Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y105C5A_1
         (2304 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17544294|ref|NP_502871.1| ELM2 domain containing protein (87....  1414   0.0
gi|39588153|emb|CAE68077.1| Hypothetical protein CBG13707 [Caeno...   347   9e-94
gi|39583525|emb|CAE73983.1| Hypothetical protein CBG21614 [Caeno...   273   1e-71
gi|39588156|emb|CAE68080.1| Hypothetical protein CBG13713 [Caeno...   209   2e-52
gi|39581626|emb|CAE71747.1| Hypothetical protein CBG18733 [Caeno...   192   2e-47
gi|17560318|ref|NP_506874.1| ELM2 domain containing protein (5Q5...   175   5e-42
gi|39579494|emb|CAE56588.1| Hypothetical protein CBG24333 [Caeno...   137   9e-31
gi|39579714|emb|CAE56227.1| Hypothetical protein CBG23860 [Caeno...   115   5e-24
gi|17570495|ref|NP_508068.1| predicted CDS, putative nuclear pro...   111   9e-23
gi|39588181|emb|CAE68106.1| Hypothetical protein CBG13748 [Caeno...   108   6e-22
gi|39596159|emb|CAE69796.1| Hypothetical protein CBG16092 [Caeno...    58   1e-06
gi|32565309|ref|NP_871687.1| putative membrane protein, with 5 c...    52   5e-05
gi|17554688|ref|NP_497667.1| putative membrane protein, with 5 c...    52   5e-05
gi|7506738|pir||T32404 hypothetical protein R148.3 - Caenorhabdi...    52   5e-05
gi|39725326|emb|CAC87487.1| fibronectin-binding protein I [Strep...    50   3e-04
gi|39725342|emb|CAC87669.1| fibronectin-binding protein I [Strep...    49   4e-04
gi|33411674|dbj|BAC81443.1| XRnf12C [Xenopus laevis]                   49   4e-04
gi|39725354|emb|CAC87675.1| fibronectin-binding protein I [Strep...    49   5e-04
gi|2498146|sp|Q00083|APSA_EMENI Anucleate primary sterigmata pro...    49   7e-04
gi|49112674|ref|XP_411894.1| APSA_EMENI Anucleate primary sterig...    49   7e-04
gi|39725378|emb|CAC87687.1| fibronectin-binding protein I [Strep...    48   0.001
gi|39725384|emb|CAC87697.1| fibronectin-binding protein I [Strep...    48   0.001
gi|25056007|gb|AAD55980.2| extensin-like protein [Zea mays]            48   0.001
gi|39725332|emb|CAC87607.1| fibronectin-binding protein I [Strep...    47   0.002
gi|39725382|emb|CAC87689.1| fibronectin-binding protein I [Strep...    47   0.002
gi|39725330|emb|CAC87489.1| fibronectin-binding protein I [Strep...    47   0.002
gi|39725328|emb|CAC87488.1| fibronectin-binding protein I [Strep...    47   0.002
gi|39725334|emb|CAC87608.1| fibronectin-binding protein I [Strep...    47   0.002
gi|39725298|emb|CAC87797.1| fibronectin-binding protein I [Strep...    47   0.002
gi|39725296|emb|CAC87796.1| fibronectin-binding protein I [Strep...    47   0.002
gi|9631996|ref|NP_048785.1| Pro- and Glu-rich, PENPEV (10x); sim...    47   0.002
gi|48763011|ref|ZP_00267568.1| COG1426: Uncharacterized protein ...    46   0.003
gi|39725300|emb|CAC87798.1| fibronectin-binding protein I [Strep...    46   0.004
gi|39725352|emb|CAC87674.1| fibronectin-binding protein I [Strep...    46   0.004
gi|50255535|gb|EAL18270.1| hypothetical protein CNBK2880 [Crypto...    45   0.008
gi|1076802|pir||S49915 extensin-like protein - maize >gnl|BL_ORD...    45   0.008
gi|39582474|emb|CAE66565.1| Hypothetical protein CBG11880 [Caeno...    45   0.008
gi|39725318|emb|CAC87807.1| fibronectin-binding protein I [Strep...    45   0.008
gi|39725322|emb|CAC87809.1| fibronectin-binding protein I [Strep...    45   0.008
gi|39725320|emb|CAC87808.1| fibronectin-binding protein I [Strep...    45   0.008
gi|97885|pir||A35186 salivary agglutinin receptor precursor - St...    45   0.010
gi|3220006|sp|P16952|SSP5_STRGN Agglutinin receptor precursor (S...    45   0.010
gi|18025476|gb|AAK95420.1| BPLF1 [cercopithicine herpesvirus 15]       45   0.010
gi|50752373|ref|XP_422760.1| PREDICTED: similar to eukaryotic tr...    44   0.013
gi|39725324|emb|CAC87486.1| fibronectin-binding protein I [Strep...    44   0.013
gi|19115833|ref|NP_594921.1| actin binding protein with SH3 doma...    44   0.017
gi|33411672|dbj|BAC81442.1| XRnf12B [Xenopus laevis]                   44   0.017
gi|46120166|ref|ZP_00179522.2| hypothetical protein Cwat020470 [...    44   0.017
gi|39725316|emb|CAC87806.1| fibronectin-binding protein I [Strep...    44   0.017
gi|31559809|ref|NP_853522.1| polycystic kidney disease 1 like 3;...    44   0.017
gi|39725366|emb|CAC87681.1| fibronectin-binding protein I [Strep...    44   0.022
gi|24658804|ref|NP_523815.2| CG12781-PA [Drosophila melanogaster...    44   0.022
gi|39725346|emb|CAC87671.1| fibronectin-binding protein I [Strep...    44   0.022
gi|41400384|gb|AAS07044.1| plus agglutinin [Chlamydomonas reinha...    44   0.022
gi|39725344|emb|CAC87670.1| fibronectin-binding protein I [Strep...    44   0.022
gi|39725364|emb|CAC87680.1| fibronectin-binding protein I [Strep...    44   0.022
gi|39725368|emb|CAC87682.1| fibronectin-binding protein I [Strep...    44   0.022
gi|7512404|pir||I38346 elastic titin - human (fragment) >gnl|BL_...    44   0.022
gi|39725348|emb|CAC87672.1| fibronectin-binding protein I [Strep...    44   0.022
gi|39725314|emb|CAC87805.1| fibronectin-binding protein I [Strep...    43   0.029
gi|322759|pir||PQ0479 pistil extensin-like protein (clone pMG14)...    43   0.029
gi|39725312|emb|CAC87804.1| fibronectin-binding protein I [Strep...    43   0.029
gi|45199230|ref|NP_986259.1| AFR711Cp [Eremothecium gossypii] >g...    43   0.029
gi|15807928|ref|NP_285589.1| hypothetical protein [Deinococcus r...    43   0.029
gi|39725292|emb|CAC87794.1| fibronectin-binding protein I [Strep...    43   0.029
gi|23508582|ref|NP_701251.1| hypothetical protein [Plasmodium fa...    43   0.029
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib...    43   0.029
gi|39725310|emb|CAC87803.1| fibronectin-binding protein I [Strep...    43   0.029
gi|39725350|emb|CAC87673.1| fibronectin-binding protein I [Strep...    43   0.038
gi|41053475|ref|NP_956982.1| hypothetical protein MGC64189 [Dani...    42   0.050
gi|34880471|ref|XP_213903.2| similar to This gene is isolated by...    42   0.050
gi|16182657|gb|AAL13544.1| GH08002p [Drosophila melanogaster]          42   0.065
gi|50555714|ref|XP_505265.1| hypothetical protein [Yarrowia lipo...    42   0.065
gi|15805485|ref|NP_294181.1| hypothetical protein [Deinococcus r...    42   0.065
gi|38105982|gb|EAA52344.1| hypothetical protein MG05036.4 [Magna...    42   0.065
gi|1100971|gb|AAC44099.1| SspA                                         42   0.085
gi|33601969|ref|NP_889529.1| filamentous hemagglutinin/adhesin [...    42   0.085
gi|39596379|emb|CAE70017.1| Hypothetical protein CBG16431 [Caeno...    42   0.085
gi|1184100|gb|AAA87047.1| pistil extensin-like protein                 42   0.085
gi|41387633|gb|AAS01677.1| large tegument protein [Gallid herpes...    42   0.085
gi|6650634|gb|AAB94077.2| adhesin [Bordetella bronchiseptica]          42   0.085
gi|33384237|gb|AAN08506.1| cardiac titin isoform N2BA [Canis fam...    42   0.085
gi|23479361|gb|EAA16212.1| guanylyl cyclase [Plasmodium yoelii y...    41   0.11
gi|39582366|emb|CAE74749.1| Hypothetical protein CBG22571 [Caeno...    41   0.11
gi|12053779|emb|CAC20094.1| Nahoda protein [Drosophila melanogas...    41   0.11
gi|17066109|emb|CAD12460.1| Titin fetal Isoform [Homo sapiens]         41   0.11
gi|39725380|emb|CAC87688.1| fibronectin-binding protein I [Strep...    41   0.11
gi|39586345|emb|CAE74002.1| Hypothetical protein CBG21638 [Caeno...    41   0.11
gi|47060309|gb|AAT09768.1| titin [Homo sapiens]                        41   0.11
gi|544262|sp|Q03211|EXLP_TOBAC Pistil-specific extensin-like pro...    41   0.11
gi|24581096|ref|NP_608670.1| CG15388-PA [Drosophila melanogaster...    41   0.14
gi|2126644|pir||S54418 fibronectin-binding protein precursor - S...    41   0.14
gi|33384231|gb|AAN08503.1| cardiac titin isoform N2BA [Canis fam...    41   0.14
gi|15021840|dbj|BAB62199.1| hypothetical protein [Macaca fascicu...    41   0.14
gi|4838563|gb|AAD31043.1| surface protein C PspC [Streptococcus ...    41   0.14
gi|31198815|ref|XP_308355.1| ENSANGP00000009410 [Anopheles gambi...    41   0.14
gi|33384233|gb|AAN08504.1| cardiac titin isoform N2BA [Canis fam...    41   0.14
gi|33413750|gb|AAN11323.1| cardiac titin [Canis familiaris]            41   0.14
gi|42408241|dbj|BAD09398.1| putative pherophorin-dz1 protein [Or...    41   0.14
gi|322756|pir||PQ0478 pistil extensin-like protein (clone pMG07)...    41   0.14
gi|31198813|ref|XP_308354.1| ENSANGP00000024069 [Anopheles gambi...    41   0.14
gi|50421125|ref|XP_459108.1| unnamed protein product [Debaryomyc...    41   0.14
gi|7243956|gb|AAB36399.2| 180 kda immunodominant antigen/PAc pro...    41   0.14
gi|39597796|emb|CAE68488.1| Hypothetical protein CBG14291 [Caeno...    41   0.14
gi|31095616|gb|AAP43676.1| C protein immunoglobin-a-binding beta...    40   0.19
gi|50750413|ref|XP_421993.1| PREDICTED: similar to WASP interact...    40   0.19
gi|34529367|dbj|BAC85687.1| unnamed protein product [Homo sapiens]     40   0.19
gi|20521149|dbj|BAA34474.2| KIAA0754 protein [Homo sapiens]            40   0.19
gi|46202034|ref|ZP_00053896.2| COG2885: Outer membrane protein a...    40   0.19
gi|950169|gb|AAB06623.1| fibronectin binding protein F                 40   0.19
gi|9759597|dbj|BAB11454.1| unnamed protein product [Arabidopsis ...    40   0.19
gi|49609344|emb|CAE53872.1| fibronectin-binding protein [Strepto...    40   0.19
gi|39578750|emb|CAE57157.1| Hypothetical protein CBG25091 [Caeno...    40   0.19
gi|11096149|gb|AAG30214.1| collagen-like surface protein [Strept...    40   0.19
gi|25143299|ref|NP_492875.2| pre-mRNA splicing SR protein relate...    40   0.19
gi|25055226|gb|AAC44102.3| streptococcal surface protein B precu...    40   0.19
gi|38108889|gb|EAA54835.1| hypothetical protein MG05626.4 [Magna...    40   0.25
gi|46140932|ref|ZP_00152648.2| COG0810: Periplasmic protein TonB...    40   0.25
gi|33469025|ref|NP_473419.1| bromodomain adjacent to zinc finger...    40   0.25
gi|41400381|gb|AAS07042.1| minus agglutinin [Chlamydomonas reinh...    40   0.25
gi|48788796|ref|ZP_00284775.1| hypothetical protein Bcep02001278...    40   0.25
gi|6754804|ref|NP_035554.1| nuclear receptor co-repressor 2; sil...    40   0.25
gi|38073487|ref|XP_355243.1| similar to This gene is isolated by...    40   0.25
gi|9635070|ref|NP_057795.1| major tegument protein [Gallid herpe...    40   0.25
gi|7209719|dbj|BAA92310.1| This gene is isolated by means of dif...    40   0.25
gi|29387324|gb|AAH48415.1| Baz2a protein [Mus musculus]                40   0.25
gi|50419203|ref|XP_458124.1| unnamed protein product [Debaryomyc...    40   0.25
gi|18029003|gb|AAL56257.1| C protein immunoglobulin-A-binding be...    40   0.32
gi|32406872|ref|XP_324049.1| predicted protein [Neurospora crass...    40   0.32
gi|416833|sp|Q02910|CPN_DROME Calphotin >gnl|BL_ORD_ID|454593 gi...    40   0.32
gi|15675795|ref|NP_269969.1| hypothetical protein SPy2009 [Strep...    40   0.32
gi|24646199|ref|NP_731674.1| CG4795-PB [Drosophila melanogaster]...    40   0.32
gi|46119199|ref|ZP_00176221.2| COG0532: Translation initiation f...    40   0.32
gi|23509251|ref|NP_701918.1| hypothetical protein [Plasmodium fa...    40   0.32
gi|12831207|ref|NP_075579.1| gamma-aminobutyric acid  A receptor...    40   0.32
gi|135986|sp|P26185|TONB_SERMA TonB protein >gnl|BL_ORD_ID|43894...    40   0.32
gi|24646197|ref|NP_731673.1| CG4795-PA [Drosophila melanogaster]...    40   0.32
gi|5305335|gb|AAD41594.1| proline-rich mucin homolog [Mycobacter...    40   0.32
gi|24656688|ref|NP_647799.1| CG12009-PA [Drosophila melanogaster...    40   0.32
gi|28869674|ref|NP_792293.1| tonB protein [Pseudomonas syringae ...    40   0.32
gi|5139695|dbj|BAA81686.1| expressed in cucumber hypocotyls [Cuc...    40   0.32
gi|20138131|sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1...    40   0.32
gi|423789|pir||A47283 calphotin - fruit fly (Drosophila melanoga...    40   0.32
gi|11610622|gb|AAG38961.1| GABA-A epsilon subunit splice variant...    40   0.32
gi|10180741|gb|AAG14229.1| UL36 large tegument protein-like prot...    40   0.32
gi|39590923|emb|CAE58703.1| Hypothetical protein CBG01887 [Caeno...    40   0.32
gi|14582310|gb|AAK69446.1| proline-rich protein-2 [Gossypium hir...    39   0.42
gi|14915682|dbj|BAB62098.1| fibronectin-binding protein [Strepto...    39   0.42
gi|50545139|ref|XP_500107.1| hypothetical protein [Yarrowia lipo...    39   0.42
gi|48696793|ref|YP_024617.1| ORF78 [Ostreid herpesvirus 1] >gnl|...    39   0.42
gi|15451136|gb|AAK96839.1| periaxin-like protein [Arabidopsis th...    39   0.42
gi|15242438|ref|NP_196515.1| hydroxyproline-rich glycoprotein fa...    39   0.42
gi|50311107|ref|XP_455577.1| unnamed protein product [Kluyveromy...    39   0.42
gi|25990270|gb|AAC44101.3| streptococcal surface protein A precu...    39   0.42
gi|46322296|ref|ZP_00222667.1| hypothetical protein Bucepa020027...    39   0.42
gi|50789970|ref|XP_423552.1| PREDICTED: similar to Myeloid/lymph...    39   0.42
gi|18029009|gb|AAL56260.1| C protein immunoglobulin-A-binding be...    39   0.42
gi|6687464|emb|CAB64965.1| TonB protein [Erwinia chrysanthemi]         39   0.42
gi|39580549|emb|CAE74681.1| Hypothetical protein CBG22491 [Caeno...    39   0.42
gi|15425681|dbj|BAB64297.1| I-connectin [Procambarus clarkii]          39   0.42
gi|6093457|sp|Q05623|MYPH_CHICK Myosin-binding protein H (MyBP-H...    39   0.55
gi|422690|pir||A46611 myosin-binding protein H - chicken               39   0.55
gi|1084362|pir||S53504 extensin-like protein S3 - alfalfa >gnl|B...    39   0.55
gi|50751732|ref|XP_422531.1| PREDICTED: similar to mesoderm indu...    39   0.55
gi|5031925|ref|NP_005798.1| proteoglycan 4; megakaryocyte stimul...    39   0.55
gi|13559026|emb|CAC36090.1| bG174L6.2 (MSF: megakaryocyte stimul...    39   0.55
gi|22775646|dbj|BAC15500.1| early nodulin 75 precursor-like prot...    39   0.55
gi|47214568|emb|CAG13290.1| unnamed protein product [Tetraodon n...    39   0.55
gi|50553702|ref|XP_504262.1| hypothetical protein [Yarrowia lipo...    39   0.55
gi|24666371|ref|NP_652671.1| CG18811-PA [Drosophila melanogaster...    39   0.55
gi|8393396|ref|NP_059065.1| gamma-aminobutyric acid (GABA-A) rec...    39   0.55
gi|50761238|ref|XP_419236.1| PREDICTED: similar to myosin bindin...    39   0.55
gi|50659088|ref|NP_596869.2| titin isoform N2-A; connectin; CMH9...    39   0.55
gi|17066105|emb|CAD12456.1| Titin [Homo sapiens]                       39   0.55
gi|46316971|ref|ZP_00217549.1| hypothetical protein Bcepa0200014...    39   0.55
gi|34870078|ref|XP_341027.1| similar to zinc finger protein ZFEN...    39   0.55
gi|46120816|ref|ZP_00172408.2| hypothetical protein Mflag021710 ...    39   0.55
gi|39725390|emb|CAC87692.1| fibronectin-binding protein I [Strep...    39   0.55
gi|39725372|emb|CAC87684.1| fibronectin-binding protein I [Strep...    39   0.55
gi|7861746|gb|AAF70384.1| GABA-A receptor epsilon-like subunit [...    39   0.55
gi|50556390|ref|XP_505603.1| hypothetical protein [Yarrowia lipo...    39   0.55
gi|50759319|ref|XP_417618.1| PREDICTED: similar to Msx-2 interac...    39   0.72
gi|15222649|ref|NP_173940.1| protein kinase family protein [Arab...    39   0.72
gi|2327063|gb|AAB66702.1| protease 1 [Pneumocystis carinii f. sp...    39   0.72
gi|49609342|emb|CAE53871.1| fibronectin-binding protein [Strepto...    39   0.72
gi|32414489|ref|XP_327724.1| hypothetical protein [Neurospora cr...    39   0.72
gi|15828864|ref|NP_326224.1| conserved hypothetical protein [Myc...    39   0.72
gi|38089806|ref|XP_110671.2| myeloid/lymphoid or mixed-lineage l...    39   0.72
gi|24586324|ref|NP_610302.2| CG30494-PA [Drosophila melanogaster...    39   0.72
gi|50590287|ref|ZP_00331686.1| COG0840: Methyl-accepting chemota...    39   0.72
gi|28870802|ref|NP_793421.1| DNA polymerase III, subunits gamma ...    39   0.72
gi|21220053|ref|NP_625832.1| putative nicotinate-nucleotide-dime...    39   0.72
gi|22093906|gb|AAM91820.1| choriogenin H [Oryzias latipes]             39   0.72
gi|18478606|gb|AAL73214.1| repetitive proline rich protein [Oryz...    39   0.72
gi|17560666|ref|NP_507009.1| putative protein family member, wit...    39   0.72
gi|81286|pir||S22697 extensin - Volvox carteri (fragment) >gnl|B...    39   0.72
gi|27370791|gb|AAH38012.1| Baz2a protein [Mus musculus]                39   0.72
gi|34879082|ref|XP_214092.2| similar to KIAA0363 [Rattus norvegi...    39   0.72
gi|34876701|ref|XP_214018.2| hypothetical protein XP_214018 [Rat...    39   0.72
gi|39725370|emb|CAC87683.1| fibronectin-binding protein I [Strep...    39   0.72
gi|27382507|ref|NP_774036.1| two-component hybrid sensor and reg...    39   0.72
gi|50511379|gb|AAT77302.1| putative repetitive proline rich prot...    39   0.72
gi|18029001|gb|AAL56256.1| C protein immunoglobulin-A-binding be...    38   0.94
gi|18028999|gb|AAL56255.1| C protein immunoglobulin-A-binding be...    38   0.94
gi|22093740|dbj|BAC07033.1| hypothetical protein [Oryza sativa (...    38   0.94
gi|39725356|emb|CAC87676.1| fibronectin-binding protein I [Strep...    38   0.94
gi|50255118|gb|EAL17857.1| hypothetical protein CNBL1190 [Crypto...    38   0.94
gi|14582308|gb|AAK69445.1| proline-rich protein-1 [Gossypium hir...    38   0.94
gi|34868150|ref|XP_343327.1| similar to myeloid/lymphoid or mixe...    38   0.94
gi|13508191|ref|NP_110140.1| cytadherence accessory protein HMW3...    38   0.94
gi|39725360|emb|CAC87678.1| fibronectin-binding protein I [Strep...    38   0.94
gi|38455896|gb|AAR20917.1| A12 protein [Pneumocystis carinii f. ...    38   0.94
gi|32417970|ref|XP_329463.1| predicted protein [Neurospora crass...    38   0.94
gi|21326031|gb|AAM47576.1| choriogenin H [Oryzias latipes]             38   0.94
gi|627837|pir||A48205 All-1 protein +GTE form - mouse (fragment)       38   0.94
gi|32476474|ref|NP_869468.1| conserved hypothetical protein-puta...    38   0.94
gi|1708302|sp|P55200|HRX_MOUSE Zinc finger protein HRX (ALL-1) >...    38   0.94
gi|39725358|emb|CAC87677.1| fibronectin-binding protein I [Strep...    38   0.94
gi|31982209|ref|NP_032554.2| B-cell linker; lymphocyte antigen 5...    38   0.94
gi|3406753|gb|AAC40206.1| B cell linker protein BLNK [Mus musculus]    38   0.94
gi|47087860|gb|AAT10376.1| beta-antigen [Streptococcus agalactiae]     38   0.94
gi|49117600|gb|AAH72624.1| Ciz1 protein [Mus musculus]                 38   0.94
gi|3252880|gb|AAC24207.1| myosin heavy chain isoform A [Loligo p...    38   0.94
gi|32414167|ref|XP_327563.1| hypothetical protein [Neurospora cr...    38   0.94
gi|39725362|emb|CAC87679.1| fibronectin-binding protein I [Strep...    38   0.94
gi|48832845|ref|ZP_00289872.1| COG0810: Periplasmic protein TonB...    38   0.94
gi|34894174|ref|NP_908412.1| putative protein kinase [Oryza sati...    38   0.94
gi|32413637|ref|XP_327298.1| hypothetical protein [Neurospora cr...    38   1.2
gi|15240947|ref|NP_198672.1| protein kinase family protein [Arab...    38   1.2
gi|32401235|gb|AAP80791.1| cardiac titin N2BA isoform [Homo sapi...    38   1.2
gi|39596044|emb|CAE69680.1| Hypothetical protein CBG15933 [Caeno...    38   1.2
gi|50417022|gb|AAH78410.1| Unknown (protein for MGC:92043) [Dani...    38   1.2
gi|23481491|gb|EAA17752.1| putative transcription factor [Plasmo...    38   1.2
gi|19882247|ref|NP_082688.1| Cip1-interacting zinc finger protei...    38   1.2
gi|38105532|gb|EAA51949.1| hypothetical protein MG03544.4 [Magna...    38   1.2
gi|50556110|ref|XP_505463.1| hypothetical protein [Yarrowia lipo...    38   1.2
gi|15222081|ref|NP_175353.1| protein kinase family protein [Arab...    38   1.2
gi|23485065|gb|EAA20186.1| hydroxyproline-rich glycoprotein DZ-H...    38   1.2
gi|50549423|ref|XP_502182.1| hypothetical protein [Yarrowia lipo...    38   1.2
gi|39597010|emb|CAE59237.1| Hypothetical protein CBG02561 [Caeno...    38   1.2
gi|39596378|emb|CAE70016.1| Hypothetical protein CBG16430 [Caeno...    38   1.2
gi|15617476|ref|NP_258270.1| essential structural protein pp78/8...    38   1.2
gi|27376266|ref|NP_767795.1| bll1155 [Bradyrhizobium japonicum U...    38   1.2
gi|541369|pir||S40043 adhesin - Streptococcus pyogenes >gnl|BL_O...    38   1.2
gi|49086416|ref|XP_405257.1| hypothetical protein AN1120.2 [Aspe...    38   1.2
gi|2271467|gb|AAC38155.1| fibronectin/fibrinogen binding protein...    38   1.2
gi|46188580|ref|ZP_00124811.2| COG0810: Periplasmic protein TonB...    38   1.2
gi|6649857|gb|AAF21601.1| kexin-like serine endoprotease [Pneumo...    37   1.6
gi|45185097|ref|NP_982814.1| ABL133Cp [Eremothecium gossypii] >g...    37   1.6
gi|48109148|ref|XP_396216.1| similar to ENSANGP00000007871 [Apis...    37   1.6
gi|39930557|ref|NP_919444.1| A kinase (PRKA) anchor protein (yot...    37   1.6
gi|50291265|ref|XP_448065.1| unnamed protein product [Candida gl...    37   1.6
gi|7657128|ref|NP_056526.1| glioma tumor suppressor candidate re...    37   1.6
gi|32563970|ref|NP_492507.2| putative nuclear protein, with a co...    37   1.6
gi|13936310|gb|AAK40308.1| putative methyl-binding domain protei...    37   1.6
gi|25453525|pir||T52340 cell wall-plasma membrane linker protein...    37   1.6
gi|16944521|emb|CAB97476.2| conserved hypothetical protein [Neur...    37   1.6
gi|42525075|ref|NP_970455.1| hypothetical protein Bd3745 [Bdello...    37   1.6
gi|11359537|pir||T51023 hypothetical protein B7F21.40 [imported]...    37   1.6
gi|34854739|ref|XP_229988.2| similar to cobl-related 1 [Rattus n...    37   1.6
gi|47229625|emb|CAG06821.1| unnamed protein product [Tetraodon n...    37   1.6
gi|39725374|emb|CAC87685.1| fibronectin-binding protein I [Strep...    37   1.6
gi|7496186|pir||T19354 hypothetical protein C17E4.10 - Caenorhab...    37   1.6
gi|33438277|dbj|BAC65656.2| mKIAA0803 protein [Mus musculus]           37   1.6
gi|50759582|ref|XP_417695.1| PREDICTED: similar to absent in mel...    37   1.6
gi|49609338|emb|CAE53869.1| fibronectin-binding protein [Strepto...    37   1.6
gi|10047295|dbj|BAB13436.1| KIAA1610 protein [Homo sapiens]            37   2.1
gi|32490589|ref|NP_870998.1| periaxin [Homo sapiens] >gnl|BL_ORD...    37   2.1
gi|38086618|ref|XP_149934.2| similar to ENSANGP00000004655 [Mus ...    37   2.1
gi|7446485|pir||T09792 proline-rich protein precursor - upland c...    37   2.1
gi|25409018|pir||C84905 probable extensin [imported] - Arabidops...    37   2.1
gi|28574063|ref|NP_787998.1| CG13388-PD [Drosophila melanogaster...    37   2.1
gi|29830947|ref|NP_825581.1| hypothetical protein SAV4404 [Strep...    37   2.1
gi|38348516|ref|NP_941039.1| Unknown (protein for MGC:58818) [Mu...    37   2.1
gi|49097922|ref|XP_410421.1| hypothetical protein AN6284.2 [Aspe...    37   2.1
gi|22656368|gb|AAM97501.1| mesoderm induction early response 1 N...    37   2.1
gi|46250177|gb|AAH68956.1| LOC414498 protein [Xenopus laevis]          37   2.1
gi|50590286|ref|ZP_00331685.1| COG0532: Translation initiation f...    37   2.1
gi|47223109|emb|CAG07196.1| unnamed protein product [Tetraodon n...    37   2.1
gi|20908094|tpg|DAA00021.1| TPA: TITIN [Drosophila melanogaster]       37   2.1
gi|32414761|ref|XP_327860.1| hypothetical protein [Neurospora cr...    37   2.1
gi|32564667|ref|NP_496621.2| putative protein family member (80....    37   2.1
gi|50289609|ref|XP_447236.1| unnamed protein product [Candida gl...    37   2.1
gi|21702661|gb|AAM76041.1| mesoderm induction early response 1 N...    37   2.1
gi|23488129|gb|EAA21238.1| hypothetical protein [Plasmodium yoel...    37   2.1
gi|47223930|emb|CAG06107.1| unnamed protein product [Tetraodon n...    37   2.1
gi|33384229|gb|AAN08502.1| cardiac titin isoform N2BA [Canis fam...    37   2.1
gi|21702659|gb|AAM76040.1| mesoderm induction early response 1 N...    37   2.1
gi|23113903|ref|ZP_00099240.1| COG1716: FOG: FHA domain [Desulfi...    37   2.1
gi|24655822|ref|NP_652705.1| CG1915-PC [Drosophila melanogaster]...    37   2.1
gi|49094886|ref|XP_408904.1| hypothetical protein AN4767.2 [Aspe...    37   2.1
gi|25528885|pir||JC7807 Wiskott-Aldrich syndrome protein (WASP)-...    37   2.1
gi|25152945|ref|NP_741957.1| carboxyl ester lipase like (XS293) ...    37   2.1
gi|7497739|pir||T33498 hypothetical protein C50E10.4 - Caenorhab...    37   2.1
gi|47216277|emb|CAG05973.1| unnamed protein product [Tetraodon n...    37   2.1
gi|17569991|ref|NP_510853.1| bile lipase like (XS293) [Caenorhab...    37   2.1
gi|39579415|emb|CAE56721.1| Hypothetical protein CBG24508 [Caeno...    37   2.1
gi|17137718|ref|NP_477460.1| CG13388-PA [Drosophila melanogaster...    37   2.1
gi|21231532|ref|NP_637449.1| ribonuclease E [Xanthomonas campest...    37   2.1
gi|5702204|gb|AAD47200.1| A kinase anchor protein 200 [Drosophil...    37   2.1
gi|9937209|gb|AAG02341.1| synaptojanin 1 [Lampetra fluviatilis]        37   2.1
gi|22656364|gb|AAM97499.1| mesoderm induction early response 1 N...    37   2.1
gi|22656366|gb|AAM97500.1| mesoderm induction early response 1 N...    37   2.1
gi|30268212|emb|CAD89921.1| hypothetical protein [Homo sapiens]        37   2.1
gi|10047317|dbj|BAB13446.1| KIAA1620 protein [Homo sapiens]            37   2.1
gi|17569989|ref|NP_510854.1| carboxyl ester lipase like (XS293) ...    37   2.1
gi|50551659|ref|XP_503304.1| hypothetical protein [Yarrowia lipo...    37   2.1
gi|17569987|ref|NP_510852.1| bile lipase like (XS293) [Caenorhab...    37   2.1
gi|15234785|ref|NP_195588.1| proline-rich family protein (PRP4) ...    37   2.1
gi|19114932|ref|NP_594020.1| tat-binding homolog 7, AAA ATPase f...    37   2.1
gi|24308261|ref|NP_065999.1| mesoderm induction early response 1...    37   2.1
gi|47206179|emb|CAF93496.1| unnamed protein product [Tetraodon n...    37   2.1
gi|50555544|ref|XP_505180.1| hypothetical protein [Yarrowia lipo...    37   2.1
gi|8250181|emb|CAB93524.1| D-Titin [Drosophila melanogaster]           37   2.1
gi|33341722|gb|AAQ15232.1| PP10631 [Homo sapiens]                      37   2.7
gi|31095626|gb|AAP43681.1| C protein immunoglobin-a-binding beta...    37   2.7
gi|18029017|gb|AAL56264.1| C protein immunoglobulin-A-binding be...    37   2.7
gi|28912428|gb|AAO53312.1| serine-proline rich repeat protein [L...    37   2.7
gi|21748558|dbj|BAC03416.1| FLJ00353 protein [Homo sapiens]            37   2.7
gi|31711510|gb|AAN78098.1| PC10A [Plasmodium chabaudi chabaudi]        37   2.7
gi|18873729|gb|AAL79776.1| proline-rich protein [Saccharum hybri...    37   2.7
gi|39581822|emb|CAE60715.1| Hypothetical protein CBG04386 [Caeno...    37   2.7
gi|6753084|ref|NP_035919.1| adenomatosis polyposis coli 2 [Mus m...    37   2.7
gi|15674586|ref|NP_268760.1| putative 42 kDa protein [Streptococ...    37   2.7
gi|33384235|gb|AAN08505.1| cardiac titin isoform N2BA [Canis fam...    37   2.7
gi|16329197|ref|NP_439925.1| unknown protein [Synechocystis sp. ...    37   2.7
gi|27881703|gb|AAH44636.1| YLPM1 protein [Homo sapiens]                37   2.7
gi|18857714|emb|CAD24007.1| WIRE protein [Homo sapiens]                37   2.7
gi|18959210|ref|NP_573571.1| WIRE protein; WASP-binding protein ...    37   2.7
gi|18029015|gb|AAL56263.1| C protein immunoglobulin-A-binding be...    37   2.7
gi|37521377|ref|NP_924754.1| hypothetical protein gll1808 [Gloeo...    37   2.7
gi|39580203|emb|CAE71710.1| Hypothetical protein CBG18687 [Caeno...    37   2.7
gi|22830955|dbj|BAC15819.1| unknown protein [Oryza sativa (japon...    37   2.7
gi|49182258|gb|AAT57631.1| serine/proline-rich repeat protein [L...    37   2.7
gi|31095628|gb|AAP43682.1| C protein immunoglobin-a-binding beta...    37   2.7
gi|31095630|gb|AAP43683.1| C protein immunoglobin-a-binding beta...    37   2.7
gi|39592749|emb|CAE62363.1| Hypothetical protein CBG06447 [Caeno...    37   2.7
gi|23508177|ref|NP_700847.1| gene 11-1 protein precursor [Plasmo...    37   2.7
gi|50257963|gb|EAL20657.1| hypothetical protein CNBE0230 [Crypto...    37   2.7
gi|39935988|ref|NP_948264.1| conserved hypothetical protein [Rho...    37   2.7
gi|46432590|gb|EAK92065.1| hypothetical protein CaO19.6598 [Cand...    37   2.7
gi|1420865|emb|CAA56616.1| orf1 [Streptococcus pyogenes]               37   2.7
gi|34857159|ref|XP_227030.2| similar to CG6621-PA [Rattus norveg...    37   2.7
gi|18029021|gb|AAL56266.1| C protein immunoglobulin-A-binding be...    37   2.7
gi|6782442|gb|AAF28388.1| proline-rich protein [Arabidopsis thal...    37   2.7
gi|7620015|gb|AAF64551.1| proline-rich protein 4 [Arabidopsis th...    37   2.7
gi|39597912|emb|CAE68604.1| Hypothetical protein CBG14482 [Caeno...    37   2.7
gi|34872074|ref|XP_233556.2| similar to Ser/Arg-related nuclear ...    37   2.7
gi|39725306|emb|CAC87801.1| fibronectin-binding protein I [Strep...    36   3.6
gi|19073926|ref|NP_584532.1| hypothetical protein [Encephalitozo...    36   3.6
gi|14521982|ref|NP_127459.1| LSU ribosomal protein L10E [Pyrococ...    36   3.6
gi|13508186|ref|NP_110135.1| cytadherence accessory protein HMW1...    36   3.6
gi|39725304|emb|CAC87800.1| fibronectin-binding protein I [Strep...    36   3.6
gi|39725308|emb|CAC87802.1| fibronectin-binding protein I [Strep...    36   3.6
gi|42733943|gb|AAS38848.1| similar to Dictyostelium discoideum (...    36   3.6
gi|47221251|emb|CAG13187.1| unnamed protein product [Tetraodon n...    36   3.6
gi|48862277|ref|ZP_00316174.1| COG3979: Uncharacterized protein ...    36   3.6
gi|41147802|ref|XP_374432.1| similar to KIAA0363 [Homo sapiens]        36   3.6
gi|50258652|gb|EAL21337.1| hypothetical protein CNBD0340 [Crypto...    36   3.6
gi|32417626|ref|XP_329291.1| predicted protein [Neurospora crass...    36   3.6
gi|48716906|dbj|BAD23601.1| hypothetical protein [Oryza sativa (...    36   3.6
gi|14165456|ref|NP_114399.1| microtubule-associated protein 1B i...    36   3.6
gi|46124997|ref|XP_387052.1| hypothetical protein FG06876.1 [Gib...    36   3.6
gi|4138732|emb|CAA76742.1| proline-rich protein [Zea mays] >gnl|...    36   3.6
gi|39583307|emb|CAE60099.1| Hypothetical protein CBG03627 [Caeno...    36   3.6
gi|39725302|emb|CAC87799.1| fibronectin-binding protein I [Strep...    36   3.6
gi|23452358|gb|AAN33008.1| proline-rich beta protein [Streptococ...    36   3.6
gi|41281542|ref|NP_055715.2| COBL-like 1 [Homo sapiens] >gnl|BL_...    36   3.6
gi|3204406|emb|CAA75462.1| E4 protein [Human papillomavirus type...    36   3.6
gi|47230306|emb|CAG10720.1| unnamed protein product [Tetraodon n...    36   3.6
gi|31542192|ref|NP_659190.2| cDNA sequence BC019977 [Mus musculu...    36   3.6
gi|22830951|dbj|BAC15815.1| unknown protein [Oryza sativa (japon...    36   3.6
gi|49085766|ref|XP_404979.1| hypothetical protein AN0842.2 [Aspe...    36   3.6
gi|46201805|ref|ZP_00054305.2| COG2114: Adenylate cyclase, famil...    36   3.6
gi|46402167|ref|NP_997086.1| hypothetical protein LOC73072 [Mus ...    36   3.6
gi|50255602|gb|EAL18335.1| hypothetical protein CNBJ2580 [Crypto...    36   3.6
gi|12697907|dbj|BAB21772.1| KIAA1681 protein [Homo sapiens]            36   3.6
gi|3005587|gb|AAC09321.1| Ser/Arg-related nuclear matrix protein...    36   3.6
gi|42565109|ref|NP_188851.2| protease inhibitor/seed storage/lip...    36   3.6
gi|49092248|ref|XP_407585.1| hypothetical protein AN3448.2 [Aspe...    36   3.6
gi|47221824|emb|CAG08878.1| unnamed protein product [Tetraodon n...    36   3.6
gi|32409825|ref|XP_325393.1| predicted protein [Neurospora crass...    36   3.6
gi|39596301|emb|CAE69939.1| Hypothetical protein CBG16321 [Caeno...    36   3.6
gi|38100429|gb|EAA47559.1| hypothetical protein MG02802.4 [Magna...    36   3.6
gi|23274133|gb|AAH36187.1| Serine/arginine repetitive matrix 1 [...    36   3.6
gi|42542379|ref|NP_005830.2| serine/arginine repetitive matrix 1...    36   3.6
gi|31240573|ref|XP_320700.1| ENSANGP00000020036 [Anopheles gambi...    36   3.6
gi|49094616|ref|XP_408769.1| hypothetical protein AN4632.2 [Aspe...    36   3.6
gi|23613443|ref|NP_703287.1| hypothetical protein [Plasmodium fa...    36   3.6
gi|5174525|ref|NP_005900.1| microtubule-associated protein 1B is...    36   3.6
gi|32419006|ref|XP_329981.1| hypothetical protein [Neurospora cr...    36   3.6
gi|37515402|emb|CAE48361.1| RAPH1 protein [Homo sapiens]               36   3.6
gi|47132519|ref|NP_998754.1| Ras association and pleckstrin homo...    36   3.6
gi|24580667|ref|NP_608532.1| CG11835-PA [Drosophila melanogaster...    36   4.7
gi|50121977|ref|YP_051144.1| putative membrane protein [Erwinia ...    36   4.7
gi|34365161|emb|CAE45928.1| hypothetical protein [Homo sapiens]        36   4.7
gi|19112374|ref|NP_595582.1| putative COPII coat component; WD r...    36   4.7
gi|50258505|gb|EAL21192.1| hypothetical protein CNBD2490 [Crypto...    36   4.7
gi|23490720|gb|EAA22430.1| Papain family cysteine protease, puta...    36   4.7
gi|33878979|gb|AAH17240.1| MAP1B protein [Homo sapiens]                36   4.7
gi|23452351|gb|AAN33005.1| proline-rich beta protein [Streptococ...    36   4.7
gi|100798|pir||S14959 proline-rich protein - wheat >gnl|BL_ORD_I...    36   4.7
gi|18029019|gb|AAL56265.1| C protein immunoglobulin-A-binding be...    36   4.7
gi|50746857|ref|XP_426314.1| PREDICTED: similar to RIKEN cDNA 57...    36   4.7
gi|33863396|ref|NP_894956.1| Proline-rich region [Prochlorococcu...    36   4.7
gi|31540577|gb|AAP48996.1| cellulosomal scaffoldin anchoring pro...    36   4.7
gi|46135725|ref|XP_389554.1| hypothetical protein FG09378.1 [Gib...    36   4.7
gi|38373695|ref|NP_003378.3| WASP-interacting protein [Homo sapi...    36   4.7
gi|5668598|gb|AAD45972.1| Wiskott-Aldrich syndrome protein inter...    36   4.7
gi|47940683|gb|AAH72400.1| THOC2 protein [Homo sapiens]                36   4.7
gi|33592641|ref|NP_880285.1| DNA polymerase III subunit Tau [Bor...    36   4.7
gi|14591733|ref|NP_143821.1| acidic ribosomal protein P0 (L10E) ...    36   4.7
gi|47221238|emb|CAG13174.1| unnamed protein product [Tetraodon n...    36   4.7
gi|46109930|ref|XP_382023.1| hypothetical protein FG01847.1 [Gib...    36   4.7
gi|1170600|sp|P43393|K501_ACTCH FRUIT PROTEIN PKIWI501 >gnl|BL_O...    36   4.7
gi|41702296|sp|Q8NI27|THO2_HUMAN THO complex subunit 2 (Tho2) >g...    36   4.7
gi|37546516|ref|XP_047325.4| Tho2 [Homo sapiens]                       36   4.7
gi|46108868|ref|XP_381492.1| hypothetical protein FG01316.1 [Gib...    36   4.7
gi|24762494|ref|NP_726397.1| CG30175-PA [Drosophila melanogaster...    36   4.7
gi|27806347|ref|NP_776644.1| Wiskott-Aldrich syndrome-like [Bos ...    36   4.7
gi|46121098|ref|ZP_00173968.2| COG0810: Periplasmic protein TonB...    36   4.7
gi|46124561|ref|XP_386834.1| hypothetical protein FG06658.1 [Gib...    36   4.7
gi|24639766|ref|NP_572189.1| CG2861-PA [Drosophila melanogaster]...    36   4.7
gi|21392064|gb|AAM48386.1| RE03056p [Drosophila melanogaster]          36   4.7
gi|24653690|ref|NP_725409.1| CG30480-PA [Drosophila melanogaster...    36   4.7
gi|50312195|ref|XP_456129.1| unnamed protein product [Kluyveromy...    36   4.7
gi|46109998|ref|XP_382057.1| hypothetical protein FG01881.1 [Gib...    36   4.7
gi|39580550|emb|CAE74682.1| Hypothetical protein CBG22492 [Caeno...    36   4.7
gi|23468642|ref|ZP_00123977.1| COG0810: Periplasmic protein TonB...    36   4.7
gi|34853415|ref|XP_215432.2| similar to WASP family 1 [Rattus no...    36   4.7
gi|20087058|ref|NP_613266.1| polyprotein [Cryphonectria hypoviru...    36   4.7
gi|24639768|ref|NP_726958.1| CG2861-PB [Drosophila melanogaster]...    36   4.7
gi|46123589|ref|XP_386348.1| hypothetical protein FG06172.1 [Gib...    36   4.7
gi|50554669|ref|XP_504743.1| hypothetical protein [Yarrowia lipo...    36   4.7
gi|34873637|ref|XP_340896.1| similar to WIRE protein; WASP-bindi...    36   4.7
gi|30984464|ref|NP_851896.1| very large tegument protein [Cercop...    36   4.7
gi|46444861|gb|EAL04133.1| hypothetical protein CaO19.12113 [Can...    36   4.7
gi|39594263|emb|CAE71841.1| Hypothetical protein CBG18883 [Caeno...    35   6.1
gi|19553263|ref|NP_601265.1| signal recognition particle GTPase ...    35   6.1
gi|23346579|ref|NP_694778.1| Wiskott-Aldrich syndrome protein in...    35   6.1
gi|38347210|emb|CAE02280.2| OSJNBa0055C08.4 [Oryza sativa (japon...    35   6.1
gi|34862191|ref|XP_222315.2| similar to TTF-I interacting protei...    35   6.1
gi|100617|pir||S18350 seed storage protein - barley >gnl|BL_ORD_...    35   6.1
gi|7959311|dbj|BAA96046.1| KIAA1522 protein [Homo sapiens]             35   6.1
gi|47938120|gb|AAH71588.1| COBLL1 protein [Homo sapiens]               35   6.1
gi|1575515|gb|AAC47461.1| thrombospondin-related anonymous prote...    35   6.1
gi|25295719|pir||T51932 kinesin [imported] - Haematonectria haem...    35   6.1
gi|14253159|emb|CAC39318.1| VMP3 protein [Volvox carteri f. naga...    35   6.1
gi|21324832|dbj|BAB99455.1| Signal recognition particle GTPase [...    35   6.1
gi|37547942|ref|XP_036299.7| KIAA1522 protein [Homo sapiens]           35   6.1
gi|23478426|gb|EAA15516.1| hypothetical protein [Plasmodium yoel...    35   6.1
gi|38233597|ref|NP_939364.1| 2-oxoglutarate dehydrogenase, E1 an...    35   6.1
gi|24654777|ref|NP_612038.2| CG17090-PA [Drosophila melanogaster...    35   6.1
gi|31414574|dbj|BAC58076.2| large tegument protein [Cercopitheci...    35   6.1
gi|13309811|gb|AAK18045.1| mucoperlin mucin-like nacre protein [...    35   6.1
gi|18028985|gb|AAL56248.1| C protein immunoglobulin-A-binding be...    35   6.1
gi|79934|pir||A60234 IgA Fc receptor precursor - Streptococcus a...    35   6.1
gi|46229311|gb|EAK90160.1| hypothetical protein cgd6_3940 [Crypt...    35   6.1
gi|33594402|ref|NP_882046.1| siderophore-mediated iron transport...    35   6.1
gi|50547475|ref|XP_501207.1| hypothetical protein [Yarrowia lipo...    35   6.1
gi|16329644|ref|NP_440372.1| unknown protein [Synechocystis sp. ...    35   6.1
gi|27817830|dbj|BAC55524.2| connectin/titin N2A-PEVK [Mus musculus]    35   6.1
gi|29367369|gb|AAO72557.1| proline-rich protein [Oryza sativa (j...    35   6.1
gi|34853610|ref|XP_216034.2| similar to Cip1-interacting zinc fi...    35   6.1
gi|4559298|gb|AAD22973.1| silencing mediator of retinoic acid an...    35   6.1
gi|11096143|gb|AAG30211.1| collagen-like surface protein [Strept...    35   6.1
gi|15226640|ref|NP_179188.1| leucine-rich repeat family protein ...    35   6.1
gi|24653946|ref|NP_725497.1| CG30085-PA [Drosophila melanogaster...    35   6.1
gi|19072840|gb|AAL82540.1| EP-repeat protein precursor [Glossina...    35   6.1
gi|50804055|ref|XP_424297.1| PREDICTED: similar to Hypothetical ...    35   6.1
gi|21749331|dbj|BAC03574.1| unnamed protein product [Homo sapiens]     35   6.1
gi|32406010|ref|XP_323618.1| hypothetical protein [Neurospora cr...    35   6.1
gi|32398970|emb|CAD98435.1| hydroxyproline-rich glycoprotein dz-...    35   6.1
gi|31095612|gb|AAP43674.1| C protein immunoglobin-a-binding beta...    35   6.1
gi|47087423|ref|NP_998607.1| zgc:63802 [Danio rerio] >gnl|BL_ORD...    35   6.1
gi|37572662|dbj|BAC98831.1| c protein beta antigen [Streptococcu...    35   6.1
gi|21360802|gb|AAM49715.1| hepatoma-derived growth factor HGDF5 ...    35   6.1
gi|39596604|emb|CAE63223.1| Hypothetical protein CBG07583 [Caeno...    35   6.1
gi|46191677|ref|ZP_00206932.1| hypothetical protein Rsph024189 [...    35   6.1
gi|50511025|dbj|BAD32498.1| mKIAA1620 protein [Mus musculus]           35   6.1
gi|40789007|dbj|BAA76821.2| KIAA0977 protein [Homo sapiens]            35   6.1
gi|45768352|gb|AAH68135.1| Prx protein [Mus musculus]                  35   6.1
gi|32407228|ref|XP_324200.1| predicted protein [Neurospora crass...    35   6.1
gi|16126412|ref|NP_420976.1| lysozyme family protein [Caulobacte...    35   6.1
gi|28278199|gb|AAH46114.1| MAP1B protein [Homo sapiens]                35   6.1
gi|30022968|ref|NP_834599.1| Cell surface protein [Bacillus cere...    35   6.1
gi|7512716|pir||T08673 hypothetical protein DKFZp564C0222.1 - hu...    35   6.1
gi|27819930|gb|AAL39732.2| LD33388p [Drosophila melanogaster]          35   6.1
gi|47209818|emb|CAF92632.1| unnamed protein product [Tetraodon n...    35   6.1
gi|15889177|ref|NP_354858.1| AGR_C_3445p [Agrobacterium tumefaci...    35   6.1
gi|46227572|gb|EAK88507.1| hypothetical protein, proline rich C-...    35   7.9
gi|34367817|emb|CAE46196.1| hypothetical protein [Homo sapiens]        35   7.9
gi|49257878|gb|AAH74429.1| Unknown (protein for MGC:84671) [Xeno...    35   7.9
gi|22971330|ref|ZP_00018299.1| hypothetical protein [Chloroflexu...    35   7.9
gi|22299765|ref|NP_683012.1| serine/threonine protein kinase [Th...    35   7.9
gi|45524317|ref|ZP_00175609.1| COG0515: Serine/threonine protein...    35   7.9
gi|1045237|emb|CAA63225.1| BNI1 [Saccharomyces cerevisiae] >gnl|...    35   7.9
gi|21040322|ref|NP_620304.1| SON DNA-binding protein isoform C; ...    35   7.9
gi|6578849|gb|AAF18101.1| FrgA [Myxococcus xanthus]                    35   7.9
gi|39593400|emb|CAE64870.1| Hypothetical protein CBG09670 [Caeno...    35   7.9


>gi|17544294|ref|NP_502871.1| ELM2 domain containing protein (87.7 kD)
            (4Q316) [Caenorhabditis elegans]
 gi|7509242|pir||T31558 hypothetical protein Y105C5A.a -
            Caenorhabditis elegans
 gi|5832756|emb|CAB54981.1| Hypothetical protein Y105C5A.1
            [Caenorhabditis elegans]
          Length = 767

 Score = 1414 bits (3659), Expect = 0.0
 Identities = 706/767 (92%), Positives = 706/767 (92%)
 Frame = -1

Query: 2304 MSQLMNAHDRRNEPAPNAPPEFQLQNRTRPAPTPIEYITLSSDDEIEVIPPPPKRAKMME 2125
            MSQLMNAHDRRNEPAPNAPPEFQLQNRTRPAPTPIEYITLSSDDEIEVIPPPPKRAKMME
Sbjct: 1    MSQLMNAHDRRNEPAPNAPPEFQLQNRTRPAPTPIEYITLSSDDEIEVIPPPPKRAKMME 60

Query: 2124 EQKPKDLLENPQLPEVPSSSASFVIPQIVVDNEEVPEDPRMKTPSPIQGASVAMPVRARI 1945
            EQKPKDLLENPQLPEVPSSSASFVIPQIVVDNEEVPEDPRMKTPSPIQGASVAMPVRARI
Sbjct: 61   EQKPKDLLENPQLPEVPSSSASFVIPQIVVDNEEVPEDPRMKTPSPIQGASVAMPVRARI 120

Query: 1944 QESPKVSRDPTPLSRASSVVIPEVPAVSEPEPLPVEVLAIXXXXXXXXXXXXXXXXXXXX 1765
            QESPKVSRDPTPLSRASSVVIPEVPAVSEPEPLPVEVLAI
Sbjct: 121  QESPKVSRDPTPLSRASSVVIPEVPAVSEPEPLPVEVLAISIPTTSPDTAPSTSSSVETV 180

Query: 1764 XXXXXXXXXXXXXXXSDAPARSPLKKKVANSVKPVVLPSRKSTRNKKDMNQIKEDEELVS 1585
                           SDAPARSPLKKKVANSVKPVVLPSRKSTRNKKDMNQIKEDEELVS
Sbjct: 181  ESVTEVVAISSAEASSDAPARSPLKKKVANSVKPVVLPSRKSTRNKKDMNQIKEDEELVS 240

Query: 1584 NFNNGIGVISRGTIVPRGLSRTPFHFKKEATDDKAGKVKDMLKIDMQPVFTPAGHSSKDL 1405
            NFNNGIGVISRGTIVPRGLSRTPFHFKKEATDDKAGKVKDMLKIDMQPVFTPAGHSSKDL
Sbjct: 241  NFNNGIGVISRGTIVPRGLSRTPFHFKKEATDDKAGKVKDMLKIDMQPVFTPAGHSSKDL 300

Query: 1404 IKRKARNSLEPSTSDADISFMKNERGKIRTGEKFQATIPDIEPSSTLTEYMDQEDKEEIF 1225
            IKRKARNSLEPSTSDADISFMKNERGKIRTGEKFQATIPDIEPSSTLTEYMDQEDKEEIF
Sbjct: 301  IKRKARNSLEPSTSDADISFMKNERGKIRTGEKFQATIPDIEPSSTLTEYMDQEDKEEIF 360

Query: 1224 WETLDMDKDNLEESKKFHETLRNVYWRAIWRQFQGHIPFETALQHLMKNNLDFAQSLETI 1045
            WETLDMDKDNLEESKKFHETLRNVYWRAIWRQFQGHIPFETALQHLMKNNLDFAQSLETI
Sbjct: 361  WETLDMDKDNLEESKKFHETLRNVYWRAIWRQFQGHIPFETALQHLMKNNLDFAQSLETI 420

Query: 1044 DENLKSLPQSFKEPCVAQVKIFDKLLQDKKTTRRQLQEKAMRNYHIAEVQQYHYRFRKFF 865
            DENLKSLPQSFKEPCVAQVKIFDKLLQDKKTTRRQLQEKAMRNYHIAEVQQYHYRFRKFF
Sbjct: 421  DENLKSLPQSFKEPCVAQVKIFDKLLQDKKTTRRQLQEKAMRNYHIAEVQQYHYRFRKFF 480

Query: 864  KYQEKYGVVCNCAEKLCNNLKFEPRYGCTNCKKNVKSSSDHGATEKLCLICQTYQKLTGN 685
            KYQEKYGVVCNCAEKLCNNLKFEPRYGCTNCKKNVKSSSDHGATEKLCLICQTYQKLTGN
Sbjct: 481  KYQEKYGVVCNCAEKLCNNLKFEPRYGCTNCKKNVKSSSDHGATEKLCLICQTYQKLTGN 540

Query: 684  VRPARNVEFCDDELEKIYHWSQKEEDLNRTLSRXXXXXXXXXEKNKKWKNNDLSAEETAM 505
            VRPARNVEFCDDELEKIYHWSQKEEDLNRTLSR         EKNKKWKNNDLSAEETAM
Sbjct: 541  VRPARNVEFCDDELEKIYHWSQKEEDLNRTLSREEFEELVREEKNKKWKNNDLSAEETAM 600

Query: 504  LNQKELRIPNRRHRTHLSDQEKQARGEKICAQLQPYVLPHFSKCNCKRMGRSSWRCETEG 325
            LNQKELRIPNRRHRTHLSDQEKQARGEKICAQLQPYVLPHFSKCNCKRMGRSSWRCETEG
Sbjct: 601  LNQKELRIPNRRHRTHLSDQEKQARGEKICAQLQPYVLPHFSKCNCKRMGRSSWRCETEG 660

Query: 324  KSSFSIQERKDYFREVRDCKGDLQQVARNLKVAPEVVRAFINIYGIEYDLEIYFPNKKLP 145
            KSSFSIQERKDYFREVRDCKGDLQQVARNLKVAPEVVRAFINIYGIEYDLEIYFPNKKLP
Sbjct: 661  KSSFSIQERKDYFREVRDCKGDLQQVARNLKVAPEVVRAFINIYGIEYDLEIYFPNKKLP 720

Query: 144  NLIPIVYDIPPSNLXXXXXXXXXXXXXXXXXPYIPPEERSPKKRRSN 4
            NLIPIVYDIPPSNL                 PYIPPEERSPKKRRSN
Sbjct: 721  NLIPIVYDIPPSNLPPIIPDGSSNSSSRDGSPYIPPEERSPKKRRSN 767




[DB home][top]