Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y106G6H_3
(342 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508679|ref|NP_492728.1| ribosomal Protein, Large subunit (r... 225 1e-58
gi|39580771|emb|CAE58940.1| Hypothetical protein CBG02208 [Caeno... 190 7e-48
gi|22758848|gb|AAN05584.1| ribosomal protein L30 [Argopecten irr... 187 4e-47
gi|49903584|gb|AAH77047.1| Unknown (protein for MGC:89963) [Xeno... 171 4e-42
gi|32450032|gb|AAH53758.1| Rpl30-prov protein [Xenopus laevis] 171 4e-42
gi|49256154|gb|AAH73560.1| Unknown (protein for MGC:82844) [Xeno... 171 4e-42
gi|17368248|sp|P58375|RL30_SPOFR 60S ribosomal protein L30 >gnl|... 170 6e-42
gi|50773045|ref|XP_423181.1| PREDICTED: similar to ribosomal pro... 170 7e-42
gi|4506631|ref|NP_000980.1| ribosomal protein L30; 60S ribosomal... 169 1e-41
gi|48099024|ref|XP_394854.1| similar to ribosomal protein L30 [A... 169 1e-41
gi|17368245|sp|P58374|RL30_BRABE 60S ribosomal protein L30 >gnl|... 168 2e-41
gi|31202857|ref|XP_310377.1| ENSANGP00000018909 [Anopheles gambi... 168 2e-41
gi|38086560|ref|XP_358225.1| similar to ribosomal protein L30 [M... 168 3e-41
gi|47205466|emb|CAF96057.1| unnamed protein product [Tetraodon n... 165 2e-40
gi|41053331|ref|NP_956322.1| Unknown (protein for MGC:77683); ri... 165 2e-40
gi|17368239|sp|P58372|RL30_ICTPU 60S ribosomal protein L30 >gnl|... 164 4e-40
gi|17369182|sp|Q9M5M6|RL30_EUPES 60S ribosomal protein L30 >gnl|... 161 3e-39
gi|47205730|emb|CAF90854.1| unnamed protein product [Tetraodon n... 160 4e-39
gi|6094048|sp|O49884|RL30_LUPLU 60S RIBOSOMAL PROTEIN L30 >gnl|B... 159 2e-38
gi|38090525|ref|XP_194724.2| similar to ribosomal protein L30 [M... 157 4e-38
gi|34881033|ref|XP_344179.1| similar to ribosomal protein L30 [R... 157 4e-38
gi|38048445|gb|AAR10125.1| similar to Drosophila melanogaster CG... 155 2e-37
gi|34878329|ref|XP_346102.1| similar to ribosomal protein L30 [R... 155 2e-37
gi|17864264|ref|NP_524687.1| CG10652-PA [Drosophila melanogaster... 154 4e-37
gi|21392200|gb|AAM48454.1| RH09938p [Drosophila melanogaster] 154 5e-37
gi|50080301|gb|AAT69635.1| putative 60S ribosomal protein L30 [O... 153 7e-37
gi|6094049|sp|O48558|RL30_MAIZE 60S RIBOSOMAL PROTEIN L30 >gnl|B... 153 9e-37
gi|34855533|ref|XP_345192.1| similar to ribosomal protein L30 [R... 152 2e-36
gi|18411753|ref|NP_565164.1| 60S ribosomal protein L30 (RPL30B) ... 152 2e-36
gi|33772495|gb|AAQ54649.1| 60S ribosomal protein L30 [Oikopleura... 151 3e-36
gi|15220372|ref|NP_174853.1| 60S ribosomal protein L30 (RPL30A) ... 150 5e-36
gi|34909198|ref|NP_915946.1| putative 60S ribosomal protein L30 ... 150 6e-36
gi|34903260|ref|NP_912977.1| unnamed protein product [Oryza sati... 150 6e-36
gi|49097518|ref|XP_410219.1| conserved hypothetical protein [Asp... 148 2e-35
gi|38079882|ref|XP_193832.2| similar to ribosomal protein L30 [M... 148 3e-35
gi|38105067|gb|EAA51540.1| hypothetical protein MG03135.4 [Magna... 148 3e-35
gi|19115769|ref|NP_594857.1| 60s ribosomal protein l30 [Schizosa... 148 3e-35
gi|15230183|ref|NP_188504.1| 60S ribosomal protein L30 (RPL30C) ... 147 4e-35
gi|19114470|ref|NP_593558.1| 60s ribosomal protein L30/L30A [Sch... 147 7e-35
gi|14269409|gb|AAK58056.1| ribosomal protein L30-like protein [O... 145 2e-34
gi|38079864|ref|XP_356878.1| similar to ribosomal protein L30 [M... 145 3e-34
gi|34853635|ref|XP_217835.2| similar to ribosomal protein L30 [R... 145 3e-34
gi|38050361|ref|XP_357112.1| similar to ribosomal protein L30 [M... 143 7e-34
gi|38086074|ref|XP_358193.1| similar to ribosomal protein L30 [M... 143 1e-33
gi|32421823|ref|XP_331355.1| hypothetical protein [Neurospora cr... 141 3e-33
gi|50553808|ref|XP_504315.1| hypothetical protein [Yarrowia lipo... 139 1e-32
gi|50260912|gb|EAL23562.1| hypothetical protein CNBA2090 [Crypto... 139 2e-32
gi|50423429|ref|XP_460297.1| unnamed protein product [Debaryomyc... 138 3e-32
gi|50802274|ref|XP_428593.1| PREDICTED: similar to ribosomal pro... 137 7e-32
gi|32400991|gb|AAP80701.1| ribosome protein L30 [Griffithsia jap... 137 7e-32
gi|45198996|ref|NP_986025.1| AFR478Wp [Eremothecium gossypii] >g... 135 2e-31
gi|6573778|gb|AAF17698.1| F28K19.15 [Arabidopsis thaliana] 135 3e-31
gi|49077074|ref|XP_402443.1| hypothetical protein UM04828.1 [Ust... 134 4e-31
gi|1350718|sp|P49153|RL30_TRYBB 60S RIBOSOMAL PROTEIN L30 >gnl|B... 134 6e-31
gi|50308869|ref|XP_454439.1| unnamed protein product [Kluyveromy... 134 6e-31
gi|46228341|gb|EAK89240.1| 60S ribosomal protein L30, pelota RNA... 134 6e-31
gi|34876783|ref|XP_344226.1| similar to ribosomal protein L30 [R... 132 1e-30
gi|730555|sp|P39095|RL30_LEIMA 60S RIBOSOMAL PROTEIN L30 >gnl|BL... 131 3e-30
gi|50284809|ref|XP_444832.1| unnamed protein product [Candida gl... 128 3e-29
gi|6321408|ref|NP_011485.1| Protein component of the large (60S)... 128 3e-29
gi|6435677|pdb|1CK2|A Chain A, Yeast (Saccharomyces Cerevisiae) ... 128 3e-29
gi|23480711|gb|EAA17197.1| 60S ribosomal protein L30 [Plasmodium... 126 1e-28
gi|23507991|ref|NP_700661.1| ribosomal protein L30e, putative [P... 123 8e-28
gi|37729521|gb|AAO47715.1| putative 60S ribosomal protein L30 [P... 121 3e-27
gi|13812291|ref|NP_113409.1| 60S ribosomal protein L30 [Guillard... 104 4e-22
gi|34879282|ref|XP_341608.1| similar to serine protease inhibito... 101 4e-21
gi|34856877|ref|XP_345380.1| similar to ribosomal protein L30 [R... 97 1e-19
gi|46137459|ref|XP_390421.1| hypothetical protein FG10245.1 [Gib... 94 9e-19
gi|29245741|gb|EAA37364.1| GLP_24_9208_8879 [Giardia lamblia ATC... 89 2e-17
gi|2275330|gb|AAB63890.1| 60S ribosomal protein L30 homolog [Sch... 85 4e-16
gi|20094121|ref|NP_613968.1| Ribosomal protein L30E [Methanopyru... 83 1e-15
gi|15679066|ref|NP_276183.1| ribosomal protein L30 [Methanotherm... 82 3e-15
gi|18312088|ref|NP_558755.1| ribosomal protein L30 [Pyrobaculum ... 80 8e-15
gi|38080297|ref|XP_358932.1| similar to ribosomal protein L30 [M... 79 2e-14
gi|14601672|ref|NP_148213.1| 50S ribosomal protein L30 [Aeropyru... 79 3e-14
gi|47122758|gb|AAH69949.1| Unknown (protein for MGC:78257) [Mus ... 76 2e-13
gi|18977933|ref|NP_579290.1| LSU ribosomal protein L30E [Pyrococ... 75 2e-13
gi|14591326|ref|NP_143404.1| 50S ribosomal protein L30 [Pyrococc... 74 5e-13
gi|15920463|ref|NP_376132.1| 106aa long hypothetical 50S ribosom... 74 7e-13
gi|14520833|ref|NP_126308.1| LSU ribosomal protein L30E [Pyrococ... 74 9e-13
gi|34851853|ref|XP_226546.2| similar to Galns protein [Rattus no... 73 1e-12
gi|132947|sp|P14025|RL3E_METVA 50S ribosomal protein L30e >gnl|B... 72 3e-12
gi|15669233|ref|NP_248038.1| LSU ribosomal protein L30E [Methano... 72 4e-12
gi|19173689|ref|NP_597492.1| 60S RIBOSOMAL PROTEIN L30 [Encephal... 71 6e-12
gi|45358928|ref|NP_988485.1| Ribosomal protein L30E [Methanococc... 71 6e-12
gi|30749253|pdb|1H7M|A Chain A, Ribosomal Protein L30e From Ther... 70 1e-11
gi|33356934|pdb|1GO0|A Chain A, Nmr Structure Of Ribosomal Prote... 70 1e-11
gi|41719520|ref|ZP_00148406.1| COG1911: Ribosomal protein L30E [... 70 1e-11
gi|132877|sp|P29160|RL3E_THECE 50S ribosomal protein L30e >gnl|B... 70 1e-11
gi|15897169|ref|NP_341774.1| LSU ribosomal protein L30E (rpl30E)... 70 1e-11
gi|21228371|ref|NP_634293.1| LSU ribosomal protein L30E [Methano... 69 2e-11
gi|11499474|ref|NP_070715.1| LSU ribosomal protein L30E (rpl30E)... 69 2e-11
gi|20090125|ref|NP_616200.1| ribosomal protein L30e [Methanosarc... 69 3e-11
gi|48840815|ref|ZP_00297741.1| COG1911: Ribosomal protein L30E [... 67 7e-11
gi|141382|sp|P11522|RL3E_SULAC 50S ribosomal protein L30e >gnl|B... 63 2e-09
gi|17557045|ref|NP_498693.1| putative membrane protein (3I863) [... 62 4e-09
gi|20822981|ref|XP_144762.1| similar to ribosomal protein L30 [M... 60 1e-08
gi|41614974|ref|NP_963472.1| NEQ179 [Nanoarchaeum equitans Kin4-... 50 1e-05
gi|41615108|ref|NP_963606.1| NEQ319 [Nanoarchaeum equitans Kin4-... 44 0.001
gi|15900467|ref|NP_345071.1| ribosomal protein L7A family [Strep... 43 0.001
gi|37999936|sp|P34667|YO11_CAEEL Hypothetical protein ZK686.1 in... 42 0.004
gi|34878279|ref|XP_346095.1| similar to ribosomal protein L30 [R... 40 0.009
gi|15902524|ref|NP_358074.1| Conserved hypothetical protein [Str... 40 0.015
gi|48838183|ref|ZP_00295130.1| COG1358: Ribosomal protein HS6-ty... 40 0.015
gi|13432097|sp|P55858|RL7A_SULSO 50S ribosomal protein L7Ae 39 0.033
gi|15897054|ref|NP_341659.1| LSU ribosomal protein L7AE (rpl7AE)... 39 0.033
gi|21228569|ref|NP_634491.1| LSU ribosomal protein L7AE [Methano... 38 0.043
gi|20090380|ref|NP_616455.1| ribosomal protein L7ae [Methanosarc... 38 0.057
gi|15678283|ref|NP_275398.1| ribosomal protein L7a [Methanotherm... 38 0.057
gi|13432215|sp|O26355|RL7A_METTH 50S ribosomal protein L7Ae 38 0.057
gi|32400812|gb|AAP80638.1| ribosomal protein L30 [Triticum aesti... 37 0.097
gi|14601646|ref|NP_148187.1| 30S ribosomal protein HS6 [Aeropyru... 37 0.13
gi|22536563|ref|NP_687414.1| ribosomal protein L7A family [Strep... 36 0.17
gi|49483431|ref|YP_040655.1| putative ribosomal protein [Staphyl... 36 0.17
gi|15924258|ref|NP_371792.1| hypothetical protein SAV1268 [Staph... 36 0.17
gi|29375842|ref|NP_814996.1| ribosomal protein L7A family [Enter... 36 0.17
gi|45531256|ref|ZP_00182316.1| COG1358: Ribosomal protein HS6-ty... 35 0.28
gi|14520882|ref|NP_126357.1| LSU ribosomal protein L7AE [Pyrococ... 35 0.28
gi|48429095|sp|P62008|RL7A_PYRAB 50S ribosomal protein L7Ae >gnl... 35 0.28
gi|18977739|ref|NP_579096.1| LSU ribosomal protein L7AE [Pyrococ... 35 0.28
gi|14591282|ref|NP_143360.1| 50S ribosomal protein L7 [Pyrococcu... 35 0.28
gi|50513475|pdb|1S72|F Chain F, Refined Crystal Structure Of The... 34 0.82
gi|2500349|sp|P55768|YLXQ_ENTFC Probable ribosomal protein in in... 33 1.1
gi|16800429|ref|NP_470697.1| conserved hypothetical protein, sim... 33 1.1
gi|46142352|ref|ZP_00149022.2| COG1358: Ribosomal protein HS6-ty... 33 1.4
gi|13242409|ref|NP_077432.1| host shutoff virion protein [Cercop... 33 1.4
gi|48478352|ref|YP_024058.1| small subunit ribosomal protein L7A... 33 1.8
gi|18314009|ref|NP_560676.1| ribosomal protein L7 [Pyrobaculum a... 33 1.8
gi|15614977|ref|NP_243280.1| BH2414~unknown conserved protein [B... 33 1.8
gi|2129247|pir||B64450 ribosomal protein HS6-type - Methanococcu... 32 2.4
gi|15612691|ref|NP_240994.1| ribosomal protein L7AE family [Baci... 32 2.4
gi|15669389|ref|NP_248198.1| LSU ribosomal protein L7AE [Methano... 32 2.4
gi|5832547|dbj|BAA84006.1| tegument protein [Human herpesvirus 1] 32 3.1
gi|9629422|ref|NP_044643.1| tegument protein; host shut-off fact... 32 3.1
gi|1483517|emb|CAA96525.1| virion host shutoff protein [Human he... 32 3.1
gi|1304316|emb|CAA96524.1| viron host shutoff protein [Human her... 32 3.1
gi|9629311|ref|NP_044511.1| tegument protein; host shut-off fact... 32 3.1
gi|2267334|gb|AAC58447.1| virion host shutoff protein [human her... 32 3.1
gi|15186726|dbj|BAB62886.1| ybxF protein [Clostridium perfringens] 32 3.1
gi|18311393|ref|NP_563327.1| ribosomal protein L7AE family [Clos... 32 3.1
gi|18266814|sp|P12743|RL7A_HALMA 50S ribosomal protein L7Ae (Hs6) 32 4.1
gi|28172417|emb|CAD22592.1| gp120 [Human immunodeficiency virus 1] 32 4.1
gi|10120924|pdb|1FFK|E Chain E, Crystal Structure Of The Large R... 32 4.1
gi|48869690|ref|ZP_00322435.1| COG1358: Ribosomal protein HS6-ty... 31 5.3
gi|16082138|ref|NP_394575.1| probable 50S ribosomal protein L7 [... 31 5.3
gi|22001981|sp|Q9EV99|RXL7_BACST Putative ribosomal protein L7Ae... 31 6.9
gi|50252472|dbj|BAD28650.1| putative CBL-interacting protein kin... 31 6.9
gi|6671495|ref|NP_031404.1| ATP-binding cassette, sub-family A, ... 30 9.1
>gi|17508679|ref|NP_492728.1| ribosomal Protein, Large subunit
(rpl-30) [Caenorhabditis elegans]
gi|7509319|pir||T26428 hypothetical protein Y106G6H.3 -
Caenorhabditis elegans
gi|3880682|emb|CAA21573.1| Hypothetical protein Y106G6H.3
[Caenorhabditis elegans]
Length = 113
Score = 225 bits (574), Expect = 1e-58
Identities = 113/113 (100%), Positives = 113/113 (100%)
Frame = +1
Query: 1 MAPAAKPQKNAENINSRLSMVMKTGQYVLGYKQTLKSLLNGKAKLVIIANNTPPLRKSEI 180
MAPAAKPQKNAENINSRLSMVMKTGQYVLGYKQTLKSLLNGKAKLVIIANNTPPLRKSEI
Sbjct: 1 MAPAAKPQKNAENINSRLSMVMKTGQYVLGYKQTLKSLLNGKAKLVIIANNTPPLRKSEI 60
Query: 181 EYYAMLAKTGVHHYNGNNIELGTACGRLFRVCTLAVTDAGDSDIILSVPSESA 339
EYYAMLAKTGVHHYNGNNIELGTACGRLFRVCTLAVTDAGDSDIILSVPSESA
Sbjct: 61 EYYAMLAKTGVHHYNGNNIELGTACGRLFRVCTLAVTDAGDSDIILSVPSESA 113