat polypeptide [Rattus n...    55   3e-06
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ...    55   3e-06
gi|17507107|ref|NP_491694.1| COLlagen structural gene (col-54) [...    55   3e-06
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ...    55   3e-06
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ...    55   3e-06
gi|39593314|emb|CAE64784.1| Hypothetical protein CBG09577 [Caeno...    55   3e-06
gi|115410|sp|P12114|CCS1_CAEEL Cuticle collagen sqt-1 >gnl|BL_OR...    54   4e-06
gi|17535735|ref|NP_496421.1| SQuaT SQT-1, ROLler: helically twis...    54   4e-06
gi|126420|sp|P15714|LP61_EIMTE Antigen LPMC-61 >gnl|BL_ORD_ID|16...    54   5e-06
gi|158896|gb|AAA29079.1| antigen LPCM61                                54   5e-06
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno...    54   5e-06
gi|39597391|emb|CAE59620.1| Hypothetical protein CBG03029 [Caeno...    54   5e-06
gi|15644950|ref|NP_207120.1| poly E-rich protein [Helicobacter p...    54   6e-06
gi|29893526|gb|AAN16519.1| merozoite surface protein-9 [Plasmodi...    54   6e-06
gi|39597300|emb|CAE59528.1| Hypothetical protein CBG02923 [Caeno...    54   6e-06
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ...    54   6e-06
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ...    54   6e-06
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd...    54   6e-06
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno...    54   6e-06
gi|32404250|ref|XP_322738.1| predicted protein [Neurospora crass...    53   8e-06
gi|12957024|emb|CAC29194.1| hypothetical protein [Enterococcus f...    53   8e-06
gi|17540620|ref|NP_502115.1| COLlagen structural gene (col-126) ...    53   8e-06
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno...    53   8e-06
gi|17540622|ref|NP_502116.1| predicted CDS, COLlagen structural ...    53   8e-06
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno...    53   8e-06
gi|39593739|emb|CAE62032.1| Hypothetical protein CBG06046 [Caeno...    53   1e-05
gi|2144796|pir||I36912 involucrin S - douroucouli (fragment) >gn...    53   1e-05
gi|39590997|emb|CAE58777.1| Hypothetical protein CBG01972 [Caeno...    53   1e-05
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col...    53   1e-05
gi|39593952|emb|CAE70062.1| Hypothetical protein CBG16497 [Caeno...    53   1e-05
gi|17570601|ref|NP_509692.1| COLlagen structural gene (28.7 kD) ...    53   1e-05
gi|17557220|ref|NP_505647.1| COLlagen structural gene (col-150) ...    53   1e-05
gi|7494765|pir||T29837 hypothetical protein B0222.6 - Caenorhabd...    52   1e-05
gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10) [...    52   1e-05
gi|39594542|emb|CAE72120.1| Hypothetical protein CBG19216 [Caeno...    52   1e-05
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ...    52   1e-05
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [...    52   1e-05
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno...    52   1e-05
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno...    52   2e-05
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand...    52   2e-05
gi|34854792|ref|XP_218287.2| similar to putative odorant recepto...    52   2e-05
gi|39597193|emb|CAE59420.1| Hypothetical protein CBG02789 [Caeno...    52   2e-05
gi|17508175|ref|NP_491106.1| COLlagen structural gene (col-49) [...    52   2e-05
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand...    52   2e-05
gi|15235733|ref|NP_192495.1| hypothetical protein [Arabidopsis t...    52   2e-05
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (...    52   2e-05
gi|24654487|ref|NP_611239.1| CG10936-PA [Drosophila melanogaster...    52   2e-05
gi|20129887|ref|NP_610708.1| CG13185-PA [Drosophila melanogaster...    52   2e-05
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para...    52   2e-05
gi|39586931|emb|CAE62866.1| Hypothetical protein CBG07049 [Caeno...    52   2e-05
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ...    52   2e-05
gi|18766204|gb|AAL78899.1| merozoite surface protein-9 precursor...    52   2e-05
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ...    52   2e-05
gi|39594543|emb|CAE72121.1| Hypothetical protein CBG19217 [Caeno...    52   2e-05
gi|17557278|ref|NP_505375.1| COLlagen structural gene (28.8 kD) ...    52   2e-05
gi|17552762|ref|NP_498533.1| COLlagen structural gene (col-8) [C...    52   2e-05
gi|115404|sp|P18833|CC08_CAEEL Cuticle collagen 8 precursor >gnl...    52   2e-05
gi|39581822|emb|CAE60715.1| Hypothetical protein CBG04386 [Caeno...    51   3e-05
gi|17534799|ref|NP_493702.1| COLlagen structural gene (col-69) [...    51   3e-05
gi|39587623|emb|CAE58561.1| Hypothetical protein CBG01723 [Caeno...    51   3e-05
gi|39581019|emb|CAE72500.1| Hypothetical protein CBG19679 [Caeno...    51   3e-05
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa]                    51   4e-05
gi|124727|sp|P24708|INVO_AOTTR Involucrin >gnl|BL_ORD_ID|1836165...    51   4e-05
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal...    51   4e-05
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec...    51   4e-05
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ...    51   4e-05
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno...    51   4e-05
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ...    51   4e-05
gi|112674|sp|P13813|110K_PLAKN 110 kDa antigen (PK110) >gnl|BL_O...    50   5e-05
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo...    50   5e-05
gi|39583250|emb|CAE60042.1| Hypothetical protein CBG03553 [Caeno...    50   5e-05
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu...    50   5e-05
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno...    50   5e-05
gi|39589674|emb|CAE66909.1| Hypothetical protein CBG12293 [Caeno...    50   5e-05
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno...    50   5e-05
gi|17540078|ref|NP_500607.1| COLlagen structural gene (col-111) ...    50   5e-05
gi|17552372|ref|NP_498729.1| COLlagen structural gene (30.6 kD) ...    50   5e-05
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno...    50   5e-05
gi|33285196|gb|AAF99925.2| Collagen protein 111 [Caenorhabditis ...    50   5e-05
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel...    50   7e-05
gi|25395729|pir||H88449 protein F54D8.1 [imported] - Caenorhabdi...    50   7e-05
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD...    50   7e-05
gi|17553572|ref|NP_498086.1| collagen alpha precursor, DumPY : s...    50   7e-05
gi|45185293|ref|NP_983010.1| ABR064Wp [Eremothecium gossypii] >g...    50   7e-05
gi|18859947|ref|NP_573217.1| CG8568-PA [Drosophila melanogaster]...    50   7e-05
gi|786136|gb|AAA99499.1| polymorphic immunodominant molecule           50   7e-05
gi|42519391|ref|NP_965321.1| signal recognition particle recepto...    50   7e-05
gi|8132107|gb|AAF73220.1| glutamine/glutamic acid-rich protein B...    50   7e-05
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc...    50   7e-05
gi|39582788|emb|CAE74251.1| Hypothetical protein CBG21938 [Caeno...    50   7e-05
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate...    50   7e-05
gi|17531717|ref|NP_496308.1| COLlagen structural gene (col-79) [...    50   7e-05
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ...    50   7e-05
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno...    50   9e-05
gi|32416182|ref|XP_328569.1| hypothetical protein [Neurospora cr...    49   1e-04
gi|45198327|ref|NP_985356.1| AFL194Wp [Eremothecium gossypii] >g...    49   1e-04
gi|39595517|emb|CAE60555.1| Hypothetical protein CBG04182 [Caeno...    49   1e-04
gi|39595642|emb|CAE67144.1| Hypothetical protein CBG12567 [Caeno...    49   1e-04
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-...    49   1e-04
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno...    49   1e-04
gi|16198327|gb|AAL14009.1| SD07158p [Drosophila melanogaster]          49   1e-04
gi|23481717|gb|EAA17910.1| dentin sialoprotein-phosphophoryn [Pl...    49   1e-04
gi|84432|pir||JS0170 collagen col-19 - Caenorhabditis elegans >g...    49   1e-04
gi|17540820|ref|NP_500070.1| COLlagen structural gene (28.0 kD) ...    49   1e-04
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >...    49   1e-04
gi|32566102|ref|NP_508100.2| COLlagen structural gene (col-19) [...    49   1e-04
gi|17535687|ref|NP_495858.1| ROLler: helically twisted, animals ...    49   1e-04
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita]    49   1e-04
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (...    49   1e-04
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ...    49   2e-04
gi|45201169|ref|NP_986739.1| AGR074Cp [Eremothecium gossypii] >g...    49   2e-04
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi...    49   2e-04
gi|18495763|emb|CAC87579.1| surface protein [Theileria annulata]       49   2e-04
gi|50424343|ref|XP_460758.1| unnamed protein product [Debaryomyc...    49   2e-04
gi|39586155|emb|CAE69231.1| Hypothetical protein CBG15273 [Caeno...    49   2e-04
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano...    49   2e-04
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa]                    49   2e-04
gi|38089141|ref|XP_146248.3| MYST histone acetyltransferase (mon...    49   2e-04
gi|17542824|ref|NP_501756.1| COLlagen structural gene (col-123) ...    49   2e-04
gi|42733783|gb|AAS38704.1| similar to Dictyostelium discoideum (...    49   2e-04
gi|32033879|ref|ZP_00134150.1| COG0810: Periplasmic protein TonB...    49   2e-04
gi|18495789|emb|CAC87892.1| surface protein [Theileria annulata]       49   2e-04
gi|18495765|emb|CAC87580.1| surface protein [Theileria annulata]...    49   2e-04
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp...    49   2e-04
gi|17505428|ref|NP_492035.1| COLlagen structural gene (col-61) [...    49   2e-04
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis]            49   2e-04
gi|39597491|emb|CAE59721.1| Hypothetical protein CBG03154 [Caeno...    49   2e-04
gi|1235974|emb|CAA65474.1| collagen [Globodera pallida]                49   2e-04
gi|50424261|ref|XP_460717.1| unnamed protein product [Debaryomyc...    48   3e-04
gi|46138495|ref|XP_390938.1| hypothetical protein FG10762.1 [Gib...    48   3e-04
gi|34853610|ref|XP_216034.2| similar to Cip1-interacting zinc fi...    48   3e-04
gi|39593522|emb|CAE61814.1| Hypothetical protein CBG05782 [Caeno...    48   3e-04
gi|28828775|gb|AAO51370.1| similar to Dictyostelium discoideum (...    48   3e-04
gi|32266205|ref|NP_860237.1| conserved hypothetical protein [Hel...    48   3e-04
gi|39594909|emb|CAE70777.1| Hypothetical protein CBG17531 [Caeno...    48   3e-04
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno...    48   3e-04
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [...    48   3e-04
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno...    48   3e-04
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-...    48   3e-04
gi|28828696|gb|AAM33200.2| similar to Dictyostelium discoideum (...    48   3e-04
gi|5803098|ref|NP_006757.1| MYST histone acetyltransferase (mono...    48   3e-04
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis]            48   3e-04
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami...    48   3e-04
gi|20066260|gb|AAM09367.1| similar to Dictyostelium discoideum (...    48   3e-04
gi|39583277|emb|CAE60069.1| Hypothetical protein CBG03586 [Caeno...    48   3e-04
gi|19112576|ref|NP_595784.1| hypothetical coiled-coil protein [S...    48   3e-04
gi|38603523|dbj|BAD02898.1| bacteriolytic enzyme [Bacillus clausii]    48   3e-04
gi|6322796|ref|NP_012869.1| RNAPII degradation factor, forms a c...    48   3e-04
gi|13508497|gb|AAF15293.3| erythrocyte membrane-associated giant...    48   3e-04
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa...    48   3e-04
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno...    48   3e-04
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par...    48   3e-04
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno...    48   3e-04
gi|17557218|ref|NP_505646.1| COLlagen structural gene (30.6 kD) ...    48   3e-04
gi|17533675|ref|NP_496739.1| mature parasite-infected erythrocyt...    47   5e-04
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (...    47   5e-04
gi|39579123|emb|CAE56688.1| Hypothetical protein CBG24466 [Caeno...    47   5e-04
gi|45550130|ref|NP_608921.2| CG14023-PA [Drosophila melanogaster...    47   5e-04
gi|28377133|ref|NP_784025.1| cell surface protein precursor [Lac...    47   5e-04
gi|39581950|emb|CAE73812.1| Hypothetical protein CBG21362 [Caeno...    47   5e-04
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa]                    47   5e-04
gi|23508683|ref|NP_701352.1| antigen 332, putative [Plasmodium f...    47   5e-04
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno...    47   5e-04
gi|17557828|ref|NP_505635.1| COLlagen structural gene (col-148) ...    47   5e-04
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder...    47   5e-04
gi|15679866|ref|NP_276984.1| heterodisulfide reductase, subunit ...    47   6e-04
gi|39597161|emb|CAE59388.1| Hypothetical protein CBG02745 [Caeno...    47   6e-04
gi|120184|sp|P06916|FIRA_PLAFF 300 KD ANTIGEN AG231 >gnl|BL_ORD_...    47   6e-04
gi|39587723|emb|CAE58661.1| Hypothetical protein CBG01830 [Caeno...    47   6e-04
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis]            47   6e-04
gi|627056|pir||A54641 interspersed repeat antigen precursor - ma...    47   6e-04
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto...    47   6e-04
gi|6981166|ref|NP_036892.1| pleiomorphic adenoma gene-like 1; Lo...    47   6e-04
gi|17536809|ref|NP_494568.1| COLlagen structural gene (col-72) [...    47   6e-04
gi|17535069|ref|NP_496535.1| COLlagen structural gene (col-84) [...    47   6e-04
gi|755081|gb|AAB00073.1| schizont/sporozoite surface protein >gn...    47   6e-04
gi|47229302|emb|CAG04054.1| unnamed protein product [Tetraodon n...    39   8e-04
gi|50294848|ref|XP_449835.1| unnamed protein product [Candida gl...    47   8e-04
gi|18495761|emb|CAC87578.1| surface protein [Theileria annulata]       47   8e-04
gi|48763005|ref|ZP_00267562.1| hypothetical protein Rrub02003719...    47   8e-04
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna...    47   8e-04
gi|124728|sp|P18174|INVO_CANFA Involucrin >gnl|BL_ORD_ID|458093 ...    47   8e-04
gi|27367908|ref|NP_763435.1| TPR repeat containing protein [Vibr...    47   8e-04
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib...    47   8e-04
gi|39597930|emb|CAE68622.1| Hypothetical protein CBG14509 [Caeno...    47   8e-04
gi|31213353|ref|XP_315620.1| ENSANGP00000017827 [Anopheles gambi...    47   8e-04
gi|124738|sp|P24711|INVO_TARBA Involucrin >gnl|BL_ORD_ID|1371644...    47   8e-04
gi|18495767|emb|CAC87581.1| SP protein [Theileria annulata]            47   8e-04
gi|21244048|ref|NP_643630.1| acidic amino acid rich protein [Xan...    47   8e-04
gi|39585781|emb|CAE59983.1| Hypothetical protein CBG03475 [Caeno...    46   0.001
gi|38049260|gb|AAR10431.1| hypothetical protein [Enterococcus fa...    46   0.001
gi|17557174|ref|NP_505670.1| COLlagen structural gene (col-151) ...    46   0.001
gi|18495779|emb|CAC87478.1| surface protein [Theileria annulata]       46   0.001
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat...    46   0.001
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ...    46   0.001
gi|12053779|emb|CAC20094.1| Nahoda protein [Drosophila melanogas...    46   0.001
gi|18495757|emb|CAC87576.1| surface protein [Theileria annulata]       46   0.001
gi|24658804|ref|NP_523815.2| CG12781-PA [Drosophila melanogaster...    46   0.001
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul...    46   0.001
gi|17539040|ref|NP_501123.1| COLlagen structural gene (35.6 kD) ...    46   0.001
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c...    46   0.001
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno...    46   0.001
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633...    46   0.001
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet...    46   0.001
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi...    46   0.001
gi|30679640|ref|NP_187241.2| neurofilament protein-related [Arab...    46   0.001
gi|17569345|ref|NP_510110.1| COLlagen structural gene (col-182) ...    46   0.001
gi|39593313|emb|CAE64783.1| Hypothetical protein CBG09576 [Caeno...    46   0.001
gi|39587116|emb|CAE57583.1| Hypothetical protein CBG00562 [Caeno...    46   0.001
gi|17568307|ref|NP_509837.1| COLlagen structural gene (col-177) ...    46   0.001
gi|17534051|ref|NP_494060.1| predicted CDS, merozoite surface li...    46   0.001
gi|17570615|ref|NP_508857.1| putative protein (XF654) [Caenorhab...    46   0.001
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL...    46   0.001
gi|17539090|ref|NP_502514.1| COLlagen structural gene (col-132) ...    46   0.001
gi|7510771|pir||T29919 hypothetical protein ZC449.5 - Caenorhabd...    46   0.001
gi|45201188|ref|NP_986758.1| AGR093Wp [Eremothecium gossypii] >g...    46   0.001
gi|129260|sp|P10451|OSTP_HUMAN Osteopontin precursor (Bone sialo...    46   0.001
gi|992948|dbj|BAA05949.1| OPN-a [Homo sapiens]                         46   0.001
gi|538245|dbj|BAA03980.1| secreted phosphoprotein-1 precursor [O...    46   0.001
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo...    46   0.001
gi|32403930|ref|XP_322578.1| predicted protein [Neurospora crass...    46   0.001
gi|34858177|ref|XP_227373.2| similar to trichohyalin [Rattus nor...    46   0.001
gi|28871978|ref|NP_794597.1| conserved hypothetical protein [Pse...    46   0.001
gi|17542298|ref|NP_501532.1| COLlagen structural gene (col-118) ...    45   0.002
gi|31243065|ref|XP_321967.1| ENSANGP00000012035 [Anopheles gambi...    45   0.002
gi|24645646|ref|NP_649988.1| CG3996-PA [Drosophila melanogaster]...    45   0.002
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ...    45   0.002
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di...    45   0.002
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati...    45   0.002
gi|27882420|gb|AAH44688.1| Ncoa5-prov protein [Xenopus laevis]         45   0.002
gi|12060990|gb|AAG48331.1| lost on transformation protein 1 [Mus...    45   0.002
gi|30910887|gb|AAP37002.1| surface protein [Theileria lestoquardi]     45   0.002
gi|6978026|gb|AAF34245.1| zinc finger protein ZAC1 [Mus musculus]      45   0.002
gi|39588149|emb|CAE68073.1| Hypothetical protein CBG13703 [Caeno...    45   0.002
gi|50420597|ref|XP_458835.1| unnamed protein product [Debaryomyc...    45   0.002
gi|32565935|ref|NP_500902.2| UNCoordinated locomotion UNC-44, an...    45   0.002
gi|39588000|emb|CAE57231.1| Hypothetical protein CBG00101 [Caeno...    45   0.002
gi|15240449|ref|NP_198068.1| hypothetical protein [Arabidopsis t...    45   0.002
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc...    45   0.002
gi|48696432|ref|YP_024473.1| ORF43 [Staphylococcus phage K] >gnl...    45   0.002
gi|38109847|gb|EAA55654.1| hypothetical protein MG01305.4 [Magna...    45   0.002
gi|28830026|gb|AAO52516.1| similar to Kaposi's sarcoma-associate...    45   0.002
gi|25395257|pir||F87754 protein C43E11.1 [imported] - Caenorhabd...    45   0.002
gi|7485304|pir||T01803 hypothetical protein A_TM021B04.5 - Arabi...    45   0.002
gi|46852388|ref|NP_060707.2| cell-cycle and apoptosis regulatory...    45   0.002
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha...    45   0.002
gi|7508112|pir||T25061 hypothetical protein T21B6.3 - Caenorhabd...    45   0.002
gi|25152272|ref|NP_509829.2| brain-specific angiogenesis inhibit...    45   0.002
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid...    45   0.002
gi|24656688|ref|NP_647799.1| CG12009-PA [Drosophila melanogaster...    45   0.002
gi|28828998|gb|AAO51573.1| similar to Dictyostelium discoideum (...    45   0.002
gi|15607012|ref|NP_214394.1| initiation factor IF-2 [Aquifex aeo...    45   0.003
gi|7494885|pir||T15348 hypothetical protein B0350.1 - Caenorhabd...    45   0.003
gi|23820861|gb|AAA93447.2| Uncoordinated protein 44, isoform f [...    45   0.003
gi|13182946|gb|AAK14999.1| centromere binding protein 1 [Candida...    45   0.003
gi|46444158|gb|EAL03435.1| hypothetical protein CaO19.4998 [Cand...    45   0.003
gi|42659790|ref|XP_378266.1| hypothetical protein XP_378266 [Hom...    45   0.003
gi|21401240|ref|NP_657225.1| hypothetical protein predicted by G...    45   0.003
gi|18495791|emb|CAC87893.1| surface protein [Theileria annulata]       45   0.003
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp...    45   0.003
gi|50419727|ref|XP_458392.1| unnamed protein product [Debaryomyc...    45   0.003
gi|19921992|ref|NP_610608.1| CG12340-PA [Drosophila melanogaster...    45   0.003
gi|50288897|ref|XP_446878.1| unnamed protein product [Candida gl...    45   0.003
gi|49186125|ref|YP_029377.1| lipoprotein, putative [Bacillus ant...    45   0.003
gi|45184892|ref|NP_982610.1| AAR069Wp [Eremothecium gossypii] >g...    45   0.003
gi|28829970|gb|AAO52460.1| similar to Dictyostelium discoideum (...    45   0.003
gi|39589826|emb|CAE67061.1| Hypothetical protein CBG12469 [Caeno...    45   0.003
gi|7022719|dbj|BAA91700.1| unnamed protein product [Homo sapiens]      44   0.004
gi|1729824|sp|P54683|TAGB_DICDI Prestalk-specific protein tagB p...    44   0.004
gi|29290093|gb|AAO67564.1| Pol protein [Drosophila virilis]            44   0.004
gi|49077200|ref|XP_402493.1| hypothetical protein UM04878.1 [Ust...    44   0.004
gi|48120927|ref|XP_396472.1| similar to CG33103-PA [Apis mellifera]    44   0.004
gi|46125615|ref|XP_387361.1| hypothetical protein FG07185.1 [Gib...    44   0.004
gi|45190780|ref|NP_985034.1| AER177Wp [Eremothecium gossypii] >g...    44   0.004
gi|32422627|ref|XP_331757.1| hypothetical protein [Neurospora cr...    44   0.004
gi|31207045|ref|XP_312489.1| ENSANGP00000021340 [Anopheles gambi...    44   0.004
gi|32441867|gb|AAP82002.1| cell-cycle and apoptosis regulatory p...    44   0.004
gi|27497118|gb|AAO17319.1| death inducer with SAP domain DIS [Ho...    44   0.004
gi|18495771|emb|CAC87571.1| surface protein [Theileria annulata]...    44   0.004
gi|17532625|ref|NP_495810.1| COLlagen structural gene (col-38) [...    44   0.004
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can...    44   0.004
gi|16305113|gb|AAL16979.1| 50kD gamma zein [Zea mays]                  44   0.004
gi|39593302|emb|CAE64772.1| Hypothetical protein CBG09563 [Caeno...    44   0.004
gi|24639970|ref|NP_572262.1| CG3108-PA [Drosophila melanogaster]...    44   0.005
gi|17505983|ref|NP_491344.1| apoptotic chromatin condensation in...    44   0.005
gi|46123749|ref|XP_386428.1| hypothetical protein FG06252.1 [Gib...    44   0.005
gi|18767668|gb|AAL54912.2| putative transcriptional repressor [C...    44   0.005
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa...    44   0.005
gi|24657526|ref|NP_728981.1| CG32251-PA [Drosophila melanogaster...    44   0.005
gi|1575515|gb|AAC47461.1| thrombospondin-related anonymous prote...    44   0.005
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa...    44   0.005
gi|21357267|ref|NP_649312.1| CG6014-PA [Drosophila melanogaster]...    44   0.005
gi|22125449|ref|NP_668872.1| hypothetical [Yersinia pestis KIM] ...    44   0.005
gi|7496380|pir||T25563 hypothetical protein C24A8.3 - Caenorhabd...    44   0.005
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno...    44   0.005
gi|39591984|emb|CAE75204.1| Hypothetical protein CBG23151 [Caeno...    44   0.005
gi|17550600|ref|NP_508738.1| predicted CDS, prion-like Q/N-rich ...    44   0.005
gi|47216756|emb|CAG03760.1| unnamed protein product [Tetraodon n...    44   0.005
gi|46109630|ref|XP_381873.1| hypothetical protein FG01697.1 [Gib...    44   0.005
gi|24641032|ref|NP_727427.1| CG2890-PA [Drosophila melanogaster]...    44   0.007
gi|23485800|gb|EAA20579.1| DnaJ domain, putative [Plasmodium yoe...    44   0.007
gi|44889999|emb|CAF32117.1| hypothetical protein [Aspergillus fu...    44   0.007
gi|24664026|ref|NP_729947.1| CG32133-PA [Drosophila melanogaster...    44   0.007
gi|17539078|ref|NP_502507.1| COLlagen structural gene (col-131) ...    44   0.007
gi|38566922|emb|CAE76225.1| related to putative cytoplasmic stru...    44   0.007
gi|46107840|ref|XP_380979.1| hypothetical protein FG00803.1 [Gib...    44   0.007
gi|32419136|ref|XP_330046.1| hypothetical protein [Neurospora cr...    44   0.007
gi|11493665|gb|AAG35598.1| secalin precursor [Secale cereale]          44   0.007
gi|46110333|ref|XP_382224.1| hypothetical protein FG02048.1 [Gib...    44   0.007
gi|46433489|gb|EAK92927.1| hypothetical protein CaO19.13986 [Can...    44   0.007
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat...    44   0.007
gi|45185072|ref|NP_982789.1| ABL158Cp [Eremothecium gossypii] >g...    44   0.007
gi|42528111|ref|NP_973209.1| conserved hypothetical protein [Tre...    44   0.007
gi|124733|sp|P14590|INVO_LEMCA Involucrin >gnl|BL_ORD_ID|1468131...    44   0.007
gi|50294998|ref|XP_449910.1| unnamed protein product [Candida gl...    44   0.007
gi|26000364|gb|AAN75477.1| dentin matrix protein 1 [Natalus stra...    44   0.007
gi|3021600|emb|CAA71376.1| nuclear protein SDK2 [Xenopus laevis]       44   0.007
gi|30022968|ref|NP_834599.1| Cell surface protein [Bacillus cere...    44   0.007
gi|17550712|ref|NP_510630.1| COLlagen structural gene (col-187) ...    44   0.007
gi|50306211|ref|XP_453068.1| unnamed protein product [Kluyveromy...    44   0.007
gi|39597796|emb|CAE68488.1| Hypothetical protein CBG14291 [Caeno...    43   0.009
gi|124729|sp|P24709|INVO_CEBAL Involucrin >gnl|BL_ORD_ID|1943485...    43   0.009
gi|26342721|dbj|BAC35017.1| unnamed protein product [Mus musculus]     43   0.009
gi|50303983|ref|XP_451941.1| unnamed protein product [Kluyveromy...    43   0.009
gi|28571738|ref|NP_732034.2| CG5166-PC [Drosophila melanogaster]...    43   0.009
gi|38078070|ref|XP_283937.2| RIKEN cDNA 1110037F02 [Mus musculus]      43   0.009
gi|11345242|gb|AAG34659.1| involucrin [Mus musculus]                   43   0.009
gi|46441609|gb|EAL00905.1| hypothetical protein CaO19.14090 [Can...    43   0.009
gi|24647162|ref|NP_732033.1| CG5166-PB [Drosophila melanogaster]...    43   0.009
gi|50758913|ref|XP_417476.1| PREDICTED: similar to Hypothetical ...    43   0.009
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD...    43   0.009
gi|2498476|sp|Q95208|ICAL_SHEEP Calpain inhibitor (Calpastatin) ...    43   0.009
gi|16122929|ref|NP_406242.1| conserved hypothetical protein [Yer...    43   0.009
gi|47216284|emb|CAF96580.1| unnamed protein product [Tetraodon n...    43   0.009
gi|33946280|ref|NP_892121.1| DKFZP434I116 protein isoform 2 [Hom...    43   0.009
gi|17569903|ref|NP_508386.1| COLlagen structural gene (38.6 kD) ...    43   0.009
gi|23273132|gb|AAH33309.1| Unknown (protein for MGC:30537) [Mus ...    43   0.009
gi|17506859|ref|NP_491822.1| predicted CDS, COLlagen structural ...    43   0.009
gi|46439924|gb|EAK99236.1| hypothetical protein CaO19.3345 [Cand...    43   0.009
gi|124732|sp|P17941|INVO_HYLLA Involucrin >gnl|BL_ORD_ID|1811533...    43   0.009
gi|25009850|gb|AAN71095.1| AT22221p [Drosophila melanogaster]          43   0.009
gi|7243239|dbj|BAA92667.1| KIAA1429 protein [Homo sapiens]             43   0.009
gi|39596370|emb|CAE70008.1| Hypothetical protein CBG16422 [Caeno...    43   0.009
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel...    43   0.009
gi|11345240|gb|AAG34658.1| involucrin [Mus musculus]                   43   0.009
gi|27503875|gb|AAH42244.1| MGC53372 protein [Xenopus laevis]           43   0.009
gi|28972750|dbj|BAC65791.1| mKIAA1429 protein [Mus musculus]           43   0.009
gi|48095295|ref|XP_394403.1| similar to ENSANGP00000017739 [Apis...    43   0.009
gi|11345238|gb|AAG34657.1| involucrin [Mus musculus]                   43   0.009
gi|114829|sp|P08726|BAR6_CHITE BALBIANI RING PROTEIN 6 (GIANT SE...    43   0.009
gi|50259690|gb|EAL22360.1| hypothetical protein CNBB5330 [Crypto...    43   0.009
gi|28901310|ref|NP_800965.1| hypothetical protein VPA1455 [Vibri...    43   0.009
gi|16182353|gb|AAL13482.1| GH01409p [Drosophila melanogaster]          43   0.009
gi|24647164|ref|NP_650466.2| CG5166-PA [Drosophila melanogaster]...    43   0.009
gi|33946282|ref|NP_056311.2| DKFZP434I116 protein isoform 1 [Hom...    43   0.009
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand...    43   0.009
gi|21243239|ref|NP_642821.1| hypothetical protein [Xanthomonas a...    43   0.009
gi|27462066|gb|AAO15300.1| MSTP054 [Homo sapiens]                      43   0.009
gi|47216869|emb|CAG11676.1| unnamed protein product [Tetraodon n...    42   0.010
gi|112493|pir||S15074 calpastatin - rat >gnl|BL_ORD_ID|968813 gi...    43   0.011
gi|39591344|emb|CAE73397.1| Hypothetical protein CBG20838 [Caeno...    43   0.011
gi|28569857|dbj|BAC57901.1| gag-like protein [Anopheles gambiae]       43   0.011
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e...    43   0.011
gi|39590610|emb|CAE64980.1| Hypothetical protein CBG09815 [Caeno...    43   0.011
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy...    43   0.011
gi|37359954|dbj|BAC97955.1| mKIAA0444 protein [Mus musculus]           43   0.011
gi|39592067|emb|CAE75287.1| Hypothetical protein CBG23255 [Caeno...    43   0.011
gi|38079062|ref|XP_196334.3| similar to chromodomain helicase DN...    43   0.011
gi|25404666|pir||B96695 hypothetical protein F5A8.4 [imported] -...    43   0.011
gi|2144790|pir||I37060 involucrin L - gorilla >gnl|BL_ORD_ID|150...    43   0.011
gi|14164561|gb|AAK55123.1| Swift [Xenopus laevis]                      43   0.011
gi|17425218|dbj|BAB78764.1| low-molecular-weight glutenin subuni...    43   0.011
gi|42563009|ref|NP_176883.3| midasin-related [Arabidopsis thaliana]    43   0.011
gi|2137076|pir||I48103 type VII collagen - Chinese hamster (frag...    43   0.011
gi|18495793|emb|CAC87894.1| surface protein [Theileria annulata]       43   0.011
gi|495866|gb|AAA58965.1| collagen type VII [Homo sapiens]              43   0.011
gi|32413483|ref|XP_327221.1| predicted protein [Neurospora crass...    43   0.011
gi|46436855|gb|EAK96211.1| hypothetical protein CaO19.7193 [Cand...    43   0.011
gi|28828398|gb|AAM09317.2| similar to Vibrio vulnificus CMCP6. T...    43   0.011
gi|15639477|ref|NP_218927.1| antigen, p83/100 [Treponema pallidu...    43   0.011
gi|50546519|ref|XP_500729.1| hypothetical protein [Yarrowia lipo...    43   0.011
gi|34393510|dbj|BAC83071.1| unknown protein [Oryza sativa (japon...    43   0.011
gi|18495769|emb|CAC87570.1| surface protein [Theileria annulata]       43   0.011
gi|4502961|ref|NP_000085.1| alpha 1 type VII collagen precursor;...    43   0.011
gi|23489676|gb|EAA21642.1| protein gar2 [Plasmodium yoelii yoelii]     43   0.011
gi|627406|pir||A54849 collagen alpha 1(VII) chain precursor - human    43   0.011
gi|39596361|emb|CAE69999.1| Hypothetical protein CBG16406 [Caeno...    43   0.011
gi|46316651|ref|ZP_00217230.1| COG1530: Ribonucleases G and E [B...    43   0.011
gi|32411243|ref|XP_326102.1| hypothetical protein [Neurospora cr...    43   0.011
gi|1708388|sp|P27321|ICAL_RAT Calpain inhibitor (Calpastatin)          43   0.011
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]...    43   0.011
gi|6324193|ref|NP_014263.1| Subunit of the NuA4 histone acetyltr...    43   0.011
gi|50753318|ref|XP_413956.1| PREDICTED: similar to microtubule-a...    43   0.011
gi|10636021|emb|CAC10616.1| gamma-gliadin [Aegilops longissima]        42   0.015
gi|38102578|gb|EAA49399.1| hypothetical protein MG01057.4 [Magna...    42   0.015
gi|10947054|ref|NP_066187.1| ankyrin 2 isoform 2; ankyrin, noner...    42   0.015
gi|254751|gb|AAB23118.1| precursor [Chironomus tentans]                42   0.015
gi|23509422|ref|NP_702089.1| hypothetical protein [Plasmodium fa...    42   0.015
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ...    42   0.015
gi|47564823|ref|ZP_00235867.1| collagen adhesin protein, putativ...    42   0.015
gi|31873714|emb|CAD97827.1| hypothetical protein [Homo sapiens]        42   0.015
gi|46444915|gb|EAL04187.1| hypothetical protein CaO19.12167 [Can...    42   0.015
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno...    42   0.015
gi|39594827|emb|CAE70695.1| Hypothetical protein CBG17418 [Caeno...    42   0.015
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ...    42   0.015
gi|41203898|ref|XP_372522.1| similar to Plasmodium falciparum tr...    42   0.015
gi|50417567|gb|AAH77588.1| K14 protein [Xenopus laevis]                42   0.015
gi|39579268|emb|CAE56955.1| Hypothetical protein CBG24805 [Caeno...    42   0.015
gi|39979119|emb|CAE85494.1| putative protein [Neurospora crassa]       42   0.015
gi|49478172|ref|YP_037430.1| conserved hypothetical protein [Bac...    42   0.015
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (...    42   0.015
gi|1703310|sp|Q01484|ANK2_HUMAN Ankyrin 2 (Brain ankyrin) (Ankyr...    42   0.015


>gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD)
           (col-88) [Caenorhabditis elegans]
 gi|7509019|pir||T32872 hypothetical protein W05G11.3 -
           Caenorhabditis elegans
 gi|2746919|gb|AAC71147.1| Hypothetical protein W05G11.3
           [Caenorhabditis elegans]
          Length = 302

 Score =  317 bits (812), Expect = 2e-85
 Identities = 174/302 (57%), Positives = 174/302 (57%)
 Frame = +1

Query: 1   MSSNTILIGTQVILSTAILGSLLYAGVLYSEINELRDDVLQDMHSFRGLANDAWRSMVQA 180
           MSSNTILIGTQVILSTAILGSLLYAGVLYSEINELRDDVLQDMHSFRGLANDAWRSMVQA
Sbjct: 1   MSSNTILIGTQVILSTAILGSLLYAGVLYSEINELRDDVLQDMHSFRGLANDAWRSMVQA 60

Query: 181 NAPVNGGALPDFGSIFTRAKRSGSCNCGPQPSNCXXXXXXXXXXXXXXXXXXENGQAGPN 360
           NAPVNGGALPDFGSIFTRAKRSGSCNCGPQPSNC                  ENGQAGPN
Sbjct: 61  NAPVNGGALPDFGSIFTRAKRSGSCNCGPQPSNCPAGPPGPPGAPGDAGLDGENGQAGPN 120

Query: 361 XXXXXXXXXXXXXXECITCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 540
                         ECITC
Sbjct: 121 GQDGAGQGSSQQPSECITCPAGAPGPQGPDGPAGAPGADGQAGSPGAPGQDGQPGGPGAQ 180

Query: 541 XXXXXXXXXXTPGQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 720
                     TPGQD
Sbjct: 181 GDAGAPGNDGTPGQDGAPGQNGQRGNGAAGAPGPQGPAGNAGQAGQPGADGQPGAQGSAG 240

Query: 721 IAGAPGQPGKAGEDGEAGENGTDGEPGTDAEYCQCPPRTGAIEVEPATQEEGYKRRKYRF 900
           IAGAPGQPGKAGEDGEAGENGTDGEPGTDAEYCQCPPRTGAIEVEPATQEEGYKRRKYRF
Sbjct: 241 IAGAPGQPGKAGEDGEAGENGTDGEPGTDAEYCQCPPRTGAIEVEPATQEEGYKRRKYRF 300

Query: 901 SN 906
           SN
Sbjct: 301 SN 302




[DB home][top]