Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y110A2AL_7
         (315 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17537721|ref|NP_494386.1| CC domain containing protein family...   226   7e-59
gi|32564277|ref|NP_494388.2| CC domain containing protein precur...    96   2e-19
gi|17537707|ref|NP_494387.1| CC domain containing protein family...    78   4e-14
gi|17532967|ref|NP_494363.1| CC domain containing protein family...    75   3e-13
gi|49035181|gb|AAB37926.2| Hypothetical protein F08D12.2 [Caenor...    72   3e-12
gi|32564876|ref|NP_494361.2| CC domain containing protein family...    66   2e-10
gi|17532965|ref|NP_494364.1| CC domain containing protein family...    56   2e-07
gi|17560828|ref|NP_506536.1| CC domain containing protein family...    50   9e-06
gi|17537333|ref|NP_496003.1| predicted CDS, CC domain and metrid...    49   3e-05
gi|17564448|ref|NP_504305.1| predicted CDS, gamma-glutamyltransp...    48   6e-05
gi|39590856|emb|CAE65229.1| Hypothetical protein CBG10108 [Caeno...    47   1e-04
gi|32565589|ref|NP_499059.2| tenascin XB precursor (64.1 kD) (3K...    47   1e-04
gi|50507720|emb|CAH04706.1| Hypothetical protein K04H4.2c [Caeno...    47   1e-04
gi|25395915|pir||B88553 protein K04H4.2b [imported] - Caenorhabd...    47   1e-04
gi|32565591|ref|NP_499058.2| tenascin XB precursor (3K438) [Caen...    47   1e-04
gi|50507719|emb|CAA81588.3| Hypothetical protein K04H4.2b [Caeno...    47   1e-04
gi|482199|pir||S40992 hypothetical protein K04H4.2 - Caenorhabdi...    47   1e-04
gi|39581862|emb|CAE60755.1| Hypothetical protein CBG04441 [Caeno...    45   4e-04
gi|17562848|ref|NP_504287.1| putative secreted or extracellular ...    45   5e-04
gi|39582251|emb|CAE64202.1| Hypothetical protein CBG08832 [Caeno...    44   6e-04
gi|17539154|ref|NP_501957.1| putative protein (4L354) [Caenorhab...    39   0.026
gi|17557938|ref|NP_503246.1| CC domain and metridin-like ShK tox...    38   0.045
gi|17557944|ref|NP_503238.1| CC domain and metridin-like ShK tox...    36   0.17
gi|39584679|emb|CAE72432.1| Hypothetical protein CBG19599 [Caeno...    36   0.22
gi|7503198|pir||T16330 hypothetical protein F41G3.10 - Caenorhab...    35   0.29
gi|39590218|emb|CAE65956.1| Hypothetical protein CBG11138 [Caeno...    35   0.38
gi|17543262|ref|NP_500134.1| putative nuclear protein (4C539) [C...    35   0.38
gi|6754578|ref|NP_034870.1| complement component 1, q subcompone...    35   0.50
gi|39583738|emb|CAE63842.1| Hypothetical protein CBG08398 [Caeno...    35   0.50
gi|27461977|gb|AAN52109.1| variant-specific surface protein AS6 ...    34   0.65
gi|29248756|gb|EAA40282.1| GLP_464_186_2480 [Giardia lamblia ATC...    34   0.65
gi|7494122|pir||A42125 trophozoite cysteine-rich surface antigen...    34   0.65
gi|39593360|emb|CAE64830.1| Hypothetical protein CBG09626 [Caeno...    34   0.85
gi|16758114|ref|NP_445835.1| lymphocyte antigen 68 [Rattus norve...    34   0.85
gi|21541989|sp|Q9ET61|CD93_RAT Complement component C1q receptor...    34   0.85
gi|17561066|ref|NP_504660.1| putative protein (5H12) [Caenorhabd...    34   0.85
gi|34452244|gb|AAP44488.1| egg bindin receptor protein 1 precurs...    34   0.85
gi|17507227|ref|NP_492473.1| e-selectin (1J826) [Caenorhabditis ...    33   1.1
gi|21064745|gb|AAM29602.1| RH47776p [Drosophila melanogaster]          33   1.1
gi|7500677|pir||T21889 hypothetical protein F36H2.3b - Caenorhab...    33   1.1
gi|17507229|ref|NP_492472.1| CUB sushi multiple domains 1 (1J826...    33   1.1
gi|7500676|pir||T21888 hypothetical protein F36H2.3a - Caenorhab...    33   1.1
gi|39584680|emb|CAE72433.1| Hypothetical protein CBG19600 [Caeno...    33   1.1
gi|6573212|gb|AAF17594.1| variant-specific surface protein H7-1 ...    33   1.4
gi|17534815|ref|NP_495742.1| putative protein family member (2I5...    33   1.9
gi|482561|pir||A48434 variant-specific surface protein - Giardia...    33   1.9
gi|39594324|emb|CAE71902.1| Hypothetical protein CBG18960 [Caeno...    33   1.9
gi|39591515|emb|CAE73569.1| Hypothetical protein CBG21039 [Caeno...    32   2.5
gi|38175571|dbj|BAD01281.1| hypothetical protein [Oryza sativa (...    32   2.5
gi|17551348|ref|NP_510044.1| tissue factor pathway inhibitor fam...    32   2.5
gi|23100462|ref|NP_693929.1| CTP synthase [Oceanobacillus iheyen...    32   2.5
gi|7507622|pir||T16840 hypothetical protein T10E10.4 - Caenorhab...    32   3.2
gi|17569759|ref|NP_509058.1| tenascin XB XB1 (XG934) [Caenorhabd...    32   3.2
gi|39591476|emb|CAE73530.1| Hypothetical protein CBG20993 [Caeno...    32   3.2
gi|39585823|emb|CAE61236.1| Hypothetical protein CBG05036 [Caeno...    32   3.2
gi|32477303|ref|NP_870297.1| CTP synthase [Pirellula sp. 1] >gnl...    32   3.2
gi|17533231|ref|NP_496658.1| CC domain and metridin-like ShK tox...    32   3.2
gi|39579000|emb|CAE57036.1| Hypothetical protein CBG24919 [Caeno...    32   3.2
gi|29247357|gb|EAA38922.1| GLP_435_45493_47811 [Giardia lamblia ...    32   4.2
gi|1098514|gb|AAA82586.1| variant-specific surface protein [Giar...    32   4.2
gi|17555474|ref|NP_499406.1| predicted CDS, nematode-specific EB...    31   5.5
gi|31212883|ref|XP_312182.1| ENSANGP00000010271 [Anopheles gambi...    31   5.5
gi|20149764|ref|NP_619614.1| stabilin-2 [Mus musculus] >gnl|BL_O...    31   5.5
gi|7486946|pir||T00400 hypothetical protein At2g44930 [imported]...    31   7.2
gi|34148305|gb|AAQ62662.1| growth hormone receptor [Beamys hindei]     31   7.2
gi|7023975|dbj|BAA92143.1| 120-kDa protein [Sarcophaga peregrina]      31   7.2
gi|17530937|ref|NP_511155.1| CG10521-PA [Drosophila melanogaster...    31   7.2
gi|31233301|ref|XP_318850.1| ENSANGP00000014402 [Anopheles gambi...    31   7.2
gi|39584333|emb|CAE65497.1| Hypothetical protein CBG10467 [Caeno...    31   7.2
gi|13929180|ref|NP_114014.1| fibrillin-2 [Rattus norvegicus] >gn...    31   7.2
gi|20808954|ref|NP_624125.1| CTP synthase (UTP-ammonia lyase) [T...    31   7.2
gi|31322550|gb|AAO52676.1| TFP250 [Eimeria maxima]                     31   7.2
gi|39579003|emb|CAE57039.1| Hypothetical protein CBG24922 [Caeno...    31   7.2
gi|18406666|ref|NP_566032.1| expressed protein [Arabidopsis thal...    31   7.2
gi|34148337|gb|AAQ62678.1| growth hormone receptor [Tatera robusta]    31   7.2
gi|34148309|gb|AAQ62664.1| growth hormone receptor [Petromyscus ...    30   9.4
gi|14520239|ref|NP_125713.1| pyruvate formate-lyase activating e...    30   9.4
gi|24421055|emb|CAC82720.1| C1q receptor protein [Homo sapiens]        30   9.4
gi|27982527|gb|AAM94646.1| CTP synthetase [Spironucleus barkhanus]     30   9.4
gi|39580696|emb|CAE70376.1| Hypothetical protein CBG16936 [Caeno...    30   9.4
gi|39596066|emb|CAE69702.1| Hypothetical protein CBG15963 [Caeno...    30   9.4
gi|17154958|gb|AAL36024.1| BM86-like protein [Hyalomma anatolicu...    30   9.4
gi|15598833|ref|NP_252327.1| CTP synthase [Pseudomonas aeruginos...    30   9.4
gi|29246222|gb|EAA37827.1| GLP_661_17216_19243 [Giardia lamblia ...    30   9.4
gi|16801765|ref|NP_472033.1| highly similar to CTP synthases [Li...    30   9.4
gi|46908730|ref|YP_015119.1| CTP synthase [Listeria monocytogene...    30   9.4
gi|16804597|ref|NP_466082.1| highly similar to CTP synthases [Li...    30   9.4
gi|46164347|ref|ZP_00137026.2| COG0504: CTP synthase (UTP-ammoni...    30   9.4


>gi|17537721|ref|NP_494386.1| CC domain containing protein family
           member (2D156) [Caenorhabditis elegans]
 gi|7331709|gb|AAF60397.1| Hypothetical protein Y110A2AL.9
           [Caenorhabditis elegans]
          Length = 104

 Score =  226 bits (577), Expect = 7e-59
 Identities = 104/104 (100%), Positives = 104/104 (100%)
 Frame = -1

Query: 315 MGDTVMVNGNMCCESKNVAVSSLLSCKSDMTPAGYGLCRPGYTLMYGYRCCATKDVFDPT 136
           MGDTVMVNGNMCCESKNVAVSSLLSCKSDMTPAGYGLCRPGYTLMYGYRCCATKDVFDPT
Sbjct: 1   MGDTVMVNGNMCCESKNVAVSSLLSCKSDMTPAGYGLCRPGYTLMYGYRCCATKDVFDPT 60

Query: 135 TATCYTGYGYSNSVMGSAVNGVCPTGYSVTKGNLCCKTAFVVVD 4
           TATCYTGYGYSNSVMGSAVNGVCPTGYSVTKGNLCCKTAFVVVD
Sbjct: 61  TATCYTGYGYSNSVMGSAVNGVCPTGYSVTKGNLCCKTAFVVVD 104




[DB home][top]