Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= W09G10_1
         (1866 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)...  1059   0.0
gi|25395485|pir||C88102 protein W09G10.6 [imported] - Caenorhabd...   274   5e-72
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno...   247   6e-64
gi|39580388|emb|CAE70947.1| Hypothetical protein CBG17757 [Caeno...   218   5e-55
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno...   199   5e-51
gi|39580387|emb|CAE70946.1| Hypothetical protein CBG17755 [Caeno...   204   8e-51
gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 k...   155   4e-36
gi|17511043|ref|NP_492871.1| chondroitin sulfate proteoglycan 3 ...   145   2e-33
gi|39592415|emb|CAE63492.1| Hypothetical protein CBG07961 [Caeno...   144   6e-33
gi|17536865|ref|NP_494582.1| c-type lectin family member (2D863)...   143   2e-32
gi|17536863|ref|NP_494583.1| c-type lectin family member (2D865)...   142   3e-32
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno...   140   8e-32
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family...   138   4e-31
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur...   138   4e-31
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb...   136   2e-30
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family...   134   1e-29
gi|17536861|ref|NP_494585.1| c-type lectin family member (2D867)...   133   2e-29
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb...   133   2e-29
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb...   132   4e-29
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family...   130   8e-29
gi|17537303|ref|NP_494565.1| predicted CDS, putative protein fam...   130   1e-28
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb...   130   1e-28
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb...   129   2e-28
gi|17509255|ref|NP_493210.1| c-type lectin family member (1N275)...   129   3e-28
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor...   128   5e-28
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ...   128   5e-28
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab...   128   5e-28
gi|17511037|ref|NP_492866.1| c-type lectin precursor family memb...   127   9e-28
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb...   125   3e-27
gi|17509731|ref|NP_493248.1| c-type lectin precursor family memb...   120   1e-25
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k...   114   1e-23
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi...   114   1e-23
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno...   113   1e-23
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno...   113   2e-23
gi|39592448|emb|CAE63525.1| Hypothetical protein CBG08004 [Caeno...   107   8e-22
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur...   105   5e-21
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur...   104   6e-21
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno...   103   1e-20
gi|39580389|emb|CAE70948.1| Hypothetical protein CBG17758 [Caeno...   102   2e-20
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam...   101   5e-20
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family...   101   5e-20
gi|17560612|ref|NP_507185.1| predicted CDS, putative secreted or...   101   7e-20
gi|17560214|ref|NP_507154.1| predicted CDS, c-type lectin precur...   100   1e-19
gi|17561204|ref|NP_507306.1| predicted CDS, low affinity IgE Fc ...   100   1e-19
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb...   100   2e-19
gi|17558364|ref|NP_507555.1| predicted CDS, c-type lectin family...    99   3e-19
gi|17536551|ref|NP_496528.1| c-type lectin precursor family memb...    99   3e-19
gi|17561202|ref|NP_507305.1| predicted CDS, low affinity IgE Fc ...    97   1e-18
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family...    96   2e-18
gi|17565896|ref|NP_503376.1| predicted CDS, c-type lectin family...    96   2e-18
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6...    95   7e-18
gi|39580384|emb|CAE70943.1| Hypothetical protein CBG17751 [Caeno...    94   9e-18
gi|17506689|ref|NP_493310.1| putative protein family member (1N7...    94   1e-17
gi|39592447|emb|CAE63524.1| Hypothetical protein CBG08003 [Caeno...    93   2e-17
gi|33300606|emb|CAE17978.1| Hypothetical protein Y18D10A.24 [Cae...    93   3e-17
gi|17510207|ref|NP_492857.1| c-type lectin family member (1L607)...    89   3e-16
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae...    89   3e-16
gi|39592428|emb|CAE63505.1| Hypothetical protein CBG07982 [Caeno...    88   8e-16
gi|39592446|emb|CAE63523.1| Hypothetical protein CBG08002 [Caeno...    87   1e-15
gi|39590393|emb|CAE66132.1| Hypothetical protein CBG11356 [Caeno...    86   3e-15
gi|39592429|emb|CAE63506.1| Hypothetical protein CBG07983 [Caeno...    85   7e-15
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb...    84   9e-15
gi|39580257|emb|CAE69649.1| Hypothetical protein CBG15894 [Caeno...    83   2e-14
gi|17536719|ref|NP_493771.1| c-type lectin family member (2A900)...    82   6e-14
gi|17566546|ref|NP_507913.1| c-type lectin precursor family memb...    81   8e-14
gi|39590136|emb|CAE61134.1| Hypothetical protein CBG04895 [Caeno...    80   2e-13
gi|39590141|emb|CAE61139.1| Hypothetical protein CBG04901 [Caeno...    79   3e-13
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family...    79   3e-13
gi|39590135|emb|CAE61133.1| Hypothetical protein CBG04894 [Caeno...    79   3e-13
gi|17560038|ref|NP_507097.1| c-type lectin family member (5Q715)...    79   5e-13
gi|39590134|emb|CAE61132.1| Hypothetical protein CBG04893 [Caeno...    78   8e-13
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno...    78   8e-13
gi|17509827|ref|NP_493289.1| c-type lectin precursor family memb...    77   2e-12
gi|17510251|ref|NP_492880.1| predicted CDS, c-type lectin precur...    75   5e-12
gi|39590099|emb|CAE61097.1| Hypothetical protein CBG04852 [Caeno...    75   5e-12
gi|39590137|emb|CAE61135.1| Hypothetical protein CBG04896 [Caeno...    72   6e-11
gi|39591912|emb|CAE75132.1| Hypothetical protein CBG23060 [Caeno...    70   1e-10
gi|17566540|ref|NP_507917.1| predicted CDS, putative protein fam...    70   1e-10
gi|39590447|emb|CAE66187.1| Hypothetical protein CBG11425 [Caeno...    70   2e-10
gi|39585189|emb|CAE57432.1| Hypothetical protein CBG00393 [Caeno...    70   2e-10
gi|17510429|ref|NP_493430.1| predicted CDS, c-type lectin family...    69   3e-10
gi|17560662|ref|NP_507006.1| c-type lectin family member (5Q453)...    69   3e-10
gi|39585190|emb|CAE57433.1| Hypothetical protein CBG00394 [Caeno...    67   1e-09
gi|17566100|ref|NP_507868.1| c-type lectin family member (5U452)...    66   3e-09
gi|17539326|ref|NP_503090.1| versican family member, possibly N-...    65   4e-09
gi|17539324|ref|NP_503089.1| putative protein family member, wit...    65   6e-09
gi|39592405|emb|CAE63482.1| Hypothetical protein CBG07950 [Caeno...    65   7e-09
gi|17559102|ref|NP_505754.1| predicted CDS, c-type lectin family...    65   7e-09
gi|17506693|ref|NP_493312.1| putative protein family member (1N7...    65   7e-09
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno...    64   1e-08
gi|39591537|emb|CAE71113.1| Hypothetical protein CBG17966 [Caeno...    64   1e-08
gi|33300312|emb|CAE17891.1| Hypothetical protein M199.6 [Caenorh...    64   1e-08
gi|39590140|emb|CAE61138.1| Hypothetical protein CBG04899 [Caeno...    64   2e-08
gi|17544386|ref|NP_502991.1| c-type lectin precursor family memb...    63   2e-08
gi|17559816|ref|NP_505795.1| c-type lectin precursor family memb...    63   3e-08
gi|17539148|ref|NP_501134.1| c-type lectin family member (4H948)...    62   4e-08
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno...    62   5e-08
gi|39590143|emb|CAE61141.1| Hypothetical protein CBG04903 [Caeno...    60   1e-07
gi|17544394|ref|NP_502996.1| c-type lectin family member (4R777)...    60   2e-07
gi|17562684|ref|NP_507837.1| putative protein family member (5U2...    59   4e-07
gi|17565952|ref|NP_507583.1| c-type lectin precursor family memb...    59   4e-07
gi|17553180|ref|NP_498001.1| predicted CDS, c-type lectin family...    59   5e-07
gi|39591539|emb|CAE71115.1| Hypothetical protein CBG17968 [Caeno...    59   5e-07
gi|39589078|emb|CAE57810.1| Hypothetical protein CBG00834 [Caeno...    58   7e-07
gi|17506151|ref|NP_493484.1| predicted CDS, putative protein fam...    57   1e-06
gi|7497627|pir||T20046 hypothetical protein C49A1.9 - Caenorhabd...    57   1e-06
gi|17543488|ref|NP_500445.1| c-type lectin family member (65.9 k...    57   1e-06
gi|17565266|ref|NP_507666.1| predicted CDS, c-type lectin family...    57   1e-06
gi|17511041|ref|NP_492870.1| putative secreted or extracellular ...    56   3e-06
gi|17559100|ref|NP_505753.1| putative protein family member (5L2...    56   3e-06
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa...    55   4e-06
gi|39579666|emb|CAE56464.1| Hypothetical protein CBG24174 [Caeno...    55   4e-06
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno...    55   4e-06
gi|17531917|ref|NP_494490.1| putative protein family member (2D5...    54   1e-05
gi|39579641|emb|CAE56640.1| Hypothetical protein CBG24401 [Caeno...    54   1e-05
gi|17554888|ref|NP_497956.1| predicted CDS, c-type lectin family...    53   2e-05
gi|39579554|emb|CAE56072.1| Hypothetical protein CBG23650 [Caeno...    53   3e-05
gi|17531337|ref|NP_493698.1| c-type lectin precursor family memb...    52   4e-05
gi|17553032|ref|NP_497944.1| predicted CDS, c-type lectin family...    51   8e-05
gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)...    51   8e-05
gi|39583020|emb|CAE71799.1| Hypothetical protein CBG18810 [Caeno...    51   8e-05
gi|39582517|emb|CAE65604.1| Hypothetical protein CBG10625 [Caeno...    51   8e-05
gi|17557544|ref|NP_505863.1| putative protein family member (5L7...    50   1e-04
gi|17541614|ref|NP_502826.1| putative secreted or extracellular ...    50   2e-04
gi|17542442|ref|NP_501639.1| putative protein (4K93) [Caenorhabd...    50   2e-04
gi|7674107|sp|Q9YGP1|LECG_TRIST Galactose-binding lectin precurs...    50   2e-04
gi|17563062|ref|NP_506460.1| predicted CDS, putative protein fam...    50   2e-04
gi|39583006|emb|CAE71785.1| Hypothetical protein CBG18789 [Caeno...    49   4e-04
gi|39583048|emb|CAE71827.1| Hypothetical protein CBG18868 [Caeno...    49   4e-04
gi|17559556|ref|NP_507665.1| predicted CDS, c-type lectin family...    49   5e-04
gi|17553034|ref|NP_497946.1| c-type lectin precursor family memb...    48   7e-04
gi|17553030|ref|NP_497945.1| c-type lectin family member (3F723)...    48   7e-04
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ...    48   0.001
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ...    48   0.001
gi|17508069|ref|NP_493489.1| c-type lectin family member (1O843)...    48   0.001
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat...    47   0.001
gi|17540466|ref|NP_500450.1| c-type lectin family member (65.9 k...    47   0.001
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ...    47   0.001
gi|33300499|emb|CAE18002.1| Hypothetical protein Y51A2A.11 [Caen...    47   0.002
gi|39582793|emb|CAE74256.1| Hypothetical protein CBG21945 [Caeno...    47   0.002
gi|39584131|emb|CAE61506.1| Hypothetical protein CBG05405 [Caeno...    47   0.002
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga...    47   0.002
gi|39583394|emb|CAE66369.1| Hypothetical protein CBG11628 [Caeno...    46   0.003
gi|47551311|ref|NP_999836.1| echinoidin [Strongylocentrotus purp...    46   0.004
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ...    45   0.005
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (...    45   0.005
gi|17565950|ref|NP_507582.1| predicted CDS, putative protein fam...    45   0.005
gi|39580256|emb|CAE69648.1| Hypothetical protein CBG15893 [Caeno...    45   0.006
gi|3023229|sp|P81111|ABA1_TRIAB Alboaggregin A subunit 1               45   0.006
gi|47218860|emb|CAG02845.1| unnamed protein product [Tetraodon n...    45   0.006
gi|17507421|ref|NP_493450.1| putative protein family member (1O6...    45   0.006
gi|33341210|gb|AAQ15166.1| stejaggregin-A alpha chain [Trimeresu...    45   0.008
gi|17562694|ref|NP_507835.1| putative protein (5U249) [Caenorhab...    44   0.010
gi|126130|sp|P21963|LECG_CROAT Galactose-specific lectin >gnl|BL...    44   0.010
gi|17510431|ref|NP_493431.1| putative endoplasmic reticulum prot...    44   0.010
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep...    44   0.010
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n...    44   0.013
gi|39587221|emb|CAE57689.1| Hypothetical protein CBG00688 [Caeno...    44   0.017
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica]        43   0.023
gi|39579291|emb|CAE56680.1| Hypothetical protein CBG24456 [Caeno...    43   0.023
gi|17558760|ref|NP_504967.1| predicted CDS, putative cytoplasmic...    43   0.023
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno...    43   0.023
gi|34922643|sp|Q9PSM4|LECG_LACST Galactose-specific lectin (Muti...    43   0.023
gi|39579198|emb|CAE56057.1| Hypothetical protein CBG23631 [Caeno...    43   0.030
gi|4337050|gb|AAD18055.1| fibrinogen clotting inhibitor A chain ...    43   0.030
gi|17536959|ref|NP_494450.1| c-type lectin precursor family memb...    43   0.030
gi|17544698|ref|NP_502451.1| phospholipase A2 receptor precursor...    43   0.030
gi|34922645|sp|Q9PSN0|LECG_BITAR Galactose-specific lectin (PAL)...    43   0.030
gi|39587076|emb|CAE57543.1| Hypothetical protein CBG00520 [Caeno...    43   0.030
gi|4808981|gb|AAD30041.1| receptor protein-tyrosine kinase; HTK2...    43   0.030
gi|11277028|pir||JC7134 agkisacutacin alpha chain precursor - sh...    42   0.039
gi|39583395|emb|CAE66370.1| Hypothetical protein CBG11629 [Caeno...    42   0.039
gi|34922459|sp|P83519|LECG_BOTJR Galactose-specific lectin (BJcuL)     42   0.039
gi|37182231|gb|AAQ88918.1| RPGT208 [Homo sapiens]                      42   0.051
gi|15925644|ref|NP_373178.1| hypothetical protein SAV2654 [Staph...    42   0.051
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n...    42   0.051
gi|28630386|gb|AAN08139.1| vitelline coat lysin M7 precursor [My...    42   0.051
gi|39579539|emb|CAE56431.1| Hypothetical protein CBG24130 [Caeno...    42   0.066
gi|39578827|emb|CAE57103.1| Hypothetical protein CBG25004 [Caeno...    42   0.066
gi|48870355|ref|ZP_00323079.1| hypothetical protein PpenA0100100...    42   0.066
gi|28630358|gb|AAN08125.1| vitelline coat lysin M7 precursor [My...    42   0.066
gi|28630360|gb|AAN08126.1| vitelline coat lysin M7 precursor [My...    42   0.066
gi|28630370|gb|AAN08131.1| vitelline coat lysin M7 precursor [My...    42   0.066
gi|28630380|gb|AAN08136.1| vitelline coat lysin M7 precursor [My...    42   0.066
gi|17540278|ref|NP_502932.1| predicted CDS, c-type lectin family...    42   0.066
gi|17531799|ref|NP_494750.1| putative protein family member (2E5...    42   0.066
gi|19703636|ref|NP_603198.1| Hemolysin [Fusobacterium nucleatum ...    42   0.066
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ...    42   0.066
gi|39581670|emb|CAE57178.1| Hypothetical protein CBG00017 [Caeno...    42   0.066
gi|9631400|ref|NP_048301.1| ORF MSV230 hypothetical protein [Mel...    41   0.086
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le...    41   0.086
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti...    41   0.086
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens]    41   0.086
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens]            41   0.086
gi|3023230|sp|P81112|ABA2_TRIAB Alboaggregin A subunit 2               41   0.086
gi|39579131|emb|CAE57020.1| Hypothetical protein CBG24896 [Caeno...    41   0.11
gi|39581152|emb|CAE71009.1| Hypothetical protein CBG17848 [Caeno...    41   0.11
gi|34979184|gb|AAQ83725.1| dendritic cell-associated lectin 2 [H...    41   0.11
gi|286056|dbj|BAA03551.1| vitelline coat lysin M7 precursor [Myt...    41   0.11
gi|1078940|pir||JX0347 acrosomal major protein M7 - blue mussel ...    41   0.11
gi|28630362|gb|AAN08127.1| vitelline coat lysin M7 precursor [My...    41   0.11
gi|28630368|gb|AAN08130.1| vitelline coat lysin M7 precursor [My...    41   0.11
gi|20273044|gb|AAF26286.2| agkisacutacin A chain [Deinagkistrodo...    40   0.15
gi|14719570|pdb|1IOD|A Chain A, Crystal Structure Of The Complex...    40   0.15
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;...    40   0.15
gi|17539972|ref|NP_502157.1| predicted CDS, putative protein fam...    40   0.15
gi|16758588|ref|NP_446205.1| C-type lectin, superfamily member 1...    40   0.15
gi|37537732|gb|AAQ92957.1| BJcuL precursor [Bothrops jararacussu]      40   0.15
gi|33341200|gb|AAQ15161.1| stejaggregin-B alpha chain-2 [Trimere...    40   0.19
gi|33341208|gb|AAQ15165.1| stejaggregin-B alpha chain-4 [Trimere...    40   0.19
gi|33341198|gb|AAQ15160.1| stejaggregin-B alpha chain-1 [Trimere...    40   0.19
gi|17558764|ref|NP_504965.1| predicted CDS, putative protein fam...    40   0.19
gi|39581623|emb|CAE71744.1| Hypothetical protein CBG18729 [Caeno...    40   0.19
gi|23321261|gb|AAN23125.1| agglucetin-alpha 2 subunit precursor ...    40   0.19
gi|17507129|ref|NP_493188.1| predicted CDS, c-type lectin precur...    40   0.19
gi|6010435|gb|AAF01135.1| erythrocyte membrane protein 3 [Plasmo...    40   0.19
gi|19263589|gb|AAH25407.1| Layilin [Homo sapiens]                      40   0.19
gi|16550435|dbj|BAB70978.1| unnamed protein product [Homo sapiens]     40   0.19
gi|30520331|ref|NP_849156.1| layilin [Homo sapiens] >gnl|BL_ORD_...    40   0.19
gi|2851435|sp|P23806|IXA_TRIFL Coagulation factor IX/factor X-bi...    40   0.25
gi|3212543|pdb|1IXX|A Chain A, Crystal Structure Of Coagulation ...    40   0.25
gi|12583677|dbj|BAB21452.1| factor XI/factor X binding protein A...    40   0.25
gi|39588321|emb|CAE72672.1| Hypothetical protein CBG19888 [Caeno...    40   0.25
gi|38087781|ref|XP_285518.2| RIKEN cDNA 4930401M13 [Mus musculus]      40   0.25
gi|37619781|emb|CAA84655.3| Hypothetical protein F10F2.5 [Caenor...    39   0.33
gi|39586507|emb|CAE73634.1| Hypothetical protein CBG21131 [Caeno...    39   0.33
gi|16804919|ref|NP_472948.1| erythrocyte membrane protein 3 [Pla...    39   0.33
gi|38090330|ref|XP_146887.2| similar to layilin [Mus musculus]         39   0.33
gi|26352257|dbj|BAC39765.1| unnamed protein product [Mus musculus]     39   0.33
gi|21284304|ref|NP_647392.1| ORFID:MW2575~hypothetical protein, ...    39   0.33
gi|41353970|gb|AAS01426.1| C-type lectin [Bothrops insularis]          39   0.33
gi|18252680|gb|AAL66391.1| antithrombin 1 A chain [Deinagkistrod...    39   0.33
gi|39587799|emb|CAE67817.1| Hypothetical protein CBG13397 [Caeno...    39   0.33
gi|39585607|emb|CAE65367.1| Hypothetical protein CBG10312 [Caeno...    39   0.33
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h...    39   0.43
gi|39584666|emb|CAE72419.1| Hypothetical protein CBG19581 [Caeno...    39   0.43
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma...    39   0.43
gi|42522250|ref|NP_967630.1| chemotaxis protein [Bdellovibrio ba...    39   0.56
gi|20562937|gb|AAM22786.1| ACF 1/2 A-chain [Deinagkistrodon acutus]    39   0.56
gi|8980619|dbj|BAA99281.1| anticoagulant protein A [Deinagkistro...    39   0.56
gi|47225069|emb|CAF97484.1| unnamed protein product [Tetraodon n...    39   0.56
gi|17541218|ref|NP_500091.1| predicted CDS, c-type lectin family...    39   0.56
gi|47270749|gb|AAC04420.2| Hypothetical protein K03H6.4 [Caenorh...    39   0.56
gi|6322945|ref|NP_013018.1| Suppressor of mutant AC40 subunit of...    39   0.56
gi|295671|gb|AAA35091.1| selected as a weak suppressor of a muta...    39   0.56
gi|26349637|dbj|BAC38458.1| unnamed protein product [Mus musculus]     39   0.56
gi|33332305|gb|AAQ11364.1| crotocetin-1 [Crotalus durissus terri...    39   0.56
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ...    38   0.73
gi|42662574|ref|XP_088636.5| cylicin, basic protein of sperm hea...    38   0.73
gi|1364010|pir||JC4329 coagulation factor IX-binding protein A c...    38   0.73
gi|17544382|ref|NP_502990.1| predicted CDS, c-type lectin family...    38   0.73
gi|18072158|gb|AAL58470.1| serine-threonine rich antigen [Staphy...    38   0.73
gi|49487433|ref|YP_044654.1| putative cell wall-anchored protein...    38   0.73
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ...    38   0.73
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens]                     38   0.73
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]...    38   0.73
gi|15226432|ref|NP_179693.1| hypothetical protein [Arabidopsis t...    38   0.73
gi|25527245|pir||JC7786 lectin CEL-I, N-acetyl-D-galactosamine-s...    38   0.73
gi|544124|sp|P35663|CYL1_HUMAN Cylicin I (Multiple-band polypept...    38   0.73
gi|39581611|emb|CAE58396.1| Hypothetical protein CBG01525 [Caeno...    38   0.95
gi|32697984|emb|CAB02800.2| Hypothetical protein C29F3.4 [Caenor...    38   0.95
gi|3790610|gb|AAC68695.1| layilin [Cricetulus griseus]                 38   0.95
gi|17559578|ref|NP_504584.1| immunoglobulin-like and fibronectin...    37   1.2
gi|39587121|emb|CAE57588.1| Hypothetical protein CBG00568 [Caeno...    37   1.2
gi|24620453|gb|AAN61517.1| 2MDa_1 protein [Caenorhabditis elegans]     37   1.2
gi|32396016|gb|AAP42417.1| c-type lectin [Bothrops jararacussu]        37   1.2
gi|3287903|sp|P81397|RHCA_AGKRH Rhodocetin alpha subunit               37   1.2
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE...    37   1.2
gi|17539582|ref|NP_500691.1| predicted CDS, putative protein fam...    37   1.2
gi|7498955|pir||T34418 hypothetical protein F12F3.3 - Caenorhabd...    37   1.2
gi|28630400|gb|AAN08146.1| vitelline coat lysin M7 precursor [My...    37   1.2
gi|15828935|ref|NP_326295.1| predicted coding region [Mycoplasma...    37   1.2
gi|24620454|gb|AAN61518.1| 2MDa_2 protein [Caenorhabditis elegans]     37   1.2
gi|50756261|ref|XP_415085.1| PREDICTED: similar to Golgi autoant...    37   1.6
gi|37360054|dbj|BAC98005.1| mKIAA0709 protein [Mus musculus]           37   1.6
gi|39581194|emb|CAE73599.1| Hypothetical protein CBG21085 [Caeno...    37   1.6
gi|39580482|emb|CAE70452.1| Hypothetical protein CBG17033 [Caeno...    37   1.6
gi|39596092|emb|CAE69728.1| Hypothetical protein CBG15999 [Caeno...    37   1.6
gi|17553028|ref|NP_497947.1| putative protein family member (3F7...    37   1.6
gi|34858419|ref|XP_232393.2| similar to dendritic cell immunorec...    37   1.6
gi|39579290|emb|CAE56946.1| Hypothetical protein CBG24793 [Caeno...    37   1.6
gi|39587227|emb|CAE57695.1| Hypothetical protein CBG00698 [Caeno...    37   1.6
gi|17561852|ref|NP_506804.1| predicted CDS, c-type lectin family...    37   2.1
gi|627047|pir||A54503 51k merozoite surface antigen - malaria pa...    37   2.1
gi|39581808|emb|CAE74181.1| Hypothetical protein CBG21854 [Caeno...    37   2.1
gi|28829800|gb|AAO52302.1| similar to Homo sapiens (Human). Dent...    37   2.1
gi|290002|gb|AAA49200.1| antifreeze protein >gnl|BL_ORD_ID|11388...    37   2.1
gi|39580589|emb|CAE70485.1| Hypothetical protein CBG17082 [Caeno...    37   2.1
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu...    37   2.1
gi|39579546|emb|CAE56386.1| Hypothetical protein CBG24070 [Caeno...    37   2.1
gi|47227138|emb|CAG00500.1| unnamed protein product [Tetraodon n...    37   2.1
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s...    37   2.1
gi|34098512|sp|Q8BR07|BCD1_MOUSE Cytoskeleton-like bicaudal D pr...    36   2.8
gi|33859516|ref|NP_033883.1| bicaudal D homolog 1 [Mus musculus]...    36   2.8
gi|26349757|dbj|BAC38518.1| unnamed protein product [Mus musculus]     36   2.8
gi|39579789|emb|CAE56528.1| Hypothetical protein CBG24254 [Caeno...    36   2.8
gi|26342142|dbj|BAC34733.1| unnamed protein product [Mus musculus]     36   2.8
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor...    36   2.8
gi|7800480|gb|AAF70056.1| serum opacity factor precursor; Sof [S...    36   2.8
gi|19351901|emb|CAC81709.1| bicaudal D protein [Mus musculus]          36   2.8
gi|39579834|emb|CAE56843.1| Hypothetical protein CBG24670 [Caeno...    36   2.8
gi|39587220|emb|CAE57688.1| Hypothetical protein CBG00687 [Caeno...    36   2.8
gi|47214961|emb|CAG10783.1| unnamed protein product [Tetraodon n...    36   2.8
gi|17559570|ref|NP_507658.1| predicted CDS, putative secreted or...    36   2.8
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di...    36   2.8
gi|50292419|ref|XP_448642.1| unnamed protein product [Candida gl...    36   3.6
gi|50302181|ref|XP_451024.1| unnamed protein product [Kluyveromy...    36   3.6
gi|23507919|ref|NP_700589.1| QF122 antigen [Plasmodium falciparu...    36   3.6
gi|28630398|gb|AAN08145.1| vitelline coat lysin M7 precursor [My...    36   3.6
gi|28630390|gb|AAN08141.1| vitelline coat lysin M7 precursor [My...    36   3.6
gi|46227256|gb|EAK88206.1| similar to hypothetical protein [Cryp...    36   3.6
gi|23509061|ref|NP_701729.1| hypothetical protein [Plasmodium fa...    36   3.6
gi|50582493|dbj|BAD32701.1| vitellogenin [Gallus gallus]               35   4.7
gi|19923672|ref|NP_036922.2| dentin sailophosphoprotein; Dentin ...    35   4.7
gi|39585067|emb|CAE62718.1| Hypothetical protein CBG06873 [Caeno...    35   4.7
gi|39597798|emb|CAE68490.1| Hypothetical protein CBG14295 [Caeno...    35   4.7
gi|39588808|emb|CAE58332.1| Hypothetical protein CBG01445 [Caeno...    35   4.7
gi|98569|pir||S21178 botulinum neurotoxin type E precursor - Clo...    35   4.7
gi|1084230|pir||S48106 neurotoxin type E - Clostridium botulinum...    35   4.7
gi|407787|emb|CAA50146.1| botulinum neurotoxin type E [Clostridi...    35   4.7
gi|8489491|gb|AAF75680.1| opacity factor Sof precursor [Streptoc...    35   4.7
gi|25392184|pir||JC7595 scavenger receptor with C-type lectin ty...    35   4.7
gi|38174510|gb|AAH60789.1| Collectin sub-family member 12, isofo...    35   4.7
gi|399135|sp|Q00496|BXE_CLOBO Botulinum neurotoxin type E precur...    35   4.7
gi|23613114|ref|NP_703436.1| chromosome condensation protein, pu...    35   4.7
gi|39581146|emb|CAE71003.1| Hypothetical protein CBG17839 [Caeno...    35   4.7
gi|15829164|ref|NP_326524.1| MEMBRANE NUCLEASE, LIPOPROTEIN [Myc...    35   4.7
gi|23490695|gb|EAA22410.1| hypothetical protein [Plasmodium yoel...    35   4.7
gi|39582943|emb|CAE73008.1| Hypothetical protein CBG20364 [Caeno...    35   4.7
gi|33300313|emb|CAE17892.1| Hypothetical protein M199.7 [Caenorh...    35   4.7
gi|4808979|gb|AAD30040.1| receptor protein-tyrosine kinase; HTK2...    35   4.7
gi|39579251|emb|CAE56965.1| Hypothetical protein CBG24816 [Caeno...    35   4.7
gi|1903280|emb|CAA98620.1| USO1 [Saccharomyces cerevisiae]             35   6.2
gi|42660713|ref|XP_042234.4| similar to FLJ00143 protein [Homo s...    35   6.2
gi|18641360|ref|NP_569057.1| collectin sub-family member 12 isof...    35   6.2
gi|6320145|ref|NP_010225.1| involved intracellular protein trans...    35   6.2
gi|48871164|ref|ZP_00323880.1| COG0711: F0F1-type ATP synthase, ...    35   6.2
gi|137175|sp|P25386|USO1_YEAST Intracellular protein transport p...    35   6.2
gi|39591430|emb|CAE73484.1| Hypothetical protein CBG20936 [Caeno...    35   6.2
gi|32477034|ref|NP_870028.1| hypothetical protein-signal peptide...    35   6.2
gi|39579848|emb|CAE56857.1| Hypothetical protein CBG24685 [Caeno...    35   6.2
gi|19584340|emb|CAD28466.1| hypothetical protein [Homo sapiens]        35   6.2
gi|39590017|emb|CAE61015.1| Hypothetical protein CBG04754 [Caeno...    35   6.2
gi|49484850|ref|YP_042074.1| putative serine rich repeat contain...    35   6.2
gi|4502409|ref|NP_001705.1| Bicaudal D homolog 1; Bicaudal-D, Dr...    35   8.1
gi|46124093|ref|XP_386600.1| hypothetical protein FG06424.1 [Gib...    35   8.1
gi|39579486|emb|CAE56876.1| Hypothetical protein CBG24712 [Caeno...    35   8.1
gi|24217045|ref|NP_714526.1| ParB-like nuclease domain [Leptospi...    35   8.1
gi|17557546|ref|NP_505862.1| putative protein (5L753) [Caenorhab...    35   8.1
gi|39582435|emb|CAE74819.1| Hypothetical protein CBG22655 [Caeno...    35   8.1
gi|39578904|emb|CAE56686.1| Hypothetical protein CBG24464 [Caeno...    35   8.1
gi|4322670|gb|AAD16120.1| dentin phosphoryn [Homo sapiens]             35   8.1
gi|677198|gb|AAB00143.1| putative                                      35   8.1
gi|39588818|emb|CAE69448.1| Hypothetical protein CBG15638 [Caeno...    35   8.1


>gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)
            [Caenorhabditis elegans]
 gi|6042175|gb|AAF02173.1| Hypothetical protein W09G10.6
            [Caenorhabditis elegans]
          Length = 621

 Score = 1059 bits (2738), Expect = 0.0
 Identities = 543/621 (87%), Positives = 543/621 (87%)
 Frame = +1

Query: 1    MLKIGSRNRGNGPCVDLTTYYSVXXXXXXXXXXXXXXXWMVEDLEQTLKLRSDAQEDQKM 180
            MLKIGSRNRGNGPCVDLTTYYSV               WMVEDLEQTLKLRSDAQEDQKM
Sbjct: 1    MLKIGSRNRGNGPCVDLTTYYSVEEDYDGKSDDDGSKYWMVEDLEQTLKLRSDAQEDQKM 60

Query: 181  KLQVEKSSRSSKDQSLDLGDSKTGIALVGVKLQADGSQGSKDQNLVGKIQKDQASQKDQK 360
            KLQVEKSSRSSKDQSLDLGDSKTGIALVGVKLQADGSQGSKDQNLVGKIQKDQASQKDQK
Sbjct: 61   KLQVEKSSRSSKDQSLDLGDSKTGIALVGVKLQADGSQGSKDQNLVGKIQKDQASQKDQK 120

Query: 361  LNLQANEXXXXXXXXXXXXXXXXXXXAKVIMELQADGTYRLKDQKLTAKIQKDQNSDSKT 540
            LNLQANE                   AKVIMELQADGTYRLKDQKLTAKIQKDQNSDSKT
Sbjct: 121  LNLQANESSRNSKDQSSDSSGSKSGNAKVIMELQADGTYRLKDQKLTAKIQKDQNSDSKT 180

Query: 541  IEDIFNREFEADGLKDQNSKSKDSNTDEASLNVKLQGSQASKDQKASSGAFKXXXXXXXX 720
            IEDIFNREFEADGLKDQNSKSKDSNTDEASLNVKLQGSQASKDQKASSGAFK
Sbjct: 181  IEDIFNREFEADGLKDQNSKSKDSNTDEASLNVKLQGSQASKDQKASSGAFKSLLSQSSD 240

Query: 721  XXXXXXXXTAQLTSTNLGGSGSELSQXXXXXXXXXXXXXQVHLASHQHTRNELSQKTDLS 900
                    TAQLTSTNLGGSGSELSQ             QVHLASHQHTRNELSQKTDLS
Sbjct: 241  LTASSSNLTAQLTSTNLGGSGSELSQKLNDLKSNSDSSDQVHLASHQHTRNELSQKTDLS 300

Query: 901  VTTDEKNQKTGFSQNHLINSSLAVSELNNNGKLSGTEVQETVEINQRKDLGNLRDQSSKN 1080
            VTTDEKNQKTGFSQNHLINSSLAVSELNNNGKLSGTEVQETVEINQRKDLGNLRDQSSKN
Sbjct: 301  VTTDEKNQKTGFSQNHLINSSLAVSELNNNGKLSGTEVQETVEINQRKDLGNLRDQSSKN 360

Query: 1081 LKLEGSEALRSSVDLKKRSLEDQKLSSKDLKTGVAGAXXXXXXXXXXXXXXXTDLNTDAS 1260
            LKLEGSEALRSSVDLKKRSLEDQKLSSKDLKTGVAGA               TDLNTDAS
Sbjct: 361  LKLEGSEALRSSVDLKKRSLEDQKLSSKDLKTGVAGAQSSSSSDRKDQSSSSTDLNTDAS 420

Query: 1261 QLELNQNQKRVLIGSDVPLTGEACSKKEQGNCEAGWKSFLRPSGEWCMKIFYENSITQPS 1440
            QLELNQNQKRVLIGSDVPLTGEACSKKEQGNCEAGWKSFLRPSGEWCMKIFYENSITQPS
Sbjct: 421  QLELNQNQKRVLIGSDVPLTGEACSKKEQGNCEAGWKSFLRPSGEWCMKIFYENSITQPS 480

Query: 1441 AENRCQAQGATLSGLQNQIESFYITYTVSSHIYPESGSIWIGLKRREECKNVGRTQNCTS 1620
            AENRCQAQGATLSGLQNQIESFYITYTVSSHIYPESGSIWIGLKRREECKNVGRTQNCTS
Sbjct: 481  AENRCQAQGATLSGLQNQIESFYITYTVSSHIYPESGSIWIGLKRREECKNVGRTQNCTS 540

Query: 1621 DNSFEWTDKSTTGLDGIDWDGGQPDNARRYSQQCATLTASHQRSVIGYHVGRLDDVGCEF 1800
            DNSFEWTDKSTTGLDGIDWDGGQPDNARRYSQQCATLTASHQRSVIGYHVGRLDDVGCEF
Sbjct: 541  DNSFEWTDKSTTGLDGIDWDGGQPDNARRYSQQCATLTASHQRSVIGYHVGRLDDVGCEF 600

Query: 1801 DYIKTNRKQRDIKAFVCGKKA 1863
            DYIKTNRKQRDIKAFVCGKKA
Sbjct: 601  DYIKTNRKQRDIKAFVCGKKA 621




[DB home][top]