Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= W09G10_3
(618 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17536809|ref|NP_494568.1| COLlagen structural gene (col-72) [... 210 2e-53
gi|25395484|pir||A88102 protein W09G10.1 [imported] - Caenorhabd... 199 3e-50
gi|39581950|emb|CAE73812.1| Hypothetical protein CBG21362 [Caeno... 100 1e-36
gi|39588000|emb|CAE57231.1| Hypothetical protein CBG00101 [Caeno... 46 6e-11
gi|39593522|emb|CAE61814.1| Hypothetical protein CBG05782 [Caeno... 48 1e-09
gi|17539040|ref|NP_501123.1| COLlagen structural gene (35.6 kD) ... 47 3e-08
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 58 1e-07
gi|687634|gb|AAA62504.1| collagen 57 3e-07
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 57 4e-07
gi|39580427|emb|CAE69309.1| Hypothetical protein CBG15367 [Caeno... 39 2e-05
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre... 48 1e-04
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 48 2e-04
gi|17560484|ref|NP_505709.1| COLlagen structural gene (col-152) ... 39 2e-04
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 47 3e-04
gi|17505583|ref|NP_492091.1| COLlagen structural gene (col-62) [... 37 4e-04
gi|17540820|ref|NP_500070.1| COLlagen structural gene (28.0 kD) ... 46 5e-04
gi|39586155|emb|CAE69231.1| Hypothetical protein CBG15273 [Caeno... 46 5e-04
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano... 46 6e-04
gi|42528111|ref|NP_973209.1| conserved hypothetical protein [Tre... 46 6e-04
gi|34878291|ref|XP_346097.1| similar to opioid growth factor rec... 46 6e-04
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu... 45 0.001
gi|32413407|ref|XP_327183.1| predicted protein [Neurospora crass... 45 0.001
gi|25150119|ref|NP_505374.2| COLlagen structural gene (col-144) ... 37 0.002
gi|17559056|ref|NP_505376.1| COLlagen structural gene (col-10) [... 37 0.002
gi|7494765|pir||T29837 hypothetical protein B0222.6 - Caenorhabd... 37 0.002
gi|17569345|ref|NP_510110.1| COLlagen structural gene (col-182) ... 44 0.002
gi|17553070|ref|NP_497975.1| COLlagen structural gene (28.9 kD) ... 33 0.002
gi|17557278|ref|NP_505375.1| COLlagen structural gene (28.8 kD) ... 35 0.003
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 44 0.003
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno... 44 0.003
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 43 0.004
gi|17534889|ref|NP_495294.1| COLlagen structural gene (col-75) [... 39 0.004
gi|22096340|sp|P18835|CC19_CAEEL Cuticle collagen 19 precursor >... 43 0.005
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 43 0.005
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ... 43 0.005
gi|84432|pir||JS0170 collagen col-19 - Caenorhabditis elegans >g... 43 0.005
gi|32566102|ref|NP_508100.2| COLlagen structural gene (col-19) [... 43 0.005
gi|39596526|emb|CAE63145.1| Hypothetical protein CBG07447 [Caeno... 43 0.005
gi|39593374|emb|CAE64844.1| Hypothetical protein CBG09640 [Caeno... 39 0.005
gi|39592587|emb|CAE63664.1| Hypothetical protein CBG08166 [Caeno... 42 0.007
gi|39585781|emb|CAE59983.1| Hypothetical protein CBG03475 [Caeno... 31 0.009
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno... 36 0.009
gi|17570601|ref|NP_509692.1| COLlagen structural gene (28.7 kD) ... 42 0.009
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 42 0.012
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 41 0.016
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 41 0.016
gi|17565206|ref|NP_506334.1| COLlagen structural gene (col-162) ... 41 0.016
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 41 0.016
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 41 0.016
gi|39593008|emb|CAE62622.1| Hypothetical protein CBG06744 [Caeno... 41 0.016
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|... 41 0.016
gi|1235974|emb|CAA65474.1| collagen [Globodera pallida] 41 0.021
gi|39594071|emb|CAE70181.1| Hypothetical protein CBG16654 [Caeno... 40 0.027
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 40 0.035
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 31 0.042
gi|32566500|ref|NP_872105.1| COLlagen structural gene (27.6 kD) ... 40 0.046
gi|17557174|ref|NP_505670.1| COLlagen structural gene (col-151) ... 40 0.046
gi|39590997|emb|CAE58777.1| Hypothetical protein CBG01972 [Caeno... 40 0.046
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp... 40 0.046
gi|25385147|pir||A88640 protein C34H4.4 [imported] - Caenorhabdi... 40 0.046
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 40 0.046
gi|17532627|ref|NP_496309.1| COLlagen structural gene (31.6 kD) ... 39 0.060
gi|23479921|gb|EAA16622.1| Arabidopsis thaliana At3g58560/F14P22... 39 0.060
gi|41152193|ref|NP_957125.1| hypothetical protein MGC73193 [Dani... 39 0.060
gi|39591910|emb|CAE75130.1| Hypothetical protein CBG23058 [Caeno... 39 0.060
gi|39596631|emb|CAE63250.1| Hypothetical protein CBG07618 [Caeno... 31 0.069
gi|15077111|gb|AAK83075.1| collagen [Meloidogyne javanica] 30 0.070
gi|30352010|ref|NP_775617.1| hypothetical protein 3000008H23 [Mu... 39 0.079
gi|23335364|ref|ZP_00120601.1| COG1186: Protein chain release fa... 39 0.079
gi|39597491|emb|CAE59721.1| Hypothetical protein CBG03154 [Caeno... 39 0.079
gi|17511053|ref|NP_492245.1| COLlagen structural gene (37.4 kD) ... 39 0.079
gi|45829789|gb|AAH68184.1| 1700069O15Rik protein [Mus musculus] 39 0.079
gi|39583551|emb|CAE65655.1| Hypothetical protein CBG10720 [Caeno... 39 0.079
gi|23465750|ref|NP_696353.1| peptide chain release factor 2 [Bif... 39 0.079
gi|17506297|ref|NP_492086.1| COLlagen structural gene (col-35) [... 39 0.079
gi|40074272|gb|AAR39422.1| adventurous gliding protein Z [Myxoco... 39 0.079
gi|32471674|ref|NP_864667.1| hypothetical protein-signal peptide... 39 0.10
gi|23619118|ref|NP_705080.1| hypothetical protein [Plasmodium fa... 39 0.10
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 39 0.10
gi|50289215|ref|XP_447038.1| unnamed protein product [Candida gl... 38 0.13
gi|17567005|ref|NP_510248.1| COLlagen structural gene (col-184) ... 38 0.13
gi|17508163|ref|NP_492936.1| COLlagen structural gene (col-65) [... 38 0.13
gi|17505428|ref|NP_492035.1| COLlagen structural gene (col-61) [... 38 0.13
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 38 0.13
gi|39586236|emb|CAE66647.1| Hypothetical protein CBG11984 [Caeno... 38 0.13
gi|47216921|emb|CAG02093.1| unnamed protein product [Tetraodon n... 32 0.14
gi|17535687|ref|NP_495858.1| ROLler: helically twisted, animals ... 38 0.18
gi|39594639|emb|CAE72217.1| Hypothetical protein CBG19328 [Caeno... 38 0.18
gi|39594640|emb|CAE72218.1| Hypothetical protein CBG19329 [Caeno... 38 0.18
gi|39592187|emb|CAE75407.1| Hypothetical protein CBG23397 [Caeno... 38 0.18
gi|13569879|ref|NP_112182.1| acidic (leucine-rich) nuclear phosp... 38 0.18
gi|17564306|ref|NP_504738.1| COLlagen structural gene (col-143) ... 38 0.18
gi|17531719|ref|NP_496310.1| COLlagen structural gene (31.3 kD) ... 38 0.18
gi|39597193|emb|CAE59420.1| Hypothetical protein CBG02789 [Caeno... 37 0.23
gi|39591984|emb|CAE75204.1| Hypothetical protein CBG23151 [Caeno... 37 0.23
gi|17563992|ref|NP_505484.1| COLlagen structural gene (27.4 kD) ... 37 0.23
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ... 37 0.23
gi|11862883|dbj|BAB19308.1| ORF1 [TT virus] 37 0.23
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa... 37 0.23
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ... 37 0.23
gi|34878626|ref|XP_214600.2| similar to hypothetical protein FLJ... 37 0.23
gi|39597390|emb|CAE59619.1| Hypothetical protein CBG03028 [Caeno... 37 0.23
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 37 0.30
gi|17552984|ref|NP_498814.1| COLlagen structural gene (col-91) [... 37 0.30
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc... 37 0.30
gi|39586186|emb|CAE66597.1| Hypothetical protein CBG11921 [Caeno... 37 0.30
gi|23619234|ref|NP_705196.1| hypothetical protein [Plasmodium fa... 37 0.30
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [... 37 0.30
gi|38603523|dbj|BAD02898.1| bacteriolytic enzyme [Bacillus clausii] 37 0.30
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno... 37 0.30
gi|25148392|ref|NP_741318.1| COLlagen structural gene (28.5 kD) ... 37 0.30
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 29 0.32
gi|50257130|gb|EAL19845.1| hypothetical protein CNBG1380 [Crypto... 37 0.39
gi|17564308|ref|NP_504736.1| COLlagen structural gene (col-142) ... 37 0.39
gi|17563988|ref|NP_505486.1| COLlagen structural gene (27.2 kD) ... 37 0.39
gi|7619741|emb|CAB88204.1| putative cuticular collagen [Globoder... 37 0.39
gi|17509327|ref|NP_491194.1| COLlagen structural gene (col-50) [... 37 0.39
gi|39580830|emb|CAE73091.1| Hypothetical protein CBG20470 [Caeno... 37 0.39
gi|17560252|ref|NP_504525.1| COLlagen structural gene (col-140) ... 37 0.39
gi|17505581|ref|NP_492090.1| COLlagen structural gene (col-7) [C... 37 0.39
gi|6322796|ref|NP_012869.1| RNAPII degradation factor, forms a c... 36 0.51
gi|17507511|ref|NP_492619.1| COLlagen structural gene (col-64) [... 36 0.51
gi|18476478|gb|AAL25814.1| lecuine-rich acidic protein-like prot... 36 0.51
gi|17506747|ref|NP_492013.1| COLlagen structural gene (col-60) [... 36 0.51
gi|37575557|gb|AAQ93550.1| hypothetical protein pSCL2.5.424.10 [... 36 0.51
gi|39594542|emb|CAE72120.1| Hypothetical protein CBG19216 [Caeno... 36 0.51
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno... 36 0.51
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ... 36 0.51
gi|39594379|emb|CAE71957.1| Hypothetical protein CBG19026 [Caeno... 36 0.51
gi|21754440|dbj|BAC04505.1| unnamed protein product [Homo sapiens] 36 0.51
gi|39594380|emb|CAE71958.1| Hypothetical protein CBG19027 [Caeno... 36 0.51
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa] 36 0.51
gi|39597389|emb|CAE59618.1| Hypothetical protein CBG03027 [Caeno... 36 0.51
gi|39579122|emb|CAE56687.1| Hypothetical protein CBG24465 [Caeno... 36 0.51
gi|17540622|ref|NP_502116.1| predicted CDS, COLlagen structural ... 36 0.67
gi|34482047|ref|NP_004635.2| adaptor-related protein complex 3, ... 36 0.67
gi|39583705|emb|CAE63809.1| Hypothetical protein CBG08355 [Caeno... 36 0.67
gi|39586197|emb|CAE66608.1| Hypothetical protein CBG11934 [Caeno... 36 0.67
gi|17540620|ref|NP_502115.1| COLlagen structural gene (col-126) ... 36 0.67
gi|31212073|ref|XP_315021.1| ENSANGP00000022264 [Anopheles gambi... 36 0.67
gi|48139637|ref|XP_393470.1| similar to ENSANGP00000021735 [Apis... 36 0.67
gi|17539048|ref|NP_500094.1| COLlagen structural gene (col-107) ... 36 0.67
gi|39582788|emb|CAE74251.1| Hypothetical protein CBG21938 [Caeno... 36 0.67
gi|47217758|emb|CAG05980.1| unnamed protein product [Tetraodon n... 36 0.67
gi|46125761|ref|XP_387434.1| hypothetical protein FG07258.1 [Gib... 36 0.67
gi|7619739|emb|CAB88203.1| putative cuticular collagen [Globoder... 36 0.67
gi|39586237|emb|CAE66648.1| Hypothetical protein CBG11985 [Caeno... 36 0.67
gi|1019902|gb|AAC50219.1| beta-NAP >gnl|BL_ORD_ID|1762402 gi|158... 36 0.67
gi|45360527|ref|NP_988936.1| hypothetical protein MGC75993 [Xeno... 36 0.67
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno... 36 0.67
gi|39596084|emb|CAE69720.1| Hypothetical protein CBG15991 [Caeno... 28 0.68
gi|39594381|emb|CAE71959.1| Hypothetical protein CBG19029 [Caeno... 35 0.87
gi|21402734|ref|NP_658719.1| FtsK_SpoIIIE, FtsK/SpoIIIE family [... 35 0.87
gi|49187578|ref|YP_030831.1| FtsK/SpoIIIE family protein [Bacill... 35 0.87
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ... 35 0.87
gi|28972892|gb|AAL99272.1| major royal jelly protein 5-like prot... 35 0.87
gi|39583250|emb|CAE60042.1| Hypothetical protein CBG03553 [Caeno... 35 0.87
gi|39587723|emb|CAE58661.1| Hypothetical protein CBG01830 [Caeno... 35 0.87
gi|17559812|ref|NP_505793.1| COLlagen structural gene (35.1 kD) ... 35 0.87
gi|23613117|ref|NP_703439.1| RNA polymerase I [Plasmodium falcip... 35 0.87
gi|17538706|ref|NP_499957.1| predicted CDS, COLlagen structural ... 35 0.87
gi|47214275|emb|CAG01332.1| unnamed protein product [Tetraodon n... 34 1.0
gi|17553572|ref|NP_498086.1| collagen alpha precursor, DumPY : s... 35 1.1
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 35 1.1
gi|17552760|ref|NP_499176.1| calnexin (69.2 kD) (cnx-1) [Caenorh... 35 1.1
gi|42783971|ref|NP_981218.1| hypothetical protein BCE4925 [Bacil... 35 1.1
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa] 35 1.1
gi|25395729|pir||H88449 protein F54D8.1 [imported] - Caenorhabdi... 35 1.1
gi|39595633|emb|CAE67135.1| Hypothetical protein CBG12558 [Caeno... 35 1.1
gi|7508686|pir||T15143 hypothetical protein T28F2.8 - Caenorhabd... 35 1.1
gi|39593739|emb|CAE62032.1| Hypothetical protein CBG06046 [Caeno... 35 1.1
gi|39594543|emb|CAE72121.1| Hypothetical protein CBG19217 [Caeno... 35 1.1
gi|23479635|gb|EAA16409.1| glutamic acid-rich protein precursor,... 35 1.1
gi|115410|sp|P12114|CCS1_CAEEL Cuticle collagen sqt-1 >gnl|BL_OR... 35 1.1
gi|17535735|ref|NP_496421.1| SQuaT SQT-1, ROLler: helically twis... 35 1.1
gi|39597300|emb|CAE59528.1| Hypothetical protein CBG02923 [Caeno... 35 1.1
gi|23508404|ref|NP_701073.1| hypothetical protein [Plasmodium fa... 35 1.1
gi|9453886|dbj|BAB03287.1| pro-alpha 1 type V/XI collagen [Pagru... 35 1.1
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno... 35 1.1
gi|39593742|emb|CAE62035.1| Hypothetical protein CBG06051 [Caeno... 35 1.1
gi|28829807|gb|AAO52309.1| similar to Oryza sativa (japonica cul... 35 1.1
gi|39593552|emb|CAE61844.1| Hypothetical protein CBG05818 [Caeno... 30 1.1
gi|31208177|ref|XP_313055.1| ENSANGP00000011681 [Anopheles gambi... 34 1.4
gi|23479683|gb|EAA16443.1| hypothetical protein [Plasmodium yoel... 35 1.5
gi|34865574|ref|XP_345672.1| similar to kinetoplast-associated p... 35 1.5
gi|4154097|gb|AAD04750.1| unknown [Human herpesvirus 8] 35 1.5
gi|31340542|gb|AAO33039.2| alpha 1 type II procollagen [Gallus g... 35 1.5
gi|18310305|ref|NP_562239.1| hypothetical protein CPE1323 [Clost... 35 1.5
gi|47180733|emb|CAG14181.1| unnamed protein product [Tetraodon n... 35 1.5
gi|17538077|ref|NP_495159.1| COLlagen structural gene (col-74) [... 35 1.5
gi|17539090|ref|NP_502514.1| COLlagen structural gene (col-132) ... 35 1.5
gi|17541560|ref|NP_502297.1| COLlagen structural gene (33.5 kD) ... 35 1.5
gi|33188417|gb|AAP97930.1| zinc finger transcription factor SALL... 35 1.5
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto... 35 1.5
gi|45383309|ref|NP_989757.1| alpha 1 type IIA collagen precursor... 35 1.5
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno... 35 1.5
gi|39585958|emb|CAE68247.1| Hypothetical protein CBG13922 [Caeno... 35 1.5
gi|39582632|emb|CAE73736.1| Hypothetical protein CBG21262 [Caeno... 35 1.5
gi|47229594|emb|CAG06790.1| unnamed protein product [Tetraodon n... 27 1.7
gi|33285196|gb|AAF99925.2| Collagen protein 111 [Caenorhabditis ... 33 1.9
gi|17536751|ref|NP_495952.1| predicted CDS, COLlagen structural ... 28 1.9
gi|34874497|ref|XP_224295.2| similar to KIAA0853 protein [Rattus... 34 1.9
gi|12802674|gb|AAK08048.1| Exl3 [Neisseria meningitidis] 34 1.9
gi|30424814|ref|NP_780402.1| golgi phosphoprotein 4 [Mus musculu... 34 1.9
gi|17568307|ref|NP_509837.1| COLlagen structural gene (col-177) ... 34 1.9
gi|23478689|gb|EAA15708.1| Arabidopsis thaliana At5g64630/MUB3_1... 34 1.9
gi|202|emb|CAA39109.1| chromogranin B [Bos taurus] 34 1.9
gi|17566918|ref|NP_506061.1| LONg body length LON-3, cuticle col... 34 1.9
gi|39591554|emb|CAE71130.1| Hypothetical protein CBG17984 [Caeno... 34 1.9
gi|47229450|emb|CAF99438.1| unnamed protein product [Tetraodon n... 34 1.9
gi|15235733|ref|NP_192495.1| hypothetical protein [Arabidopsis t... 34 1.9
gi|12644006|sp|P23389|SG1_BOVIN Secretogranin I precursor (SgI) ... 34 1.9
gi|89471|pir||S15901 chromogranin B precursor - bovine >gnl|BL_O... 34 1.9
gi|30794308|ref|NP_851349.1| chromogranin B (secretogranin 1) [B... 34 1.9
gi|12802666|gb|AAK08042.1| Exl3 [Neisseria meningitidis] 34 1.9
gi|228903|prf||1814299A chromogranin B 34 1.9
gi|49099137|ref|XP_410734.1| hypothetical protein AN6597.2 [Aspe... 34 1.9
gi|47218941|emb|CAF98139.1| unnamed protein product [Tetraodon n... 28 2.2
gi|22477176|gb|AAH36669.1| COL25A1 protein [Homo sapiens] 31 2.4
gi|17506917|ref|NP_491595.1| DumPY : shorter than wild-type DPY-... 27 2.5
gi|34860705|ref|XP_215931.2| similar to hypothetical protein MGC... 34 2.5
gi|45190262|ref|NP_984516.1| AEL344Wp [Eremothecium gossypii] >g... 34 2.5
gi|17531393|ref|NP_496311.1| nematode cuticle collagen, BLIstere... 34 2.5
gi|37619788|emb|CAA86755.2| Hypothetical protein C09G5.6 [Caenor... 34 2.5
gi|14249928|gb|AAH08345.1| Unknown (protein for IMAGE:3531356) [... 34 2.5
gi|42539446|gb|AAS18679.1| AP-3 complex beta3B subunit [Mus musc... 34 2.5
gi|48103403|ref|XP_395567.1| similar to sea star regeneration-as... 34 2.5
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy... 34 2.5
gi|23480875|gb|EAA17319.1| hypothetical protein [Plasmodium yoel... 34 2.5
gi|15128574|dbj|BAB62753.1| putative ATP-dependent exonuclease s... 34 2.5
gi|41203898|ref|XP_372522.1| similar to Plasmodium falciparum tr... 34 2.5
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno... 34 2.5
gi|31455194|gb|AAH13023.1| NUMA1 protein [Homo sapiens] 34 2.5
gi|5803080|ref|NP_006761.1| macrophage receptor with collagenous... 34 2.5
gi|5231092|gb|AAD41064.1| macrophage receptor [Homo sapiens] 34 2.5
gi|23468050|ref|ZP_00123621.1| COG5295: Autotransporter adhesin ... 34 2.5
gi|23510031|ref|NP_702697.1| hypothetical protein [Plasmodium fa... 34 2.5
gi|38107150|gb|EAA53365.1| predicted protein [Magnaporthe grisea... 33 3.3
gi|13359215|dbj|BAB33341.1| KIAA1671 protein [Homo sapiens] 33 3.3
gi|39594909|emb|CAE70777.1| Hypothetical protein CBG17531 [Caeno... 33 3.3
gi|32410297|ref|XP_325629.1| predicted protein [Neurospora crass... 33 3.3
gi|17551258|ref|NP_510522.1| COLlagen structural gene (col-41) [... 33 3.3
gi|1705738|sp|P51861|CDR1_HUMAN Cerebellar-degeneration-related ... 33 3.3
gi|34876989|ref|XP_343608.1| similar to alpha-3 type IV collagen... 33 3.3
gi|23613071|ref|NP_703393.1| hypothetical protein [Plasmodium fa... 33 3.3
gi|5453820|ref|NP_006176.1| nuclear mitotic apparatus protein 1 ... 33 3.3
gi|23491066|gb|EAA22695.1| hypothetical protein [Plasmodium yoel... 33 3.3
gi|39592197|emb|CAE75417.1| Hypothetical protein CBG23407 [Caeno... 33 3.3
gi|42662443|ref|XP_371461.2| similar to KIAA1671 protein [Homo s... 33 3.3
gi|11096145|gb|AAG30212.1| collagen-like surface protein [Strept... 33 3.3
gi|25009822|gb|AAN71082.1| AT17081p [Drosophila melanogaster] 33 3.3
gi|34875146|ref|XP_344415.1| similar to Hypothetical protein MGC... 33 3.3
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 33 3.3
gi|50750043|ref|XP_421847.1| PREDICTED: similar to [Segment 3 of... 28 3.6
gi|21431496|sp||P12105_1 [Segment 1 of 3] Collagen alpha 1(III) ... 28 3.7
gi|539775|pir||A61228 collagen alpha 2(IV) chain precursor - rab... 27 3.8
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 30 4.0
gi|7498195|pir||T34203 hypothetical protein D2024.8 - Caenorhabd... 28 4.0
gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114) ... 28 4.0
gi|39596527|emb|CAE63146.1| Hypothetical protein CBG07448 [Caeno... 30 4.0
gi|39595564|emb|CAE67065.1| Hypothetical protein CBG12473 [Caeno... 26 4.1
gi|32565431|ref|NP_494929.2| cis-Golgi matrix protein (2F328) [C... 33 4.3
gi|543516|pir||A48295 collagen 1 - marine sponge (Microciona pro... 33 4.3
gi|39587623|emb|CAE58561.1| Hypothetical protein CBG01723 [Caeno... 33 4.3
gi|48763005|ref|ZP_00267562.1| hypothetical protein Rrub02003719... 33 4.3
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her... 33 4.3
gi|39581046|emb|CAE57348.1| Hypothetical protein CBG00290 [Caeno... 33 4.3
gi|34783134|gb|AAH10457.2| PELP1 protein [Homo sapiens] 33 4.3
gi|30145696|emb|CAD89749.1| Hypothetical protein M199.5 [Caenorh... 33 4.3
gi|38197221|gb|AAH02875.2| PELP1 protein [Homo sapiens] 33 4.3
gi|50752612|ref|XP_426716.1| PREDICTED: similar to otolin-1 [Gal... 33 4.3
gi|17827247|dbj|BAB79346.1| ORF1 [TT virus] 33 4.3
gi|25402569|pir||B86231 hypothetical protein [imported] - Arabid... 33 4.3
gi|17508863|ref|NP_491786.1| predicted CDS, COLlagen structural ... 33 4.3
gi|46399217|gb|AAH69058.1| Proline-, glutamic acid-, leucine-ric... 33 4.3
gi|479557|pir||S34665 collagen, cuticular - root-knot nematode (... 33 4.3
gi|2267002|gb|AAB63467.1| cuticule collagen [Meloidogyne incognita] 33 4.3
gi|12060432|dbj|BAB20604.1| ORF1 [TT virus] 33 4.3
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD... 33 4.3
gi|50754535|ref|XP_425157.1| PREDICTED: similar to type VII coll... 33 4.3
gi|42561868|ref|NP_172443.2| kinase interacting family protein [... 33 4.3
gi|50419151|ref|XP_458098.1| unnamed protein product [Debaryomyc... 33 4.3
gi|46128327|ref|XP_388717.1| hypothetical protein FG08541.1 [Gib... 33 4.3
gi|47229302|emb|CAG04054.1| unnamed protein product [Tetraodon n... 27 4.6
gi|50744844|ref|XP_419902.1| PREDICTED: similar to alpha 1 chain... 30 4.8
gi|39589676|emb|CAE66911.1| Hypothetical protein CBG12296 [Caeno... 27 5.2
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n... 33 5.7
gi|15890088|ref|NP_203700.1| alpha 5 type IV collagen isoform 3,... 33 5.7
gi|49074004|ref|XP_401167.1| hypothetical protein UM03552.1 [Ust... 33 5.7
gi|49097974|ref|XP_410447.1| hypothetical protein AN6310.2 [Aspe... 33 5.7
gi|11096153|gb|AAG30216.1| collagen-like surface protein [Strept... 33 5.7
gi|4502955|ref|NP_000486.1| alpha 5 type IV collagen isoform 1, ... 33 5.7
gi|27469566|gb|AAH42075.1| COL22A1 protein [Homo sapiens] 33 5.7
gi|17540078|ref|NP_500607.1| COLlagen structural gene (col-111) ... 33 5.7
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa] 33 5.7
gi|159960|gb|AAA29439.1| collagen-like protein 33 5.7
gi|103623|pir||A32249 collagen - sea urchin (Paracentrotus livid... 33 5.7
gi|24415383|ref|NP_055204.1| proline-, glutamic acid-, leucine-r... 33 5.7
gi|17510441|ref|NP_493439.1| putative protein, with a coiled coi... 33 5.7
gi|388714|gb|AAA89196.1| type VII collagen 33 5.7
gi|49074306|ref|XP_401296.1| hypothetical protein UM03681.1 [Ust... 33 5.7
gi|26334667|dbj|BAC31034.1| unnamed protein product [Mus musculus] 33 5.7
gi|1346682|sp|P48681|NEST_HUMAN Nestin >gnl|BL_ORD_ID|1651341 gi... 33 5.7
gi|1314210|gb|AAA99480.1| alpha-5 type IV collagen 33 5.7
gi|42780042|ref|NP_977289.1| collagen adhesin domain protein [Ba... 33 5.7
gi|46122453|ref|XP_385780.1| hypothetical protein FG05604.1 [Gib... 33 5.7
gi|22652113|gb|AAN03620.1| alpha 1 type XXII collagen [Homo sapi... 33 5.7
gi|40805823|ref|NP_690848.1| collagen, type XXII, alpha 1 [Homo ... 33 5.7
gi|39587615|emb|CAE58553.1| Hypothetical protein CBG01712 [Caeno... 33 5.7
gi|39596361|emb|CAE69999.1| Hypothetical protein CBG16406 [Caeno... 33 5.7
gi|47218418|emb|CAG12689.1| unnamed protein product [Tetraodon n... 33 5.7
gi|15890086|ref|NP_203699.1| alpha 5 type IV collagen isoform 2,... 33 5.7
gi|4502961|ref|NP_000085.1| alpha 1 type VII collagen precursor;... 33 5.7
gi|627406|pir||A54849 collagen alpha 1(VII) chain precursor - human 33 5.7
gi|495866|gb|AAA58965.1| collagen type VII [Homo sapiens] 33 5.7
gi|37550261|ref|XP_210543.4| similar to SPBPJ4664.02 [Homo sapiens] 33 5.7
gi|46576655|sp|Q9JME5|A3B2_MOUSE Adapter-related protein complex... 33 5.7
gi|553234|gb|AAA52046.1| alpha-5 type IV collagen 33 5.7
gi|50730536|ref|XP_416952.1| PREDICTED: similar to alpha 2 type ... 33 5.7
gi|49203006|emb|CAF05744.1| hypothetical protein [TT virus] 26 6.3
gi|49203014|emb|CAF05748.1| hypothetical protein [TT virus] 26 6.3
gi|12829958|gb|AAK01940.1| ORF1 [TT virus] 26 6.3
gi|42780655|ref|NP_977902.1| hypothetical protein BCE1580 [Bacil... 27 6.7
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 29 6.7
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 30 6.7
gi|17542460|ref|NP_499889.1| COLlagen structural gene (col-100) ... 29 6.7
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno... 26 6.8
gi|17537701|ref|NP_496783.1| predicted CDS, COLlagen structural ... 32 7.4
gi|7494158|pir||T28156 DNA-directed RNA polymerase homolog - mal... 32 7.4
gi|38567701|emb|CAE75991.1| B1160F02.22 [Oryza sativa (japonica ... 32 7.4
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par... 32 7.4
gi|31377595|ref|NP_653205.2| hypothetical protein BC001584 [Homo... 32 7.4
gi|50756045|ref|XP_414992.1| PREDICTED: similar to type VII coll... 32 7.4
gi|33303420|gb|AAQ02286.1| dentin matrix protein 1 [Neotoma albi... 32 7.4
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib... 32 7.4
gi|47551001|ref|NP_999674.1| alpha-1 collagen [Strongylocentrotu... 32 7.4
gi|4504487|ref|NP_002143.1| histidine-rich calcium-binding prote... 32 7.4
gi|41117725|ref|XP_372917.1| similar to Cerebellar-degeneration-... 32 7.4
gi|18652045|gb|AAL76931.1| chromogranin B [Rana ridibunda] 32 7.4
gi|16552089|dbj|BAB71237.1| unnamed protein product [Homo sapiens] 32 7.4
gi|112629|pir||B41207 collagen 6, nonfibrillar - freshwater spon... 32 7.4
gi|11120710|ref|NP_068528.1| collagen, type V, alpha 3; procolla... 32 7.4
gi|31242905|ref|XP_321883.1| ENSANGP00000013952 [Anopheles gambi... 32 7.4
gi|48140714|ref|XP_393523.1| similar to ENSANGP00000019179 [Apis... 32 7.4
gi|6708282|gb|AAF25871.1| lens epithelium-derived growth factor ... 32 7.4
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa] 32 7.4
gi|28829347|gb|AAO51889.1| similar to Dictyostelium discoideum (... 32 7.4
gi|50548039|ref|XP_501489.1| hypothetical protein [Yarrowia lipo... 32 7.4
gi|39794213|gb|AAH64135.1| Unknown (protein for MGC:74712) [Homo... 32 7.4
gi|115659|sp|P18503|CAS4_EPHMU SHORT-CHAIN COLLAGEN C4 >gnl|BL_O... 32 7.4
gi|15823627|dbj|BAB68553.1| P18 [Babesia gibsoni] 32 7.4
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 32 7.4
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 32 7.4
gi|27882026|gb|AAH44568.1| PSIP1 protein [Homo sapiens] 32 7.4
gi|12060429|dbj|BAB20602.1| ORF1 [TT virus] 32 7.4
gi|21426922|gb|AAC17708.2| PELP1 [Homo sapiens] 32 7.4
gi|50761816|ref|XP_429162.1| PREDICTED: similar to RIKEN cDNA A2... 32 7.4
gi|3168604|gb|AAC17709.1| proline and glutamic acid rich nuclear... 32 7.4
gi|49389189|dbj|BAD26479.1| putative hUPF2 [Oryza sativa (japoni... 32 7.4
gi|34861086|ref|XP_342606.1| similar to neural zinc finger prote... 32 7.4
gi|49106612|ref|XP_411442.1| hypothetical protein AN7305.2 [Aspe... 32 7.4
gi|46391019|dbj|BAD16553.1| hypothetical protein [Oryza sativa (... 32 7.4
gi|11360305|pir||JC7168 lens epithelium-derived growth factor - ... 32 7.4
gi|19923653|ref|NP_150091.2| PC4 and SFRS1 interacting protein 1... 32 7.4
gi|39597098|emb|CAE59325.1| Hypothetical protein CBG02667 [Caeno... 32 7.4
gi|47222135|emb|CAG11561.1| unnamed protein product [Tetraodon n... 28 7.9
gi|34877879|ref|XP_341575.1| similar to collectin placenta 1 [Ra... 27 8.0
gi|26335321|dbj|BAC31361.1| unnamed protein product [Mus musculus] 27 8.0
gi|21901969|dbj|BAC05523.1| collectin placenta 1 [Mus musculus] ... 27 8.0
gi|18485494|ref|NP_569716.1| collectin sub-family member 12 [Mus... 27 8.0
gi|29789010|ref|NP_034066.1| procollagen, type IX, alpha 3 [Mus ... 32 8.1
gi|18028926|gb|AAL56219.1| alpha-3 type IX collagen [Mus musculus] 32 8.1
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 26 8.7
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha... 27 8.7
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]... 32 9.6
gi|47550915|ref|NP_999631.1| 3 alpha procollagen [Strongylocentr... 32 9.6
gi|47223345|emb|CAG04206.1| unnamed protein product [Tetraodon n... 32 9.6
gi|47206016|emb|CAF91417.1| unnamed protein product [Tetraodon n... 32 9.6
gi|422532|pir||A45407 collagen alpha 3(IV) chain - sea urchin (S... 32 9.6
gi|127891|sp|P19691|NCAP_IHNV NUCLEOCAPSID PROTEIN (NUCLEOPROTEI... 32 9.6
gi|33149359|gb|AAO64414.1| type VII collagen [Canis familiaris] 32 9.6
gi|23613221|ref|NP_703543.1| hypothetical protein [Plasmodium fa... 32 9.6
gi|47226324|emb|CAG09292.1| unnamed protein product [Tetraodon n... 32 9.6
gi|29565780|ref|NP_817352.1| gp14 [Mycobacteriophage Che8] >gnl|... 32 9.6
gi|21411282|gb|AAH30945.1| Col9a3 protein [Mus musculus] 32 9.6
gi|4558862|gb|AAD22767.1| A-kinase anchoring protein AKAP350 [Ho... 32 9.6
gi|47216869|emb|CAG11676.1| unnamed protein product [Tetraodon n... 32 9.6
gi|49068152|ref|XP_398365.1| hypothetical protein UM00750.1 [Ust... 32 9.6
gi|7441224|pir||T13990 collagen type IV alpha 2 - fruit fly (Dro... 32 9.6
gi|47229823|emb|CAG07019.1| unnamed protein product [Tetraodon n... 32 9.6
gi|47212298|emb|CAF90561.1| unnamed protein product [Tetraodon n... 32 9.6
gi|1480444|gb|AAC59935.1| gizzard PTB-associated splicing factor 32 9.6
gi|23510201|ref|NP_702867.1| erythrocyte membrane-associated ant... 32 9.6
gi|238617|gb|AAB20270.1| from cDNA clone Spcoll [Strongylocentro... 32 9.6
gi|21450183|ref|NP_659062.1| solute carrier family 24 (sodium/po... 32 9.6
gi|50744910|ref|XP_419932.1| PREDICTED: similar to myelin transc... 32 9.6
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto... 32 9.6
gi|50759792|ref|XP_417784.1| PREDICTED: similar to PTB-associate... 32 9.6
gi|7446352|pir||S69282 polypyrimidine tract-binding protein-asso... 32 9.6
gi|46437473|gb|EAK96819.1| hypothetical protein CaO19.10369 [Can... 32 9.6
gi|17137252|ref|NP_477190.1| CG16858-PA [Drosophila melanogaster... 32 9.6
gi|29387355|gb|AAH48221.1| COL2A1 protein [Xenopus laevis] 32 9.6
gi|214042|gb|AAA49678.1| alpha-1 type II collagen 32 9.6
gi|104010|pir||B40333 collagen alpha 1(II) chain precursor - Afr... 32 9.6
gi|49109243|ref|XP_411663.1| hypothetical protein AN7526.2 [Aspe... 32 9.6
gi|14164347|dbj|BAB55661.1| collagen a1(I) [Oncorhynchus mykiss] 32 9.6
gi|49202946|emb|CAF05718.1| hypothetical protein [TT virus] 32 9.6
gi|49202963|emb|CAF05724.1| hypothetical protein 1 [TT virus] 32 9.6
gi|49202950|emb|CAF05720.1| hypothetical protein [TT virus] 32 9.6
gi|49202967|emb|CAF05726.1| hypothetical protein [TT virus] 32 9.6
gi|49202959|emb|CAF05722.1| hypothetical protein [TT virus] 32 9.6
gi|48256849|gb|AAT41626.1| collagen type IX-like [Ciona intestin... 32 9.6
gi|3641657|dbj|BAA33380.1| alpha 1 type I collagen [Oncorhynchus... 32 9.6
gi|6680972|ref|NP_031764.1| procollagen, type VII, alpha 1 [Mus ... 32 9.6
gi|17559154|ref|NP_505981.1| COLlagen structural gene (33.2 kD) ... 32 9.6
gi|39596894|emb|CAE59121.1| Hypothetical protein CBG02416 [Caeno... 32 9.6
gi|49202954|emb|CAF05776.1| hypothetical protein [TT virus] 32 9.6
gi|45361285|ref|NP_989220.1| hypothetical protein MGC75588 [Xeno... 32 9.6
gi|32411685|ref|XP_326323.1| hypothetical protein [Neurospora cr... 32 9.6
gi|39591564|emb|CAE71140.1| Hypothetical protein CBG17995 [Caeno... 32 9.6
gi|4519619|dbj|BAA75669.1| collagen pro alpha-chain [Haliotis di... 30 9.8
gi|21745458|gb|AAM77398.1| fibrillar collagen precursor [Hydra v... 25 9.8
>gi|17536809|ref|NP_494568.1| COLlagen structural gene (col-72)
[Caenorhabditis elegans]
gi|14916385|gb|AAB66109.2| Hypothetical protein W09G10.1
[Caenorhabditis elegans]
Length = 205
Score = 210 bits (535), Expect = 2e-53
Identities = 116/205 (56%), Positives = 116/205 (56%)
Frame = -1
Query: 618 MWRTKCMPRRNKGSTRPKRRRRNPWSTWTTWRARNHWNDPTNRLSKREILPPVXXXXXXX 439
MWRTKCMPRRNKGSTRPKRRRRNPWSTWTTWRARNHWNDPTNRLSKREILPPV
Sbjct: 1 MWRTKCMPRRNKGSTRPKRRRRNPWSTWTTWRARNHWNDPTNRLSKREILPPVPTRPRGQ 60
Query: 438 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKAGGPGSPGRDGIRGS 259
GKAGGPGSPGRDGIRGS
Sbjct: 61 PGYGGPPGPPGLPGQPGQNGNGGRPGNNGPMGQPGEPGREGQPGKAGGPGSPGRDGIRGS 120
Query: 258 KGSTGDKXXXXXXXXXXXXGWAGRDXXXXXXXXXXXXXXXXXXXXXXXXXXXGNPGPDGA 79
KGSTGDK GWAGRD GNPGPDGA
Sbjct: 121 KGSTGDKGPNGPPGQNGPPGWAGRDGNIGPQGTPGGRGEPGGPGTDGFPGFAGNPGPDGA 180
Query: 78 PGVDSGYCKCPSRGAYARTASSKRS 4
PGVDSGYCKCPSRGAYARTASSKRS
Sbjct: 181 PGVDSGYCKCPSRGAYARTASSKRS 205