Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= W09H1_6
(840 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25153023|ref|NP_496801.2| galectin, beta-galactoside binding ... 573 e-162
gi|39597215|emb|CAE59442.1| Hypothetical protein CBG02815 [Caeno... 561 e-159
gi|7509192|pir||T26325 hypothetical protein W09H1.6b - Caenorhab... 556 e-157
gi|7542332|gb|AAF63405.1| galectin [Haemonchus contortus] 501 e-141
gi|7542334|gb|AAF63406.1| galectin [Haemonchus contortus] >gnl|B... 495 e-139
gi|6225602|sp|O44126|LEG1_HAECO 32 kDa beta-galactoside-binding ... 495 e-139
gi|30039166|gb|AAP05998.1| galectin [Haemonchus contortus] 490 e-137
gi|25326270|pir||F88281 protein ZK892.1 [imported] - Caenorhabdi... 434 e-121
gi|1935058|gb|AAC47546.1| galectin [Teladorsagia circumcincta] >... 433 e-120
gi|1935060|gb|AAC47547.1| galectin [Teladorsagia circumcincta] >... 433 e-120
gi|3341815|gb|AAD11972.1| galectin [Haemonchus contortus] 432 e-120
gi|433317|gb|AAA20541.1| beta-galactoside-binding lectin 428 e-119
gi|7159326|gb|AAF37720.1| galectin [Dirofilaria immitis] 426 e-118
gi|17535117|ref|NP_496159.1| galectin (33.6 kD) (lec-3) [Caenorh... 426 e-118
gi|7159328|gb|AAF37721.1| galectin [Brugia malayi] 423 e-117
gi|26985805|emb|CAA91327.2| Hypothetical protein F52H3.7a [Caeno... 419 e-116
gi|7503988|pir||T22523 hypothetical protein F52H3.7 - Caenorhabd... 419 e-116
gi|25154078|ref|NP_496165.2| galectin (31.3 kD) (lec-2) [Caenorh... 419 e-116
gi|7542330|gb|AAF63404.1| galectin [Haemonchus contortus] 413 e-114
gi|25815088|emb|CAD57721.1| Hypothetical protein ZK892.1d [Caeno... 413 e-114
gi|39587773|emb|CAE67791.1| Hypothetical protein CBG13368 [Caeno... 412 e-114
gi|39587776|emb|CAE67794.1| Hypothetical protein CBG13371 [Caeno... 367 e-100
gi|25815087|emb|CAD57720.1| Hypothetical protein ZK892.1c [Caeno... 304 1e-81
gi|17554192|ref|NP_497763.1| galectin (32.4 kD) (lec-4) [Caenorh... 237 3e-61
gi|9857647|dbj|BAB11970.1| galectin LEC-4 [Caenorhabditis elegans] 234 2e-60
gi|39580340|emb|CAE64495.1| Hypothetical protein CBG09221 [Caeno... 233 5e-60
gi|39596979|emb|CAE59206.1| Hypothetical protein CBG02518 [Caeno... 214 2e-54
gi|17535119|ref|NP_495163.1| galectin (35.4 kD) (lec-5) [Caenorh... 212 9e-54
gi|7510946|pir||T34498 hypothetical protein ZK1248.16 - Caenorha... 212 9e-54
gi|4100353|gb|AAD00843.1| Ov87 [Onchocerca volvulus] 199 5e-50
gi|1916602|gb|AAB51189.1| beta-galactoside binding lectin 171 2e-41
gi|13277708|gb|AAH03754.1| Lgals9 protein [Mus musculus] 171 2e-41
gi|33284841|emb|CAE17639.1| SI:dZ122B7.2.2 (novel protein simila... 171 2e-41
gi|49902809|gb|AAH76011.1| Unknown (protein for MGC:92326) [Dani... 167 3e-40
gi|49227307|ref|NP_001001817.1| wu:fd20c09 [Danio rerio] >gnl|BL... 167 3e-40
gi|33284840|emb|CAE17638.1| SI:dZ122B7.2.1 (novel protein simila... 167 3e-40
gi|6981156|ref|NP_037109.1| lectin, galactose binding, soluble 9... 164 3e-39
gi|1916610|gb|AAB51192.1| 36 kDa beta-galactoside binding lectin 164 3e-39
gi|18148432|dbj|BAB83623.1| galectin-9 [Homo sapiens] 162 1e-38
gi|40288183|gb|AAR84192.1| tandem-repeat galectin Gal9-L1 [Danio... 159 7e-38
gi|41152379|ref|NP_956366.1| Unknown (protein for MGC:73232); wu... 158 1e-37
gi|3299781|dbj|BAA31542.1| ecalectin [Homo sapiens] 158 2e-37
gi|18148433|dbj|BAB83624.1| galectin-9 [Homo sapiens] 157 3e-37
gi|5453712|ref|NP_006140.1| galectin 4; lectin galactoside-bindi... 155 1e-36
gi|30583951|gb|AAP36224.1| Homo sapiens lectin, galactoside-bind... 155 1e-36
gi|46102473|gb|AAS80311.1| galectin 9 [Canis familiaris] 155 1e-36
gi|27884291|dbj|BAC55882.1| galectin family xgalectin-IIb [Xenop... 155 1e-36
gi|46849705|ref|NP_034836.1| lectin, galactose binding, soluble ... 154 2e-36
gi|6981152|ref|NP_037107.1| lectin, galactose binding, soluble 4... 153 4e-36
gi|3335391|gb|AAC27244.1| galectin-6 [Mus musculus] 153 4e-36
gi|6754534|ref|NP_034837.1| lectin, galactose binding, soluble 6... 153 4e-36
gi|27884293|dbj|BAC55883.1| galectin family xgalectin-IIIb [Xeno... 153 5e-36
gi|21218385|gb|AAM44060.1| galectin-4 [Mus musculus] 152 1e-35
gi|50507728|emb|CAA94229.2| Hypothetical protein C53D6.7 [Caenor... 151 1e-35
gi|47212865|emb|CAF93222.1| unnamed protein product [Tetraodon n... 150 4e-35
gi|4504987|ref|NP_002299.1| galectin 9 short isoform [Homo sapie... 147 3e-34
gi|47522788|ref|NP_999146.1| L-36 lactose binding protein [Sus s... 147 4e-34
gi|18148443|dbj|BAB83257.1| galectin family xgalectin-IIa [Xenop... 146 5e-34
gi|4995880|emb|CAB44278.1| urate transporter/channel protein (UA... 145 1e-33
gi|5882169|gb|AAD55242.1| galectin-4 [Oryctolagus cuniculus] 144 2e-33
gi|3335393|gb|AAC27245.1| galectin-4 [Mus musculus] 142 9e-33
gi|50415315|gb|AAH77487.1| Xgalectin-IIIa protein [Xenopus laevis] 138 2e-31
gi|17539436|ref|NP_501571.1| galectin (4J798) [Caenorhabditis el... 135 1e-30
gi|27884301|dbj|BAC55887.1| galectin family xgalectin-VIIIa [Xen... 134 3e-30
gi|1932712|gb|AAB51605.1| prostate carcinoma tumor antigen [Homo... 130 3e-29
gi|7449988|pir||JC6147 prostate carcinoma tumor antigen 1 - human 130 3e-29
gi|27884297|dbj|BAC55885.1| galectin family xgalectin-VIa [Xenop... 130 4e-29
gi|8928545|sp|O00214|LEG8_HUMAN Galectin-8 (Gal-8) (Prostate car... 130 4e-29
gi|34189506|gb|AAH16486.2| Galectin 8, isoform b [Homo sapiens] 130 4e-29
gi|48675855|ref|NP_446314.2| galectin 8 [Rattus norvegicus] >gnl... 130 4e-29
gi|6625728|gb|AAF19370.1| galectin-8 [Homo sapiens] 130 4e-29
gi|42544187|ref|NP_963837.1| galectin 8 isoform b; prostate carc... 130 4e-29
gi|50800928|ref|XP_428498.1| PREDICTED: similar to Po66 carbohyd... 126 5e-28
gi|2842655|sp|Q62665|LEG8_RAT Galectin-8 (30 kDa S-type lectin) ... 126 7e-28
gi|2511668|emb|CAA62904.1| Galectin-8 [Homo sapiens] 122 1e-26
gi|47213104|emb|CAF89524.1| unnamed protein product [Tetraodon n... 122 1e-26
gi|18148447|dbj|BAB83259.1| galectin family xgalectin-IVa [Xenop... 122 1e-26
gi|9256551|ref|NP_061374.1| galectin 8; lectin, galactose bindin... 120 5e-26
gi|34785121|gb|AAH56859.1| Xgalectin-iva protein [Xenopus laevis] 119 1e-25
gi|14626474|gb|AAK69827.1| lymphocyte/NHL galectin-8 short isofo... 117 3e-25
gi|6754536|ref|NP_034838.1| lectin, galactose binding, soluble 9... 108 1e-22
gi|2851467|sp|P97840|LEG9_RAT Galectin-9 (36 kDa beta-galactosid... 106 6e-22
gi|6981154|ref|NP_037108.1| lectin, galactose binding, soluble 5... 103 4e-21
gi|31237317|ref|XP_319586.1| ENSANGP00000016692 [Anopheles gambi... 103 6e-21
gi|6681410|dbj|BAA88670.1| galectin like protein [Oncorhynchus m... 100 3e-20
gi|6806890|ref|NP_033665.1| galectin 9 long isoform [Homo sapien... 99 9e-20
gi|8358152|emb|CAB93851.1| galectin-9 [Homo sapiens] 99 9e-20
gi|49522841|gb|AAH73889.1| Unknown (protein for MGC:90361) [Homo... 97 3e-19
gi|24655134|ref|NP_611349.2| CG5335-PA [Drosophila melanogaster]... 97 4e-19
gi|20270911|gb|AAM18472.1| VHSV-induced protein-9 [Oncorhynchus ... 96 7e-19
gi|16768442|gb|AAL28440.1| GM04669p [Drosophila melanogaster] 96 1e-18
gi|18148445|dbj|BAB83258.1| galectin family xgalectin-IIIa [Xeno... 95 2e-18
gi|785053|gb|AAA65445.1| galectin-5 94 3e-18
gi|31543120|ref|NP_032522.2| lectin, galactose binding, soluble ... 92 1e-17
gi|13540268|gb|AAK29385.1| beta-galactoside-binding protein gale... 91 2e-17
gi|12843770|dbj|BAB26108.1| unnamed protein product [Mus musculus] 91 2e-17
gi|47230311|emb|CAG10725.1| unnamed protein product [Tetraodon n... 91 2e-17
gi|3915736|sp|P97590|LEG7_RAT Galectin-7 (Gal-7) 91 4e-17
gi|4504985|ref|NP_002298.1| galectin 7; lectin galactoside-bindi... 91 4e-17
gi|1778169|gb|AAB40658.1| galectin-7 [Rattus norvegicus] 91 4e-17
gi|3891470|pdb|3GAL|A Chain A, Crystal Structure Of Human Galect... 91 4e-17
gi|34783544|gb|AAH42911.2| LGALS7 protein [Homo sapiens] 91 4e-17
gi|12018232|ref|NP_072104.1| lectin, galactose binding, soluble ... 91 4e-17
gi|3913978|sp|O54974|LEG7_MOUSE Galectin-7 (Gal-7) >gnl|BL_ORD_I... 90 5e-17
gi|45360627|ref|NP_988986.1| hypothetical protein MGC75803 [Xeno... 89 2e-16
gi|1346428|sp|P47953|LEG3_CRILO Galectin-3 (Galactose-specific l... 87 3e-16
gi|47522622|ref|NP_999097.1| urate transporter/channel protein, ... 87 3e-16
gi|26344535|dbj|BAC35918.1| unnamed protein product [Mus musculus] 87 5e-16
gi|2213875|gb|AAB61596.1| galectin [Globodera rostochiensis] 87 5e-16
gi|33284839|emb|CAE17637.1| SI:dZ122B7.3 (novel protein similar ... 85 2e-15
gi|47214807|emb|CAF89634.1| unnamed protein product [Tetraodon n... 84 5e-15
gi|47550701|ref|NP_999858.1| chimera galectin Gal3 [Danio rerio]... 84 5e-15
gi|49457147|emb|CAG46894.1| LGALS3 [Homo sapiens] 83 7e-15
gi|299602|gb|AAB26229.1| carbohydrate binding protein 35; Mac-2;... 83 7e-15
gi|4504983|ref|NP_002297.1| galectin-3; galactose-specific lecti... 83 7e-15
gi|1196442|gb|AAA88086.1| galactose-specific lectin [Homo sapiens] 83 7e-15
gi|3402185|pdb|1A3K| X-Ray Crystal Structure Of The Human Galec... 83 7e-15
gi|1346429|sp|P47845|LEG3_RABIT Galectin-3 (Galactose-specific l... 83 9e-15
gi|45786143|gb|AAH68068.1| Galectin-3 [Homo sapiens] 83 9e-15
gi|33859580|ref|NP_034835.1| galectin-3 [Mus musculus] >gnl|BL_O... 82 1e-14
gi|126679|sp|P16110|LEG3_MOUSE Galectin-3 (Galactose-specific le... 82 1e-14
gi|52851|emb|CAA34206.1| unnamed protein product [Mus sp.] 82 1e-14
gi|48096012|ref|XP_392379.1| similar to galectin family xgalecti... 82 1e-14
gi|50764989|ref|XP_422957.1| PREDICTED: similar to galectin 8 is... 82 1e-14
gi|437331|gb|AAA16211.1| beta-galactosides-binding lectin 82 2e-14
gi|1170758|sp|P38486|LEG3_CANFA Galectin-3 (Galactose-specific l... 82 2e-14
gi|1082938|pir||A49688 lactose-binding lectin L-29 - dog 82 2e-14
gi|27884299|dbj|BAC55886.1| galectin family xgalectin-VIIa [Xeno... 81 2e-14
gi|32450320|gb|AAH54324.1| Xgalectin-VIa protein [Xenopus laevis] 81 3e-14
gi|17226660|gb|AAL37895.1| galectin-14 [Ovis aries] 80 6e-14
gi|204728|gb|AAA41378.1| IgE binding protein 80 6e-14
gi|1170759|sp|P08699|LEG3_RAT Galectin-3 (Galactose-specific lec... 80 6e-14
gi|13929190|ref|NP_114020.1| galectin-3; IgE binding protein [Ra... 80 6e-14
gi|5577970|gb|AAD45404.1| Po66 carbohydrate binding protein 2 [H... 80 6e-14
gi|50369353|gb|AAH76353.1| Unknown (protein for MGC:92897) [Dani... 80 6e-14
gi|5577968|gb|AAD45403.1| Po66 carbohydrate binding protein 1 [H... 80 7e-14
gi|27372937|gb|AAO06842.1| putative salivary galectin [Anopheles... 80 7e-14
gi|13249301|gb|AAK16736.1| colorectal carcinoma-derived galectin... 80 7e-14
gi|42544185|ref|NP_006490.3| galectin 8 isoform a; prostate carc... 80 7e-14
gi|39590939|emb|CAE58719.1| Hypothetical protein CBG01904 [Caeno... 80 7e-14
gi|7506381|pir||T24001 hypothetical protein R07B1.10 - Caenorhab... 79 9e-14
gi|17568907|ref|NP_509649.1| galectin (20.4 kD) (lec-8) [Caenorh... 79 9e-14
gi|47221302|emb|CAG13238.1| unnamed protein product [Tetraodon n... 79 1e-13
gi|387111|gb|AAA37311.1| carbohydrate binding protein 35 79 1e-13
gi|50748894|ref|XP_421447.1| PREDICTED: lectin, galactoside-bind... 79 2e-13
gi|47551305|ref|NP_999756.1| lectin, galactoside-binding, solubl... 79 2e-13
gi|18652347|gb|AAL77076.1| lymphocyte/NHL galectin-8 long isofor... 79 2e-13
gi|17559166|ref|NP_503154.1| galectin family xgalectin-IIb (5A68... 78 2e-13
gi|1389600|gb|AAB02856.1| galectin-3 77 4e-13
gi|28071074|emb|CAD61918.1| unnamed protein product [Homo sapiens] 77 4e-13
gi|31200823|ref|XP_309359.1| ENSANGP00000015624 [Anopheles gambi... 77 5e-13
gi|39590917|emb|CAE58697.1| Hypothetical protein CBG01879 [Caeno... 77 6e-13
gi|1055226|gb|AAB40001.1| putative fiber protein [porcine adenov... 76 1e-12
gi|19920434|ref|NP_608487.1| CG11372-PA [Drosophila melanogaster... 76 1e-12
gi|31203655|ref|XP_310776.1| ENSANGP00000014884 [Anopheles gambi... 76 1e-12
gi|17564950|ref|NP_504647.1| galectin (22.0 kD) (lec-10) [Caenor... 75 1e-12
gi|47217277|emb|CAG01500.1| unnamed protein product [Tetraodon n... 75 2e-12
gi|7506382|pir||T23993 hypothetical protein R07B1.2 - Caenorhabd... 75 2e-12
gi|48103972|ref|XP_395686.1| similar to ENSANGP00000022235 [Apis... 75 2e-12
gi|24667330|ref|NP_730508.1| CG32226-PA [Drosophila melanogaster... 75 2e-12
gi|20141588|sp|Q09605|LEC7_CAEEL Probable galaptin lec-7 >gnl|BL... 74 4e-12
gi|39594311|emb|CAE71889.1| Hypothetical protein CBG18946 [Caeno... 74 5e-12
gi|39592739|emb|CAE62353.1| Hypothetical protein CBG06431 [Caeno... 72 1e-11
gi|28932714|gb|AAO60051.1| midgut gallectin-like protein [Rhipic... 72 1e-11
gi|34861856|ref|XP_219545.2| similar to galectin-12 [Rattus norv... 72 2e-11
gi|17568909|ref|NP_510844.1| galectin (15.6 kD) (lec-9) [Caenorh... 71 3e-11
gi|17508813|ref|NP_493005.1| predicted CDS, galectin family memb... 71 3e-11
gi|17105338|ref|NP_476535.1| galectin-related inter-fiber protei... 71 3e-11
gi|15010854|gb|AAK77330.1| galectin-12 isoform c [Homo sapiens] 70 6e-11
gi|29134776|emb|CAD79473.1| galectin-4 (lectin, galactoside-bind... 70 7e-11
gi|20847635|ref|XP_132470.1| galectin-related inter-fiber protei... 70 7e-11
gi|39590940|emb|CAE58720.1| Hypothetical protein CBG01905 [Caeno... 69 1e-10
gi|47214916|emb|CAG04110.1| unnamed protein product [Tetraodon n... 67 4e-10
gi|48099607|ref|XP_394918.1| similar to MSTA protein [Apis melli... 67 4e-10
gi|20127659|ref|NP_149092.2| lectin, galactoside-binding, solubl... 67 5e-10
gi|11878243|gb|AAG40863.1| galectin-12 splice form 1 [Homo sapiens] 67 5e-10
gi|47207507|emb|CAF87201.1| unnamed protein product [Tetraodon n... 67 6e-10
gi|17556226|ref|NP_497215.1| galectin (16.0 kD) (3B218) [Caenorh... 67 6e-10
gi|1395154|dbj|BAA09794.1| galectin [Caenorhabditis elegans] 67 6e-10
gi|9910348|ref|NP_064514.1| lectin, galactoside-binding, soluble... 67 6e-10
gi|41017495|sp|Q8TCE9|P13L_HUMAN Placental protein 13-like (Char... 66 8e-10
gi|11878245|gb|AAG40864.1| galectin-12 splice form 2 [Homo sapiens] 66 1e-09
gi|45439325|ref|NP_982297.1| lectin, galactoside-binding, solubl... 66 1e-09
gi|17507291|ref|NP_493095.1| galectin LEC-4 like family member (... 65 2e-09
gi|9506757|ref|NP_062389.1| lectin, galactose binding, soluble 1... 65 2e-09
gi|26329213|dbj|BAC28345.1| unnamed protein product [Mus musculus] 65 2e-09
gi|15010846|gb|AAK77326.1| galectin-12 [Mus musculus] >gnl|BL_OR... 65 2e-09
gi|6900060|emb|CAB71314.1| galectin [Haemonchus contortus] 64 3e-09
gi|126176|sp|P08520|LEG_ELEEL Beta-galactoside-binding lectin (1... 64 3e-09
gi|26351723|dbj|BAC39498.1| unnamed protein product [Mus musculus] 64 3e-09
gi|387112|gb|AAA37314.1| 34 kDa beta-galactoside-binding lectin ... 64 3e-09
gi|50415264|gb|AAH77459.1| Unknown (protein for MGC:82421) [Xeno... 64 4e-09
gi|21410142|gb|AAH30890.1| Lgals12 protein [Mus musculus] 64 4e-09
gi|47201773|emb|CAF88786.1| unnamed protein product [Tetraodon n... 64 4e-09
gi|15010856|gb|AAK77331.1| galectin-12 isoform d [Homo sapiens] 64 5e-09
gi|13385082|ref|NP_079898.1| lectin, galactose-binding, soluble ... 64 5e-09
gi|31210949|ref|XP_314441.1| ENSANGP00000016074 [Anopheles gambi... 63 7e-09
gi|110638|pir||S08576 lectin - mouse (fragment) 63 9e-09
gi|31212079|ref|XP_315024.1| ENSANGP00000022235 [Anopheles gambi... 62 1e-08
gi|31228128|ref|XP_318003.1| ENSANGP00000010670 [Anopheles gambi... 62 2e-08
gi|7340066|gb|AAF61069.1| galectin [Paralichthys olivaceus] 62 2e-08
gi|39586144|emb|CAE69220.1| Hypothetical protein CBG15260 [Caeno... 62 2e-08
gi|12842598|dbj|BAB25661.1| unnamed protein product [Mus musculus] 62 2e-08
gi|13629138|sp|Q9CQW5|LEG2_MOUSE Galectin-2 >gnl|BL_ORD_ID|27903... 62 2e-08
gi|46048435|ref|NP_996788.1| galectin CG-16; beta-galactoside-bi... 61 3e-08
gi|7245936|pdb|1QMJ|A Chain A, Cg-16, A Homodimeric Agglutinin F... 61 3e-08
gi|19424308|ref|NP_598283.1| lectin, galactoside-binding, solubl... 61 3e-08
gi|50748328|ref|XP_421196.1| PREDICTED: similar to RIKEN cDNA 11... 61 3e-08
gi|20381452|gb|AAH27504.1| Lgals2 protein [Mus musculus] 61 3e-08
gi|33150726|gb|AAP97241.1| Charcot-Leyden crystal 2 protein [Hom... 61 3e-08
gi|1644285|emb|CAA93822.1| lectin [Anopheles gambiae] 60 5e-08
gi|50738969|ref|XP_419347.1| PREDICTED: similar to RIKEN cDNA 11... 60 5e-08
gi|187112|gb|AAA36171.1| beta-galactoside-binding lectin 60 5e-08
gi|2833360|sp|Q29373|LEG2_PIG Galectin-2 60 5e-08
gi|515139|pdb|1HLC|A Chain A, Lectin (Human L-14-Ii) Complexed W... 60 6e-08
gi|6979969|gb|AAF34677.1| galectin-related inhibitor of prolifer... 60 6e-08
gi|13021684|gb|AAK11514.1| galectin-1 [Xenopus laevis] >gnl|BL_O... 60 6e-08
gi|5729903|ref|NP_006489.1| lectin, galactoside-binding, soluble... 60 6e-08
gi|34783249|gb|AAH29063.2| LGALS2 protein [Homo sapiens] 60 6e-08
gi|45382785|ref|NP_990826.1| gbl mRNA [Gallus gallus] >gnl|BL_OR... 60 8e-08
gi|50054414|ref|NP_001001900.1| hypothetical protein MGC76272 [X... 60 8e-08
gi|357782|prf||1304250A lectin,beta galactoside binding 60 8e-08
gi|31228118|ref|XP_318001.1| ENSANGP00000010840 [Anopheles gambi... 59 1e-07
gi|6979967|gb|AAF34676.1| galectin-related inhibitor of prolifer... 59 2e-07
gi|18147670|dbj|BAB83247.1| galectin family xgalectin-Ia [Xenopu... 59 2e-07
gi|17505753|ref|NP_492918.1| predicted CDS, galectin LEC-4 like ... 59 2e-07
gi|5596624|gb|AAD45606.1| galectin 3 [Haemonchus contortus] 58 2e-07
gi|7019497|ref|NP_037400.1| placental protein 13; galectin-13 [H... 58 3e-07
gi|24580517|ref|NP_608488.1| CG11374-PA [Drosophila melanogaster... 57 4e-07
gi|31228123|ref|XP_318002.1| ENSANGP00000003368 [Anopheles gambi... 57 5e-07
gi|7582422|gb|AAF64320.1| galectin OVGAL11 [Ovis aries] 57 5e-07
gi|17540250|ref|NP_501007.1| galectin (26.7 kD) (lec-11) [Caenor... 57 5e-07
gi|9857641|dbj|BAB11967.1| galectin LEC-11 [Caenorhabditis elegans] 57 5e-07
gi|547870|sp|Q05315|LPPL_HUMAN Eosinophil lysophospholipase (Cha... 57 5e-07
gi|17942629|pdb|1HDK|A Chain A, Charcot-Leyden Crystal Protein -... 57 5e-07
gi|42658351|ref|XP_379988.1| similar to galectin-related inter-f... 57 7e-07
gi|20357559|ref|NP_001819.2| Charot-Leyden crystal protein; eosi... 56 9e-07
gi|47779226|gb|AAT38511.1| galectin-1 [Ovis aries] 56 9e-07
gi|39584133|emb|CAE61508.1| Hypothetical protein CBG05407 [Caeno... 56 9e-07
gi|50763478|ref|XP_422899.1| PREDICTED: similar to beta-galactos... 56 9e-07
gi|999583|pdb|1SLA|A Chain A, Galectin-1 (S-Lectin) Complexed Wi... 56 1e-06
gi|6647565|sp|Q9YIC2|LEG2_CONMY Congerin II (Beta-galactoside-bi... 56 1e-06
gi|24158678|pdb|1IS3|A Chain A, Lactose And Mes-Liganded Congeri... 56 1e-06
gi|28461189|ref|NP_786976.1| lectin, galactoside-binding, solubl... 56 1e-06
gi|31210947|ref|XP_314440.1| ENSANGP00000025083 [Anopheles gambi... 56 1e-06
gi|47716872|gb|AAT37622.1| galectin-1 [Sus scrofa] 55 1e-06
gi|1346427|sp|P48538|LEG1_CRIGR Galectin-1 (Beta-galactoside-bin... 55 1e-06
gi|7500762|pir||T29894 hypothetical protein F38A5.3 - Caenorhabd... 55 2e-06
gi|47939397|gb|AAH71424.1| Unknown (protein for MGC:86752) [Dani... 55 2e-06
gi|42542977|pdb|1GZW|A Chain A, X-Ray Crystal Structure Of Human... 54 3e-06
gi|30584667|gb|AAP36586.1| Homo sapiens lectin, galactoside-bind... 54 4e-06
gi|47086247|ref|NP_998059.1| proto galectin Gal1-L2 [Danio rerio... 54 4e-06
gi|42542978|pdb|1GZW|B Chain B, X-Ray Crystal Structure Of Human... 54 4e-06
gi|24580729|ref|NP_608553.1| CG13950-PA [Drosophila melanogaster... 54 4e-06
gi|4504981|ref|NP_002296.1| beta-galactosidase binding lectin pr... 54 4e-06
gi|193442|gb|AAA37667.1| beta-galactoside binding protein 54 4e-06
gi|3122339|sp|P81184|LEG1_SHEEP Galectin-1 (Beta-galactoside-bin... 54 6e-06
gi|47224706|emb|CAG00300.1| unnamed protein product [Tetraodon n... 54 6e-06
gi|49659000|emb|CAD37940.1| galectin [Suberites domuncula] 53 7e-06
gi|38540931|gb|AAH62691.1| Unknown (protein for MGC:71953) [Homo... 53 7e-06
gi|29611654|ref|NP_776113.1| RIKEN cDNA 1110067D22 [Mus musculus... 53 7e-06
gi|12805209|gb|AAH02063.1| Lectin, galactose binding, soluble 1 ... 53 7e-06
gi|9845261|ref|NP_063969.1| beta-galactoside-binding lectin [Rat... 53 9e-06
gi|41055788|ref|NP_956808.1| hypothetical protein MGC66283 [Dani... 52 1e-05
gi|6678682|ref|NP_032521.1| lectin, galactose binding, soluble 1... 52 1e-05
gi|7661818|ref|NP_054900.1| HSPC159 protein [Homo sapiens] >gnl|... 52 1e-05
gi|28189797|dbj|BAC56513.1| similar to galactose-binding lectin ... 52 2e-05
gi|211258|gb|AAA48626.1| 16 kDa beta-galactoside-binding lectin 52 2e-05
gi|29741322|ref|XP_086001.2| similar to Placental tissue protein... 52 2e-05
gi|39584785|emb|CAE67680.1| Hypothetical protein CBG13243 [Caeno... 50 8e-05
gi|28189290|dbj|BAC56336.1| similar to galactose-binding lectin ... 50 8e-05
gi|494605|pdb|1SLT|A Chain A, S-Lectin (A Vertebrate 14 Kda Beta... 49 1e-04
gi|494606|pdb|1SLT|B Chain B, S-Lectin (A Vertebrate 14 Kda Beta... 49 1e-04
gi|52890|emb|CAA36183.1| unnamed protein product [Mus musculus] 49 1e-04
gi|12835432|dbj|BAB23254.1| unnamed protein product [Mus musculus] 49 1e-04
gi|47209806|emb|CAG12311.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|50755815|ref|XP_425233.1| PREDICTED: similar to galectin-rela... 49 2e-04
gi|2554855|pdb|1GAN|A Chain A, Complex Of Toad Ovary Galectin Wi... 48 2e-04
gi|25050441|ref|XP_195619.1| similar to RIKEN cDNA 1110067D22 [M... 48 3e-04
gi|1438873|gb|AAB04141.1| galactose binding lectin [Coprinopsis ... 47 4e-04
gi|323008|pir||PC1254 endonuclease (EC 3.1.-.-) 12K chain - inky... 47 4e-04
gi|48425803|pdb|1UL9|A Chain A, Cgl2 Ligandfree >gnl|BL_ORD_ID|1... 47 7e-04
gi|4115482|dbj|BAA36385.1| Conger eel galectin (Congerin I) [Con... 46 9e-04
gi|6435674|pdb|1C1F|A Chain A, Ligand-Free Congerin I >gnl|BL_OR... 46 9e-04
gi|47211368|emb|CAF89821.1| unnamed protein product [Tetraodon n... 45 0.002
gi|1490874|gb|AAB06178.1| galactose binding lectin [Coprinus cin... 45 0.002
gi|6016493|sp|P56217|LEG1_BUFAR Galectin-1 >gnl|BL_ORD_ID|580704... 45 0.002
gi|13358444|ref|NP_078654.1| Galactose-binding lectin [Lymphocys... 45 0.002
gi|29467638|dbj|BAC67210.1| galectin [Anguilla japonica] 45 0.003
gi|126175|sp|P26788|LEG1_CONMY Congerin I (Beta-galactoside-bind... 45 0.003
gi|17507363|ref|NP_492884.1| predicted CDS, galectin like family... 44 0.003
gi|86947|pir||B28302 beta-galactoside-binding lectin, placental ... 44 0.003
gi|26349211|dbj|BAC38245.1| unnamed protein product [Mus musculus] 43 0.010
gi|7506105|pir||T29184 hypothetical protein M6.2 - Caenorhabditi... 43 0.010
gi|17540564|ref|NP_500492.1| predicted CDS, lectin like family m... 42 0.013
gi|27817330|emb|CAD61095.1| SI:zC101N13.9 (novel protein) [Danio... 42 0.017
gi|28189270|dbj|BAC56326.1| similar to galactose-binding lectin ... 42 0.017
gi|84420|pir||PX0062 beta-galactoside-binding lectin - Caenorhab... 42 0.017
gi|17540560|ref|NP_500490.1| galectin like precursor family memb... 42 0.017
gi|110639|pir||S07162 lectin - mouse (fragment) 41 0.037
gi|27884295|dbj|BAC55884.1| galectin family xgalectin-Vb [Xenopu... 41 0.037
gi|28189272|dbj|BAC56327.1| similar to galactose-binding lectin ... 40 0.049
gi|14194179|gb|AAK56284.1| placental protein 13-like [Homo sapiens] 40 0.049
gi|17540562|ref|NP_500491.1| predicted CDS, galectin LEC-4 like ... 40 0.049
gi|539480|pir||A42812 16K lactose-binding lectin - African clawe... 40 0.083
gi|14194183|gb|AAK56286.1| placental protein 13-like [Homo sapiens] 39 0.11
gi|17507371|ref|NP_492881.1| putative secreted or extracellular ... 39 0.14
gi|17507361|ref|NP_492885.1| galectin LEC-4 like family member (... 39 0.18
gi|25011571|ref|NP_735966.1| Unknown [Streptococcus agalactiae N... 39 0.18
gi|39584983|emb|CAE64407.1| Hypothetical protein CBG09099 [Caeno... 38 0.24
gi|14041576|emb|CAC38760.1| Galectin [Geodia cydonium] 38 0.31
gi|28189843|dbj|BAC56536.1| similar to galactose-binding lectin ... 37 0.41
gi|23103011|ref|ZP_00089504.1| COG4239: ABC-type uncharacterized... 37 0.70
gi|45433586|ref|NP_991400.1| hypothetical protein MGC75965 [Xeno... 36 0.91
gi|2133438|pir||S45342 galactose/lactose-binding lectin I precur... 36 1.2
gi|2285924|emb|CAA63818.1| galectin [Geodia cydonium] >gnl|BL_OR... 36 1.2
gi|19113482|ref|NP_596690.1| hypothetical serine-rich secreted p... 35 1.6
gi|553876|gb|AAA37313.1| 14 kDa beta-galactoside-binding lectin ... 35 2.0
gi|8885520|dbj|BAA97453.1| streptococcal hemagglutinin [Streptoc... 35 2.0
gi|28422201|gb|AAH44270.1| MGC53130 protein [Xenopus laevis] 35 2.0
gi|47218748|emb|CAG02734.1| unnamed protein product [Tetraodon n... 35 2.7
gi|20094199|ref|NP_614046.1| Predicted RNA methylase [Methanopyr... 35 2.7
gi|1209314|gb|AAA93053.1| lectin II 35 2.7
gi|31200841|ref|XP_309368.1| ENSANGP00000015669 [Anopheles gambi... 35 2.7
gi|323155|pir||S29983 lectin II - Geodia cydonium (fragment) >gn... 35 2.7
gi|17507365|ref|NP_492883.1| putative secreted or extracellular ... 34 3.5
gi|15901602|ref|NP_346206.1| cell wall surface anchor family pro... 34 4.5
gi|2501758|gb|AAC47752.1| cubitus interruptus dominant protein [... 34 4.5
gi|45549239|ref|NP_524617.3| CG2125-PA [Drosophila melanogaster]... 34 4.5
gi|47220508|emb|CAG05534.1| unnamed protein product [Tetraodon n... 34 4.5
gi|50751166|ref|XP_422287.1| PREDICTED: similar to SMG-7 homolog... 34 4.5
gi|32043395|ref|ZP_00140657.1| COG0596: Predicted hydrolases or ... 34 4.5
gi|50288227|ref|XP_446542.1| unnamed protein product [Candida gl... 34 4.5
gi|48854547|ref|ZP_00308709.1| COG0457: FOG: TPR repeat [Cytopha... 34 4.5
gi|30678395|ref|NP_850934.1| pre-mRNA splicing factor SF2 (SF2) ... 34 4.5
gi|1079067|pir||A38926 DNA-binding protein ci (D) - fruit fly (D... 34 4.5
gi|39580030|emb|CAE65644.1| Hypothetical protein CBG10702 [Caeno... 34 4.5
gi|5815236|gb|AAD52610.1| splicing factor SR1B [Arabidopsis thal... 34 4.5
gi|25153827|ref|NP_741306.1| galectin like family member (4C1) [... 33 5.9
gi|34533013|dbj|BAC86573.1| unnamed protein product [Homo sapiens] 33 7.7
gi|16081450|ref|NP_393794.1| hypothetical membrane protein [Ther... 33 7.7
gi|18202412|sp|P82447|LEG1_PODHI Galectin-1 33 7.7
gi|49389229|dbj|BAD26539.1| hypothetical protein [Oryza sativa (... 33 7.7
>gi|25153023|ref|NP_496801.2| galectin, beta-galactoside binding
lectin (31.8 kD) (lec-1) [Caenorhabditis elegans]
gi|547844|sp|P36573|LE32_CAEEL 32 kDa beta-galactoside-binding
lectin (32 kDa GBP)
gi|7494614|pir||T37216 beta-galactoside-binding protein GBP -
Caenorhabditis elegans
gi|156210|gb|AAB87718.1| beta-galactoside binding protein
[Caenorhabditis elegans]
gi|2564036|dbj|BAA22942.1| 32-kDa galectin [Caenorhabditis elegans]
gi|3880610|emb|CAB04959.1| Hypothetical protein W09H1.6a
[Caenorhabditis elegans]
Length = 279
Score = 573 bits (1478), Expect = e-162
Identities = 279/279 (100%), Positives = 279/279 (100%)
Frame = +1
Query: 1 MSAEEPKSYPVPYRSVLQEKFEPGQTLIVKGSTIDESQRFTINLHSKTADFSGNDVPLHV 180
MSAEEPKSYPVPYRSVLQEKFEPGQTLIVKGSTIDESQRFTINLHSKTADFSGNDVPLHV
Sbjct: 1 MSAEEPKSYPVPYRSVLQEKFEPGQTLIVKGSTIDESQRFTINLHSKTADFSGNDVPLHV 60
Query: 181 SVRFDEGKIVLNSFSNGEWGKEERKSNPIKKGDSFDIRIRAHDDRFQIIVDHKEFKDYEH 360
SVRFDEGKIVLNSFSNGEWGKEERKSNPIKKGDSFDIRIRAHDDRFQIIVDHKEFKDYEH
Sbjct: 61 SVRFDEGKIVLNSFSNGEWGKEERKSNPIKKGDSFDIRIRAHDDRFQIIVDHKEFKDYEH 120
Query: 361 RLPLSSISHLSIDGDLYLNHVHWGGKYYPVPYESGLANGLPVGKSLLVFGTVEKKAKRFH 540
RLPLSSISHLSIDGDLYLNHVHWGGKYYPVPYESGLANGLPVGKSLLVFGTVEKKAKRFH
Sbjct: 121 RLPLSSISHLSIDGDLYLNHVHWGGKYYPVPYESGLANGLPVGKSLLVFGTVEKKAKRFH 180
Query: 541 VNLLRKNGDISFHFNPRFDEKHVIRNSLAANEWGNEEREGKNPFEKGVGFDLVIQNEEYA 720
VNLLRKNGDISFHFNPRFDEKHVIRNSLAANEWGNEEREGKNPFEKGVGFDLVIQNEEYA
Sbjct: 181 VNLLRKNGDISFHFNPRFDEKHVIRNSLAANEWGNEEREGKNPFEKGVGFDLVIQNEEYA 240
Query: 721 FQVFVNGERYISFAHRADPHDIAGLQISGDIELSGIQIQ 837
FQVFVNGERYISFAHRADPHDIAGLQISGDIELSGIQIQ
Sbjct: 241 FQVFVNGERYISFAHRADPHDIAGLQISGDIELSGIQIQ 279