Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y110A2AR_1
         (657 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17537739|ref|NP_494397.1| ubiquitin conjugating enzyme (24.5 ...   471   e-132
gi|39584695|emb|CAE72448.1| Hypothetical protein CBG19618 [Caeno...   303   1e-81
gi|32563946|ref|NP_871922.1| ubiquitin-conjugating enzymes (2D18...   186   5e-46
gi|39584694|emb|CAE72447.1| Hypothetical protein CBG19617 [Caeno...   182   4e-45
gi|21358599|ref|NP_650631.1| CG5823-PA [Drosophila melanogaster]...   179   6e-44
gi|31215274|ref|XP_315994.1| ENSANGP00000010774 [Anopheles gambi...   176   5e-43
gi|48132665|ref|XP_396699.1| similar to ubiquitin conjugating en...   172   4e-42
gi|2982311|gb|AAC32141.1| probable ubiquitin-conjugating enzyme ...   170   2e-41
gi|19114168|ref|NP_593256.1| putative ubiquitin-conjugating enzy...   170   2e-41
gi|14484934|gb|AAK62819.1| ubiquitin conjugating enzyme 2 [Lycop...   170   3e-41
gi|50759239|ref|XP_417582.1| PREDICTED: similar to ubiquitin con...   169   4e-41
gi|14029267|gb|AAK52609.1| ubiquitin conjugating enzyme 6 [Homo ...   167   1e-40
gi|37577124|ref|NP_477515.2| ubiquitin conjugating enzyme E2, J2...   167   1e-40
gi|6649660|gb|AAF21504.1| Ubc6p homolog [Mus musculus]                167   2e-40
gi|41351233|gb|AAH65779.1| Unknown (protein for MGC:73556) [Mus ...   167   2e-40
gi|34873108|ref|XP_216595.2| similar to Ubc6p homolog [Rattus no...   167   2e-40
gi|14029263|gb|AAK52607.1| ubiquitin conjugating enzyme 6 [Mus m...   167   2e-40
gi|15240671|ref|NP_199854.1| ubiquitin-conjugating enzyme, putat...   166   3e-40
gi|50290111|ref|XP_447487.1| unnamed protein product [Candida gl...   166   3e-40
gi|15220062|ref|NP_173172.1| ubiquitin-conjugating enzyme, putat...   166   5e-40
gi|22760840|dbj|BAC11355.1| unnamed protein product [Homo sapiens]    165   6e-40
gi|38076442|ref|XP_356743.1| similar to Ubc6p homolog [Mus muscu...   165   8e-40
gi|12835927|dbj|BAB23421.1| unnamed protein product [Mus musculus]    164   1e-39
gi|45201468|ref|NP_987038.1| AGR372Wp [Eremothecium gossypii] >g...   164   1e-39
gi|11359328|pir||T43159 ubiquitin-protein ligase homolog - fissi...   164   1e-39
gi|31543915|ref|NP_067377.3| ubiquitin-conjugating enzyme E2, J2...   163   2e-39
gi|50309721|ref|XP_454873.1| unnamed protein product [Kluyveromy...   162   4e-39
gi|46127873|ref|XP_388490.1| hypothetical protein FG08314.1 [Gib...   162   4e-39
gi|38103058|gb|EAA49813.1| hypothetical protein MG09977.4 [Magna...   162   5e-39
gi|6320947|ref|NP_011026.1| Ubiquitin-conjugating enzyme involve...   161   9e-39
gi|47212316|emb|CAF89614.1| unnamed protein product [Tetraodon n...   161   9e-39
gi|12845644|dbj|BAB26835.1| unnamed protein product [Mus musculus]    158   1e-37
gi|37577126|ref|NP_919296.1| ubiquitin conjugating enzyme E2, J2...   157   2e-37
gi|46438260|gb|EAK97593.1| hypothetical protein CaO19.7347 [Cand...   155   7e-37
gi|50408085|ref|XP_456755.1| unnamed protein product [Debaryomyc...   153   3e-36
gi|17082483|gb|AAL35400.1| ubiquitin conjugating enzyme 2 [Zea m...   152   6e-36
gi|50554345|ref|XP_504581.1| hypothetical protein [Yarrowia lipo...   149   5e-35
gi|50257475|gb|EAL20182.1| hypothetical protein CNBF2580 [Crypto...   145   9e-34
gi|50550481|ref|XP_502713.1| hypothetical protein [Yarrowia lipo...   143   3e-33
gi|16551332|dbj|BAB71086.1| unnamed protein product [Homo sapiens]    134   1e-30
gi|47550809|ref|NP_999932.1| zgc:63554 [Danio rerio] >gnl|BL_ORD...   134   1e-30
gi|34867116|ref|XP_216362.2| similar to non-canonical ubquitin c...   133   3e-30
gi|45382103|ref|NP_990094.1| Non-Canonical UBiquitin Conjugating...   133   3e-30
gi|9453733|emb|CAB99360.1| bA11D8.1 (yeast ubiquitin conjugating...   133   3e-30
gi|6841528|gb|AAF29117.1| HSPC153 [Homo sapiens] >gnl|BL_ORD_ID|...   133   3e-30
gi|15277421|ref|NP_057420.2| ubiquitin-conjugating enzyme E2, J1...   133   3e-30
gi|7363050|emb|CAB83217.1| Non-Canonical UBiquitin Conjugating E...   133   3e-30
gi|31980960|ref|NP_062532.2| ubiquitin-conjugating enzyme E2, J1...   133   3e-30
gi|4929621|gb|AAD34071.1| CGI-76 protein [Homo sapiens]               130   3e-29
gi|18401338|ref|NP_566563.1| ubiquitin-conjugating enzyme, putat...   129   7e-29
gi|37577130|ref|NP_919439.1| ubiquitin conjugating enzyme E2, J2...   126   3e-28
gi|6649662|gb|AAF21505.1| Ubc6p homolog [Homo sapiens]                126   4e-28
gi|7498090|pir||T34195 hypothetical protein D1022.1 - Caenorhabd...   125   1e-27
gi|17532649|ref|NP_495566.1| ubiquitin conjugating enzyme (35.3 ...   124   1e-27
gi|39596027|emb|CAE67530.1| Hypothetical protein CBG13052 [Caeno...   122   8e-27
gi|18092344|gb|AAL59236.1| ubiqutin conjugating enzyme 2 [Zea mays]   121   1e-26
gi|32409933|ref|XP_325447.1| hypothetical protein [Neurospora cr...   120   3e-26
gi|50421749|ref|XP_459430.1| unnamed protein product [Debaryomyc...   114   2e-24
gi|49079976|ref|XP_403570.1| hypothetical protein UM05955.1 [Ust...   112   8e-24
gi|38108449|gb|EAA54461.1| hypothetical protein MG02446.4 [Magna...   110   3e-23
gi|46228870|gb|EAK89740.1| Ubc6p like ubiquiting conjugating enz...   110   3e-23
gi|46126173|ref|XP_387640.1| hypothetical protein FG07464.1 [Gib...   107   2e-22
gi|38566817|emb|CAE76125.1| related to non-canonical ubiquitin c...   107   3e-22
gi|32412562|ref|XP_326761.1| hypothetical protein [Neurospora cr...   107   3e-22
gi|49106957|ref|XP_411475.1| hypothetical protein AN7338.2 [Aspe...   106   3e-22
gi|50257921|gb|EAL20619.1| hypothetical protein CNBE3270 [Crypto...   103   4e-21
gi|17510685|ref|NP_490861.1| putative protein of eukaryotic orig...   103   4e-21
gi|29250521|gb|EAA42013.1| GLP_68_18546_19520 [Giardia lamblia A...   102   9e-21
gi|25153453|ref|NP_500279.2| predicted CDS, putative membrane pr...   101   1e-20
gi|49103171|ref|XP_411127.1| hypothetical protein AN6990.2 [Aspe...    99   7e-20
gi|47190747|emb|CAG13938.1| unnamed protein product [Tetraodon n...    99   7e-20
gi|17534119|ref|NP_496837.1| ALDH5B1, ALdehyde deHydrogenase (al...    94   2e-18
gi|29251108|gb|EAA42592.1| GLP_487_28716_29249 [Giardia lamblia ...    89   8e-17
gi|13122204|emb|CAB89584.2| possible non-canonical ubiquitin con...    88   1e-16
gi|31211617|ref|XP_314778.1| ENSANGP00000014351 [Anopheles gambi...    88   2e-16
gi|24664701|ref|NP_730059.1| CG7656-PA [Drosophila melanogaster]...    87   2e-16
gi|24664697|ref|NP_730058.1| CG7656-PC [Drosophila melanogaster]...    87   3e-16
gi|29250085|gb|EAA41585.1| GLP_546_71955_72440 [Giardia lamblia ...    86   6e-16
gi|41058172|gb|AAR99131.1| RE15288p [Drosophila melanogaster]          86   6e-16
gi|18394114|ref|NP_563951.1| ubiquitin-conjugating enzyme 1 (UBC...    82   7e-15
gi|136640|sp|P25866|UBC2_WHEAT Ubiquitin-conjugating enzyme E2-1...    81   2e-14
gi|18395424|ref|NP_565289.1| ubiquitin-conjugating enzyme 2 (UBC...    81   2e-14
gi|13516451|dbj|BAB40310.1| ubiquitin-conjugating enzyme (E2) [N...    80   4e-14
gi|19113788|ref|NP_592876.1| ubiquitin-conjugating enzyme e2-17 ...    79   6e-14
gi|33146810|dbj|BAC79758.1| OsRad6 [Oryza sativa (japonica culti...    79   6e-14
gi|18844990|dbj|BAB85469.1| Rad6 [Oryza sativa (japonica cultiva...    79   6e-14
gi|13516453|dbj|BAB40311.1| ubiquitin-conjugating enzyme (E2) [N...    79   6e-14
gi|39579465|emb|CAE56741.1| Hypothetical protein CBG24535 [Caeno...    79   8e-14
gi|8118527|gb|AAF73016.1| ubiquitin conjugating protein [Avicenn...    79   1e-13
gi|6136093|sp|O74201|UBC2_CANAL Ubiquitin-conjugating enzyme E2-...    78   2e-13
gi|464980|sp|P35130|UBC2_MEDSA Ubiquitin-conjugating enzyme E2-1...    78   2e-13
gi|50260358|gb|EAL23017.1| hypothetical protein CNBA7840 [Crypto...    78   2e-13
gi|9628248|ref|NP_042834.1| ubiquitin-conjugating enzyme [Africa...    78   2e-13
gi|17542650|ref|NP_500480.1| ubiquitin conjugating enzyme (21.5 ...    77   2e-13
gi|34810893|pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E...    77   2e-13
gi|11272418|pir||T45220 ubiquitin-protein ligase (EC 6.3.2.19) r...    77   2e-13
gi|1717855|sp|P52493|UBC2_NEUCR Ubiquitin-conjugating enzyme E2-...    77   3e-13
gi|38086696|ref|XP_284734.2| RIKEN cDNA 4930524E20 [Mus musculus]      77   4e-13
gi|50557022|ref|XP_505919.1| hypothetical protein [Yarrowia lipo...    77   4e-13
gi|13811942|ref|NP_113070.1| ubiquitin conjugating enzyme [Guill...    76   5e-13
gi|32419875|ref|XP_330381.1| UBIQUITIN-CONJUGATING ENZYME E2-17 ...    76   5e-13
gi|41055506|ref|NP_957215.1| ubiquitin-conjugating enzyme E2E 3;...    76   7e-13
gi|25293669|pir||T51931 hypothetical protein NhRAD6 [imported] -...    76   7e-13
gi|38110378|gb|EAA56105.1| hypothetical protein MG01756.4 [Magna...    75   9e-13
gi|19074740|ref|NP_586246.1| UBIQUITIN CONJUGATING ENZYME E2-17k...    75   9e-13
gi|1174848|sp|P43102|UBC4_CANAL Ubiquitin-conjugating enzyme E2 ...    75   9e-13
gi|24644103|ref|NP_524230.2| CG2013-PA [Drosophila melanogaster]...    75   9e-13
gi|30585021|gb|AAP36783.1| Homo sapiens ubiquitin-conjugating en...    75   9e-13
gi|103350|pir||A39392 RAD6 DNA-repair homolog Dhr6 - fruit fly (...    75   9e-13
gi|16604264|gb|AAK50144.1| UVSJ [Aspergillus nidulans]                 75   9e-13
gi|4507771|ref|NP_003328.1| ubiquitin-conjugating enzyme E2B; ub...    75   9e-13
gi|136651|sp|P25869|UBC_ASFM2 Ubiquitin-conjugating enzyme E2-21...    75   9e-13
gi|50419513|ref|XP_458283.1| unnamed protein product [Debaryomyc...    75   1e-12
gi|34932996|ref|XP_216466.2| similar to ubiquitin-conjugating en...    75   1e-12
gi|1072386|emb|CAA63352.1| ubiquitin-conjugating enzyme UbcM2 [M...    75   1e-12
gi|45361457|ref|NP_989305.1| hypothetical protein MGC76120 [Xeno...    75   1e-12
gi|5454146|ref|NP_006348.1| ubiquitin-conjugating enzyme E2E 3; ...    75   1e-12
gi|50405625|ref|XP_456449.1| unnamed protein product [Debaryomyc...    75   1e-12
gi|41054359|ref|NP_956013.1| ubiquitin-conjugating enzyme E2B (R...    75   1e-12
gi|21450233|ref|NP_659088.1| ubiquitin-conjugating enzyme E2E 2 ...    75   1e-12
gi|22749327|ref|NP_689866.1| ubiquitin-conjugating enzyme E2E 2 ...    75   1e-12
gi|34869227|ref|XP_341289.1| similar to cDNA sequence BC016265 [...    75   1e-12
gi|50750373|ref|XP_421975.1| PREDICTED: similar to ubiquitin-con...    75   1e-12
gi|31202935|ref|XP_310416.1| ENSANGP00000017916 [Anopheles gambi...    75   1e-12
gi|9790041|ref|NP_062642.1| ubiquitin-conjugating enzyme E2A, RA...    74   2e-12
gi|49903971|gb|AAH76409.1| Zgc:100921 protein [Danio rerio]            74   2e-12
gi|49257228|gb|AAH71066.1| Unknown (protein for MGC:78891) [Xeno...    74   2e-12
gi|50370097|gb|AAH76483.1| Unknown (protein for MGC:92467) [Dani...    74   2e-12
gi|40363453|dbj|BAD06217.1| ubiquitin conjugating enzyme E2 [Xen...    74   3e-12
gi|25143513|ref|NP_490882.2| ubiquitin conjugating enzyme (ubc-3...    74   3e-12
gi|21314398|gb|AAM46925.1| ubiquitin conjugating enzyme E2A [Fun...    74   3e-12
gi|108016|pir||A41222 ubiquitin-protein ligase (EC 6.3.2.19) E2A...    74   3e-12
gi|32400971|gb|AAP80691.1| ubiquitin-conjugating enzyme [Griffit...    74   3e-12
gi|31560630|ref|NP_033484.2| ubiquitin-conjugating enzyme E2B, R...    74   3e-12
gi|50257678|gb|EAL20383.1| hypothetical protein CNBF1930 [Crypto...    73   4e-12
gi|4507779|ref|NP_003332.1| ubiquitin-conjugating enzyme E2E 1 i...    73   4e-12
gi|6678479|ref|NP_033481.1| ubiquitin-conjugating enzyme E2E 1, ...    73   4e-12
gi|50426447|ref|XP_461820.1| unnamed protein product [Debaryomyc...    73   4e-12
gi|17530929|ref|NP_511150.1| CG18319-PA [Drosophila melanogaster...    73   4e-12
gi|45360717|ref|NP_989032.1| hypothetical protein MGC75971 [Xeno...    73   4e-12
gi|47214413|emb|CAG00254.1| unnamed protein product [Tetraodon n...    73   4e-12
gi|50414876|gb|AAH77801.1| Unknown (protein for MGC:80411) [Xeno...    73   4e-12
gi|18424601|ref|NP_568956.1| ubiquitin-conjugating enzyme 3 (UBC...    73   6e-12
gi|50418285|gb|AAH77923.1| Unknown (protein for MGC:80856) [Xeno...    73   6e-12
gi|29841267|gb|AAP06299.1| similar to GenBank Accession Number U...    73   6e-12
gi|47900319|gb|AAT39166.1| putative ubiquitin-conjugating enzyme...    73   6e-12
gi|23505769|gb|AAN28744.1| At5g62540/K19B1_15 [Arabidopsis thali...    73   6e-12
gi|31225040|ref|XP_317521.1| ENSANGP00000010118 [Anopheles gambi...    72   7e-12
gi|17137158|ref|NP_477137.1| CG6720-PA [Drosophila melanogaster]...    72   7e-12
gi|24580841|ref|NP_608594.1| CG5440-PA [Drosophila melanogaster]...    72   1e-11
gi|48103517|ref|XP_395589.1| similar to ENSANGP00000010118 [Apis...    72   1e-11
gi|38086695|ref|XP_142081.3| similar to ubiquitin-conjugating en...    72   1e-11
gi|49068616|ref|XP_398597.1| UBC1_COLGL Ubiquitin-conjugating en...    72   1e-11
gi|18410268|ref|NP_567020.1| ubiquitin-conjugating enzyme 14 (UB...    72   1e-11
gi|50309021|ref|XP_454516.1| unnamed protein product [Kluyveromy...    71   2e-11
gi|19347846|gb|AAL86003.1| putative E2, ubiquitin-conjugating en...    71   2e-11
gi|46438132|gb|EAK97468.1| hypothetical protein CaO19.7329 [Cand...    71   2e-11
gi|28973769|gb|AAO64200.1| putative E2, ubiquitin-conjugating en...    71   2e-11
gi|49069068|ref|XP_398823.1| hypothetical protein UM01208.1 [Ust...    71   2e-11
gi|15081749|gb|AAK82529.1| AT5g62540/K19B1_15 [Arabidopsis thali...    71   2e-11
gi|39589388|emb|CAE74417.1| Hypothetical protein CBG22149 [Caeno...    71   2e-11
gi|50550765|ref|XP_502855.1| hypothetical protein [Yarrowia lipo...    71   2e-11
gi|47218772|emb|CAG02758.1| unnamed protein product [Tetraodon n...    71   2e-11
gi|38105743|gb|EAA52133.1| hypothetical protein MG03728.4 [Magna...    71   2e-11
gi|31210263|ref|XP_314098.1| ENSANGP00000010475 [Anopheles gambi...    70   3e-11
gi|29841048|gb|AAP06061.1| similar to NM_019668 ubiquitin-conjug...    70   3e-11
gi|45190777|ref|NP_985031.1| AER173Cp [Eremothecium gossypii] >g...    70   3e-11
gi|31088843|sp|Q42540|UBC7_ARATH Ubiquitin-conjugating enzyme E2...    70   3e-11
gi|18408206|ref|NP_566884.1| ubiquitin-conjugating enzyme 13 (UB...    70   3e-11
gi|7437989|pir||T01329 ubiquitin-conjugating enzyme E2 - maize >...    70   3e-11
gi|7437988|pir||T02943 ubiquitin-conjugating enzyme - maize >gnl...    70   4e-11
gi|42662656|ref|XP_208431.2| similar to ubiquitin-conjugating en...    70   5e-11
gi|30584383|gb|AAP36440.1| Homo sapiens ubiquitin-conjugating en...    70   5e-11
gi|48095652|ref|XP_392337.1| similar to Ubiquitin-conjugating en...    70   5e-11
gi|32417826|ref|XP_329391.1| hypothetical protein [Neurospora cr...    70   5e-11
gi|4507773|ref|NP_003329.1| ubiquitin-conjugating enzyme E2D 1; ...    70   5e-11
gi|46575928|ref|NP_997236.1| ubiquitin-conjugating enzyme UbcM2 ...    70   5e-11
gi|50289673|ref|XP_447268.1| unnamed protein product [Candida gl...    70   5e-11
gi|50732764|ref|XP_418752.1| PREDICTED: similar to Ubiquitin-con...    70   5e-11
gi|6321380|ref|NP_011457.1| Ubiquitin-conjugating enzyme (E2), i...    69   6e-11
gi|17541470|ref|NP_502065.1| UBiquitin Conjugating enzyme E2, Ub...    69   6e-11
gi|24646906|ref|NP_731941.1| CG7425-PA [Drosophila melanogaster]...    69   6e-11
gi|45184981|ref|NP_982699.1| AAR156Cp [Eremothecium gossypii] >g...    69   6e-11
gi|7799043|emb|CAB90824.1| ubiquitin conjugating enzyme [Drosoph...    69   6e-11
gi|3659954|pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharo...    69   6e-11
gi|50304985|ref|XP_452450.1| unnamed protein product [Kluyveromy...    69   8e-11
gi|50286929|ref|XP_445894.1| unnamed protein product [Candida gl...    69   8e-11
gi|8393719|ref|NP_057067.1| ubiquitin-conjugating enzyme HBUCE1 ...    69   8e-11
gi|50257940|gb|EAL20637.1| hypothetical protein CNBE3020 [Crypto...    69   8e-11
gi|7497060|pir||T32959 hypothetical protein C35B1.1 - Caenorhabd...    69   8e-11
gi|31198143|ref|XP_308019.1| ENSANGP00000019471 [Anopheles gambi...    69   8e-11
gi|47216207|emb|CAG01241.1| unnamed protein product [Tetraodon n...    69   1e-10
gi|34909292|ref|NP_915993.1| ubiquitin conjugating enzyme [Oryza...    69   1e-10
gi|24642559|ref|NP_524684.2| CG4443-PA [Drosophila melanogaster]...    69   1e-10
gi|38103646|gb|EAA50322.1| hypothetical protein MG04081.4 [Magna...    69   1e-10
gi|50294532|ref|XP_449677.1| unnamed protein product [Candida gl...    69   1e-10
gi|50725323|dbj|BAD34325.1| putative ubiquitin-conjugating enzym...    68   1e-10
gi|47217004|emb|CAG01632.1| unnamed protein product [Tetraodon n...    68   1e-10
gi|2668744|gb|AAB88617.1| ubiquitin conjugating enzyme [Zea mays]      68   2e-10
gi|41054637|ref|NP_955865.1| ubiquitin-conjugating enzyme E2D 2;...    68   2e-10
gi|477134|pir||A48145 ubiquitin-conjugating enzyme ubc-2 - Caeno...    68   2e-10
gi|34391429|gb|AAN16046.1| ubiquitin-conjugating enzyme E2 [Pavl...    68   2e-10
gi|45185288|ref|NP_983005.1| ABR059Wp [Eremothecium gossypii] >g...    68   2e-10
gi|46128361|ref|XP_388734.1| conserved hypothetical protein [Gib...    68   2e-10
gi|19112075|ref|NP_595283.1| ubiquitin-conjugating enzyme e2-16 ...    67   2e-10
gi|41152425|ref|NP_955958.1| Unknown (protein for MGC:73096); wu...    67   2e-10
gi|49899030|gb|AAH76728.1| Unknown (protein for MGC:81261) [Xeno...    67   2e-10
gi|23612890|ref|NP_704429.1| ubiquitin-conjugating enzyme, putat...    67   2e-10
gi|22331064|ref|NP_566459.2| ubiquitin-conjugating enzyme (COP10...    67   2e-10
gi|34908132|ref|NP_915413.1| putative Ubiquitin carrier protein ...    67   2e-10
gi|18423829|ref|NP_568835.1| ubiquitin-conjugating enzyme, putat...    67   3e-10
gi|6319556|ref|NP_009638.1| Ubiquitin-conjugating enzyme that me...    67   3e-10
gi|18398206|ref|NP_566331.1| ubiquitin-conjugating enzyme 11 (UB...    67   3e-10
gi|23394352|gb|AAN31466.1| ubiquitin-conjugating enzyme [Phytoph...    67   3e-10
gi|27805767|sp|Q9UVR2|UBC1_MAGGR Ubiquitin-conjugating enzyme E2...    67   3e-10
gi|48103877|ref|XP_392901.1| similar to ENSANGP00000010475 [Apis...    67   3e-10
gi|7108763|gb|AAF36529.1| RAD6 homolog [Equus caballus]                67   3e-10
gi|7108765|gb|AAF36530.1| RAD6 homolog [Bos taurus]                    67   3e-10
gi|6323664|ref|NP_013735.1| part of the HRDDER pathway of ER-ass...    67   3e-10
gi|23487849|gb|EAA21159.1| ubiquitin-conjugating enzyme [Plasmod...    67   3e-10
gi|34391431|gb|AAN16047.1| ubiquitin-conjugating enzyme E2 [Pavl...    67   4e-10
gi|50760741|ref|XP_418113.1| PREDICTED: similar to hypothetical ...    66   5e-10
gi|40287554|gb|AAR83891.1| ubiquitin-conjugating enzyme 8 [Capsi...    66   5e-10
gi|30025160|gb|AAP04430.1| ubiquitin-conjugating enzyme [Hordeum...    66   5e-10
gi|12843975|dbj|BAB26188.1| unnamed protein product [Mus musculus]     66   5e-10
gi|41152398|ref|NP_956246.1| Unknown (protein for MGC:73200); wu...    66   5e-10
gi|46123199|ref|XP_386153.1| conserved hypothetical protein [Gib...    66   5e-10
gi|47219797|emb|CAG03424.1| unnamed protein product [Tetraodon n...    66   5e-10
gi|41055692|ref|NP_957252.1| similar to ubiquitin-conjugating en...    66   5e-10
gi|33149322|ref|NP_871621.1| ubiquitin-conjugating enzyme E2D 3 ...    66   7e-10
gi|6320264|ref|NP_010344.1| Ubiquitin-conjugating enzyme that me...    66   7e-10
gi|31196029|ref|XP_306962.1| ENSANGP00000016320 [Anopheles gambi...    66   7e-10
gi|18403097|ref|NP_564572.1| ubiquitin-conjugating enzyme 20 (UB...    65   9e-10
gi|28569259|gb|AAL99219.1| ubiquitin-conjugating enzyme E2 [Goss...    65   9e-10
gi|32488376|emb|CAE02801.1| OSJNBa0043A12.6 [Oryza sativa (japon...    65   9e-10
gi|28569267|gb|AAL99223.1| ubiquitin-conjugating enzyme E2 [Goss...    65   9e-10
gi|20152205|dbj|BAB89355.1| ubiquitin-conjugating enzyme OsUBC5b...    65   9e-10
gi|41054778|ref|NP_957404.1| similar to UBiquitin Conjugating en...    65   9e-10
gi|32417650|ref|XP_329303.1| hypothetical protein [Neurospora cr...    65   9e-10
gi|49096344|ref|XP_409632.1| hypothetical protein AN5495.2 [Aspe...    65   9e-10
gi|50308591|ref|XP_454298.1| unnamed protein product [Kluyveromy...    65   9e-10
gi|30693863|ref|NP_851114.1| ubiquitin-conjugating enzyme 8 (UBC...    65   1e-09
gi|441457|emb|CAA51821.1| ubiquitin conjugating enzyme E2 [Lycop...    65   1e-09
gi|21553796|gb|AAM62889.1| E2, ubiquitin-conjugating enzyme UBC8...    65   1e-09
gi|11022580|emb|CAC14238.1| probable ubiquitin-conjugating enzym...    65   1e-09
gi|41052626|dbj|BAD08135.1| ubiquitin-conjugating enzyme [Oryza ...    65   1e-09
gi|4100646|gb|AAD00911.1| putative ubiquitin conjugating enzyme ...    65   1e-09
gi|464981|sp|P35135|UBC4_LYCES Ubiquitin-conjugating enzyme E2-1...    65   1e-09
gi|50540444|ref|NP_001002688.1| zgc:91847 [Danio rerio] >gnl|BL_...    65   1e-09
gi|49259382|pdb|1UR6|A Chain A, Nmr Based Structural Model Of Th...    65   1e-09
gi|4507775|ref|NP_003330.1| ubiquitin-conjugating enzyme E2D 2 i...    65   1e-09
gi|2136339|pir||I59365 ubiquitin conjugating enzyme - human >gnl...    65   1e-09
gi|27805755|sp|O74196|UBC1_COLGL Ubiquitin-conjugating enzyme E2...    65   1e-09
gi|48145949|emb|CAG33197.1| UBE2D3 [Homo sapiens]                      65   1e-09
gi|49090874|ref|XP_406898.1| UBC1_COLGL Ubiquitin-conjugating en...    65   1e-09
gi|46109246|ref|XP_381681.1| hypothetical protein FG01505.1 [Gib...    65   1e-09
gi|16152184|gb|AAL14998.1| RAD6-like protein HR6A [Bos taurus]         65   1e-09
gi|21618179|gb|AAM67229.1| E2, ubiquitin-conjugating enzyme, put...    65   2e-09
gi|34903234|ref|NP_912964.1| unnamed protein product [Oryza sati...    65   2e-09
gi|28569269|gb|AAL99224.1| ubiquitin-conjugating enzyme E2 [Goss...    65   2e-09
gi|4507777|ref|NP_003331.1| ubiquitin-conjugating enzyme E2D 3 i...    65   2e-09
gi|45361601|ref|NP_989375.1| hypothetical protein MGC75672 [Xeno...    65   2e-09
gi|32450396|gb|AAH53797.1| Ube2n-prov protein [Xenopus laevis]         65   2e-09
gi|16758810|ref|NP_446380.1| ubiquitin-conjugating enzyme E2N (h...    65   2e-09
gi|7108761|gb|AAF36528.1| RAD6 homolog [Sus scrofa]                    65   2e-09
gi|18417097|ref|NP_567791.1| ubiquitin-conjugating enzyme E2-17 ...    64   2e-09
gi|11762186|gb|AAG40371.1| AT4g27960 [Arabidopsis thaliana]            64   2e-09
gi|30687803|ref|NP_849462.1| ubiquitin-conjugating enzyme E2-17 ...    64   2e-09
gi|46228398|gb|EAK89297.1| protein with UBC domain, ubiquitin co...    64   2e-09
gi|41055694|ref|NP_957253.1| similar to ubiquitin-conjugating en...    64   2e-09
gi|44890748|gb|AAH66917.1| Ubiquitin-conjugating enzyme E2D 3, i...    64   2e-09
gi|12833659|dbj|BAB22614.1| unnamed protein product [Mus musculus]     64   2e-09
gi|20152203|dbj|BAB89354.1| ubiquitin-conjugating enzyme OsUBC5a...    64   2e-09
gi|5381319|gb|AAD42941.1| ubiquitin-conjugating enzyme E2 [Catha...    64   2e-09
gi|30583959|gb|AAP36228.1| Homo sapiens ubiquitin-conjugating en...    64   2e-09
gi|39587909|emb|CAE67928.1| Hypothetical protein CBG13528 [Caeno...    64   2e-09
gi|4507793|ref|NP_003339.1| ubiquitin-conjugating enzyme E2N; be...    64   2e-09
gi|12838544|dbj|BAB24239.1| unnamed protein product [Mus musculus]     64   2e-09
gi|28174992|gb|AAH34898.2| Ube2n protein [Mus musculus]                64   2e-09
gi|47209874|emb|CAF90188.1| unnamed protein product [Tetraodon n...    64   2e-09
gi|34852447|ref|XP_342126.1| similar to ubiquitin-conjugating en...    64   2e-09
gi|41054401|ref|NP_956636.1| hypothetical protein MGC63901 [Dani...    64   3e-09
gi|47087307|ref|NP_998651.1| zgc:55726 [Danio rerio] >gnl|BL_ORD...    64   3e-09
gi|18398199|ref|NP_565391.1| ubiquitin-conjugating enzyme, putat...    64   3e-09
gi|456568|gb|AAA64427.1| ubiquitin conjugating enzyme                  64   3e-09
gi|34881346|ref|XP_228445.2| similar to testis protein TEX16 [Ra...    64   3e-09
gi|23619484|ref|NP_705446.1| ubiquitin-conjugating enzyme, putat...    64   3e-09
gi|18408001|ref|NP_564828.1| ubiquitin-conjugating enzyme, putat...    64   3e-09
gi|5762457|gb|AAD51109.1| ubiquitin-conjugating enzyme UBC2 [Mes...    64   3e-09
gi|31202937|ref|XP_310417.1| ENSANGP00000022394 [Anopheles gambi...    64   3e-09
gi|25153953|ref|NP_500272.2| ubiquitin conjugating enzyme (16.9 ...    64   3e-09
gi|49250425|gb|AAH74529.1| Unknown (protein for MGC:69351) [Xeno...    64   3e-09
gi|29245125|gb|EAA36783.1| GLP_382_5313_4777 [Giardia lamblia AT...    63   4e-09
gi|38048037|gb|AAR09921.1| similar to Drosophila melanogaster ef...    63   4e-09
gi|21554343|gb|AAM63450.1| E2, ubiquitin-conjugating enzyme 10 (...    63   4e-09
gi|18423494|ref|NP_568788.1| ubiquitin-conjugating enzyme 10 (UB...    63   4e-09
gi|47222043|emb|CAG12069.1| unnamed protein product [Tetraodon n...    63   4e-09
gi|19921342|ref|NP_609715.1| CG3473-PA [Drosophila melanogaster]...    63   4e-09
gi|7287841|gb|AAF44879.1| hypothetical protein [Drosophila melan...    63   4e-09
gi|18402475|ref|NP_566653.1| ubiquitin-conjugating enzyme 19 (UB...    63   4e-09
gi|28175616|gb|AAH45129.1| MGC53533 protein [Xenopus laevis]           63   4e-09
gi|49121123|ref|XP_412395.1| conserved hypothetical protein [Asp...    63   4e-09
gi|28569263|gb|AAL99222.1| ubiquitin-conjugating enzyme E2 [Goss...    63   6e-09
gi|13386314|ref|NP_082778.1| RIKEN cDNA 1700013N18 [Mus musculus...    63   6e-09
gi|33585636|gb|AAH56005.1| Ube2r2-prov protein [Xenopus laevis] ...    63   6e-09
gi|17646076|emb|CAC80335.1| ubiquitin coniugating enzyme 3b [Mus...    63   6e-09
gi|13385778|ref|NP_080551.1| ubiquitin-conjugating enzyme E2R 2 ...    63   6e-09
gi|17510667|ref|NP_493381.1| ubiquitin conjugating enzyme (19.1 ...    63   6e-09
gi|1381181|gb|AAB02656.1| ubiquitin-conjugating enzyme E2-32k          63   6e-09
gi|47215198|emb|CAG01405.1| unnamed protein product [Tetraodon n...    63   6e-09
gi|38100154|gb|EAA47325.1| hypothetical protein MG02568.4 [Magna...    62   8e-09
gi|31204097|ref|XP_310997.1| ENSANGP00000023324 [Anopheles gambi...    62   8e-09
gi|49071504|ref|XP_400041.1| hypothetical protein UM02426.1 [Ust...    62   8e-09
gi|31204099|ref|XP_310998.1| ENSANGP00000019908 [Anopheles gambi...    62   8e-09
gi|38101490|gb|EAA48445.1| hypothetical protein MG00103.4 [Magna...    62   8e-09
gi|19112570|ref|NP_595778.1| ubiquitin-conjugating enzyme e2-18 ...    62   8e-09
gi|46442744|gb|EAL02031.1| hypothetical protein CaO19.13882 [Can...    62   8e-09
gi|22597164|gb|AAN03469.1| ubiquitin-conjugation enzyme [Glycine...    62   1e-08
gi|42734055|gb|AAS38927.1| similar to Drosophila melanogaster (F...    62   1e-08
gi|49067948|ref|XP_398263.1| hypothetical protein UM00648.1 [Ust...    62   1e-08
gi|17946312|gb|AAL49196.1| RE63412p [Drosophila melanogaster] >g...    62   1e-08
gi|50540266|ref|NP_001002600.1| zgc:92307 [Danio rerio] >gnl|BL_...    62   1e-08
gi|27696459|gb|AAH44029.1| Hspc150-prov protein [Xenopus laevis]       62   1e-08
gi|49128246|ref|XP_412839.1| hypothetical protein AN8702.2 [Aspe...    62   1e-08
gi|50755162|ref|XP_414634.1| PREDICTED: similar to ubiquitin con...    62   1e-08
gi|50547641|ref|XP_501290.1| hypothetical protein [Yarrowia lipo...    62   1e-08
gi|20984341|ref|XP_135925.1| similar to Ubiquitin-conjugating en...    62   1e-08
gi|23508735|ref|NP_701403.1| ubiquitin-conjugating enzyme e2, pu...    62   1e-08
gi|49091604|ref|XP_407263.1| hypothetical protein AN3126.2 [Aspe...    62   1e-08
gi|2136341|pir||A49630 ubiquitin conjugating enzyme - human (fra...    62   1e-08
gi|50746901|ref|XP_420667.1| PREDICTED: similar to ubiquitin-con...    61   2e-08
gi|20086317|gb|AAM08126.1| elicitor and UV light related transcr...    61   2e-08
gi|7020506|dbj|BAA91156.1| unnamed protein product [Homo sapiens]      61   2e-08
gi|25293673|pir||D96541 hypothetical protein F17J6.3 [imported] ...    61   2e-08
gi|39592473|emb|CAE63550.1| Hypothetical protein CBG08036 [Caeno...    61   2e-08
gi|7510549|pir||T27463 hypothetical protein Y87G2A.k - Caenorhab...    61   2e-08
gi|3212324|pdb|1A3S|  Human Ubc9                                       61   2e-08
gi|9454557|gb|AAF87880.1| Putative ubiquitin carrier protein [Ar...    61   2e-08
gi|30693871|ref|NP_568595.2| ubiquitin-conjugating enzyme 8 (UBC...    61   2e-08
gi|3004909|gb|AAC32312.1| ubiquitin conjugating enzyme G2 [Homo ...    61   2e-08
gi|19347859|gb|AAL85988.1| putative E2, ubiquitin-conjugating en...    61   2e-08
gi|24656930|ref|NP_647823.1| CG10862-PA [Drosophila melanogaster...    61   2e-08
gi|34873479|ref|XP_220902.2| similar to hypothetical protein FLJ...    61   2e-08
gi|18412149|ref|NP_565192.1| ubiquitin-conjugating enzyme, putat...    61   2e-08
gi|23487093|gb|EAA20958.1| ubiquitin conjugating enzyme [Plasmod...    61   2e-08
gi|33149324|ref|NP_871622.1| ubiquitin-conjugating enzyme E2D 3 ...    61   2e-08
gi|45201217|ref|NP_986787.1| AGR121Cp [Eremothecium gossypii] >g...    60   3e-08
gi|38048399|gb|AAR10102.1| similar to Drosophila melanogaster cr...    60   3e-08
gi|27717493|ref|XP_216827.1| similar to cell division cycle 34; ...    60   3e-08
gi|29243988|ref|NP_808281.1| cell division cycle 34 homolog [Mus...    60   3e-08
gi|16357477|ref|NP_004350.1| cell division cycle 34; ubiquitin-c...    60   3e-08
gi|29246580|gb|EAA38171.1| GLP_675_13414_12824 [Giardia lamblia ...    60   3e-08
gi|50259390|gb|EAL22063.1| hypothetical protein CNBC2010 [Crypto...    60   3e-08
gi|30584917|gb|AAP36715.1| Homo sapiens cell division cycle 34 [...    60   3e-08
gi|32404624|ref|XP_322925.1| hypothetical protein ( (AL513444) p...    60   3e-08
gi|11272355|pir||T43235 ubiquitin-conjugating enzyme ubcP3 - fis...    60   3e-08
gi|25010062|gb|AAN71196.1| GH25305p [Drosophila melanogaster]          60   4e-08
gi|2612962|gb|AAB84397.1| ubiquitin-conjugating enzyme [Drosophi...    60   4e-08
gi|48094959|ref|XP_394314.1| similar to ENSANGP00000014351 [Apis...    60   4e-08
gi|6010087|emb|CAB57250.1| putative ubiquitin carrier [Entodiniu...    60   4e-08
gi|17136904|ref|NP_476978.1| CG3018-PA [Drosophila melanogaster]...    60   4e-08
gi|50732762|ref|XP_418751.1| PREDICTED: similar to ubiquitin-con...    60   4e-08
gi|30583869|gb|AAP36183.1| Homo sapiens ubiquitin-conjugating en...    60   5e-08
gi|31197971|ref|XP_307933.1| ENSANGP00000021824 [Anopheles gambi...    60   5e-08
gi|40363447|dbj|BAD06214.1| ubiquitin conjugating enzyme E2 [Xen...    60   5e-08
gi|34911052|ref|NP_916873.1| ubiquitin-conjugating enzyme E2 [Or...    60   5e-08
gi|41151648|ref|XP_372257.1| similar to ubiquitin-conjugating en...    60   5e-08
gi|5902146|ref|NP_008950.1| ubiquitin-conjugating enzyme E2C iso...    60   5e-08
gi|34393509|dbj|BAC83070.1| putative elicitor inducible beta-1,3...    60   5e-08
gi|23612144|ref|NP_703724.1| ubiquitin-conjugating enzyme E2, pu...    60   5e-08
gi|37606125|emb|CAE50620.1| SI:zK83D9.5 (novel protein similar t...    60   5e-08
gi|47087229|ref|NP_998695.1| zgc:55321 [Danio rerio] >gnl|BL_ORD...    60   5e-08
gi|23394373|gb|AAN31476.1| ubiquitin-conjugating enzyme [Phytoph...    60   5e-08
gi|34911986|ref|NP_917340.1| P0694A04.26 [Oryza sativa (japonica...    59   6e-08
gi|18394416|ref|NP_564011.1| ubiquitin-conjugating enzyme, putat...    59   6e-08
gi|50728482|ref|XP_416140.1| PREDICTED: similar to Ube2n protein...    59   6e-08
gi|50548071|ref|XP_501505.1| hypothetical protein [Yarrowia lipo...    59   6e-08
gi|14719686|pdb|1JAT|A Chain A, Mms2UBC13 UBIQUITIN CONJUGATING ...    59   6e-08
gi|19075569|ref|NP_588069.1| ubiquitin conjugating enzyme [Schiz...    59   6e-08
gi|50368789|gb|AAH76753.1| Unknown (protein for MGC:82328) [Xeno...    59   6e-08
gi|50752092|ref|XP_422648.1| PREDICTED: similar to ubiquitin-con...    59   6e-08
gi|13385530|ref|NP_080300.1| RIKEN cDNA 2700084L22 [Mus musculus...    59   6e-08
gi|3915196|sp|Q95044|UBCB_SPISO Ubiquitin-conjugating enzyme E2-...    59   8e-08
gi|3347990|gb|AAC27763.1| ubiquitin-conjugating enzyme protein U...    59   8e-08
gi|47226000|emb|CAG04374.1| unnamed protein product [Tetraodon n...    59   8e-08
gi|4507785|ref|NP_003336.1| ubiquitin-conjugating enzyme E2I; SU...    59   8e-08
gi|25293666|pir||B96818 hypothetical protein F9K20.8 [imported] ...    59   8e-08
gi|50539720|ref|NP_001002330.1| zgc:92419 [Danio rerio] >gnl|BL_...    59   8e-08
gi|38086699|ref|XP_136032.2| similar to ubiquitin-conjugating en...    59   8e-08
gi|26344497|dbj|BAC35899.1| unnamed protein product [Mus musculus]     59   8e-08
gi|50306051|ref|XP_452987.1| unnamed protein product [Kluyveromy...    59   8e-08
gi|30584109|gb|AAP36303.1| Homo sapiens ubiquitin-conjugating en...    59   8e-08
gi|20150955|pdb|1KPS|A Chain A, Structural Basis For E2-Mediated...    59   8e-08
gi|34852367|ref|XP_215371.2| similar to ubiquitin-conjugating en...    59   8e-08
gi|30584321|gb|AAP36409.1| Homo sapiens ubiquitin-conjugating en...    59   8e-08
gi|30582859|gb|AAP35656.1| ubiquitin-conjugating enzyme E2I (UBC...    59   8e-08
gi|2194010|pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzym...    59   8e-08
gi|4388942|pdb|2E2C|  E2-C, An Ubiquitin Conjugating Enzyme Requ...    59   8e-08
gi|30584075|gb|AAP36286.1| Homo sapiens ubiquitin-conjugating en...    59   8e-08
gi|49067328|ref|XP_397954.1| hypothetical protein UM00339.1 [Ust...    59   8e-08
gi|25293664|pir||D96666 protein F22C12.2 [imported] - Arabidopsi...    59   8e-08
gi|20806111|ref|NP_062777.2| ubiquitin-conjugating enzyme E2G 2;...    59   8e-08
gi|50288567|ref|XP_446713.1| unnamed protein product [Candida gl...    59   8e-08
gi|18859521|ref|NP_571908.1| ubiquitin-conjugating enzyme E2I2 [...    59   8e-08
gi|29841409|gb|AAP06441.1| similar to NM_007019 ubiquitin-conjug...    59   1e-07
gi|1463033|gb|AAC50603.1| ubiquitin-conjugating enzyme 9 (UBC9)        59   1e-07
gi|33359691|ref|NP_872607.1| ubiquitin-conjugating enzyme E2E 1 ...    59   1e-07
gi|46226745|gb|EAK87724.1| ubiquitin-conjugating enzyme [Cryptos...    59   1e-07
gi|13786748|pdb|1I7K|A Chain A, Crystal Structure Of Human Mitot...    59   1e-07
gi|6320297|ref|NP_010377.1| Ubiquitin-conjugating enzyme involve...    59   1e-07
gi|17536739|ref|NP_494717.1| predicted CDS, putative cytoplasmic...    58   1e-07
gi|481811|pir||S39483 ubiquitin-conjugating enzyme UBC2-1 - Arab...    58   1e-07
gi|18859523|ref|NP_571426.1| ubiquitin-conjugating enzyme E2I; u...    58   1e-07
gi|50258359|gb|EAL21048.1| hypothetical protein CNBD4240 [Crypto...    58   1e-07
gi|28189903|dbj|BAC56566.1| similar to phosphoarginine phosphata...    58   1e-07
gi|17556414|ref|NP_497624.1| predicted CDS, putative protein, wi...    58   1e-07
gi|27704688|ref|XP_215924.1| similar to ubiquitin-conjugating en...    58   1e-07
gi|29245557|gb|EAA37189.1| GLP_243_16653_17147 [Giardia lamblia ...    58   1e-07
gi|47210823|emb|CAF90880.1| unnamed protein product [Tetraodon n...    58   1e-07
gi|32566270|ref|NP_500177.2| predicted CDS, putative protein fam...    58   1e-07
gi|46138581|ref|XP_390981.1| UBC1_COLGL Ubiquitin-conjugating en...    58   1e-07
gi|2501430|sp|O09181|UBCI_MESAU Ubiquitin-like protein SUMO-1 co...    58   2e-07
gi|18401461|ref|NP_564493.1| ubiquitin-conjugating enzyme 15 (UB...    58   2e-07
gi|6324915|ref|NP_014984.1| Ubiquitin-conjugating enzyme most si...    58   2e-07
gi|23613728|ref|NP_704749.1| ubiquitin conjugating enzyme E2, pu...    58   2e-07
gi|50422541|ref|XP_459842.1| unnamed protein product [Debaryomyc...    58   2e-07
gi|23613292|ref|NP_703614.1| ubiquitin-conjugating enzyme, putat...    58   2e-07
gi|21623510|dbj|BAC00866.1| ubiquitin-conjugating enzyme [Brachi...    57   2e-07
gi|46441146|gb|EAL00445.1| hypothetical protein CaO19.7571 [Cand...    57   2e-07
gi|46227653|gb|EAK88588.1| ubiquitin conjugating enzyme [Cryptos...    57   2e-07
gi|31542455|ref|NP_758504.2| hypothetical protein LOC268470 [Mus...    57   2e-07
gi|49089228|ref|XP_406349.1| hypothetical protein AN2212.2 [Aspe...    57   2e-07
gi|18410856|ref|NP_565110.1| ubiquitin-conjugating enzyme 16 (UB...    57   2e-07
gi|18308140|gb|AAL67839.1| putative ubiquitin [Pinus pinaster]         57   2e-07
gi|49387540|dbj|BAD25096.1| putative ubiquitin-conjugating enzym...    57   2e-07
gi|31201253|ref|XP_309574.1| ENSANGP00000003964 [Anopheles gambi...    57   2e-07
gi|6097072|dbj|BAA85660.1| cyclin-selective ubiquitin carrier pr...    57   2e-07
gi|24646683|ref|NP_650309.1| CG9602-PA [Drosophila melanogaster]...    57   2e-07
gi|37589398|gb|AAH59343.1| MGC69155 protein [Xenopus laevis]           57   3e-07
gi|12751495|ref|NP_075567.1| hypothetical protein FLJ13855 [Homo...    57   3e-07
gi|47211014|emb|CAF95528.1| unnamed protein product [Tetraodon n...    57   3e-07
gi|46438455|gb|EAK97785.1| hypothetical protein CaO19.933 [Candi...    57   3e-07
gi|46431269|gb|EAK90863.1| hypothetical protein CaO19.2225 [Cand...    57   3e-07
gi|7661808|ref|NP_054895.1| HSPC150 protein similar to ubiquitin...    57   3e-07
gi|20862207|ref|XP_141534.1| ubiquitin-conjugating enzyme E2C [M...    57   3e-07
gi|47228625|emb|CAG07357.1| unnamed protein product [Tetraodon n...    57   3e-07
gi|50257543|gb|EAL20248.1| hypothetical protein CNBF0600 [Crypto...    57   3e-07
gi|23484233|gb|EAA19635.1| putative ubiquitin-conjugating enzyme...    57   3e-07
gi|34897008|ref|NP_909850.1| putative ubiquitin-conjugating enzy...    57   3e-07
gi|30699363|ref|NP_849902.1| ubiquitin-conjugating enzyme, putat...    57   4e-07
gi|46136229|ref|XP_389806.1| hypothetical protein FG09630.1 [Gib...    57   4e-07
gi|7688217|emb|CAB89853.1| dJ680N4.2 (ubiquitin-conjugating enzy...    57   4e-07
gi|17510385|ref|NP_490761.1| eukaryotic translation initiation f...    57   4e-07
gi|19113031|ref|NP_596239.1| ubiquitin-conjugating enzyme [Schiz...    57   4e-07
gi|46116380|ref|XP_384208.1| hypothetical protein FG04032.1 [Gib...    57   4e-07
gi|49076336|ref|XP_402157.1| hypothetical protein UM04542.1 [Ust...    57   4e-07
gi|27371275|gb|AAH41263.1| MGC52831 protein [Xenopus laevis]           57   4e-07
gi|19111870|ref|NP_595078.1| putative ubiquitin conjugating enzy...    57   4e-07
gi|2801444|gb|AAC39325.1| ubiquitin-conjugating enzyme 16 [Arabi...    56   5e-07
gi|49084306|ref|XP_404363.1| hypothetical protein AN0226.2 [Aspe...    56   5e-07
gi|34880242|ref|XP_341125.1| similar to RIKEN cDNA 2700084L22 [R...    56   5e-07
gi|32425438|gb|AAH15169.2| FLJ13855 protein [Homo sapiens]             56   5e-07
gi|18420949|ref|NP_568476.1| ubiquitin-conjugating enzyme, putat...    56   5e-07
gi|2130087|pir||S61417 ubiquitin-protein ligase (EC 6.3.2.19) - ...    56   5e-07
gi|47226201|emb|CAG08348.1| unnamed protein product [Tetraodon n...    56   5e-07
gi|32440939|dbj|BAC78820.1| ubiquitin-conjugating enzyme9 [Copri...    56   7e-07
gi|50418605|ref|XP_457821.1| unnamed protein product [Debaryomyc...    56   7e-07
gi|7494269|pir||T18512 hypothetical protein C0855w - malaria par...    56   7e-07
gi|16805277|ref|NP_473305.1| ubiquitin-conjugating enzyme, putat...    56   7e-07
gi|19115771|ref|NP_594859.1| ubiquitin-conjugating enzyme e2-16 ...    55   9e-07
gi|47212904|emb|CAF90794.1| unnamed protein product [Tetraodon n...    55   9e-07
gi|18424219|ref|NP_568902.1| ubiquitin-conjugating enzyme 7 (UBC...    55   9e-07
gi|37536440|ref|NP_922522.1| putative ubiquitin-conjugating enzy...    55   9e-07
gi|37719049|emb|CAE45567.1| SUMO E2 conjugating enzyme SCE1 [Nic...    55   9e-07
gi|12311787|emb|CAC24487.1| putative ubiquitin-conjugating enzym...    55   1e-06
gi|34391575|gb|AAN46746.1| E2 ubiquitin-conjugating enzyme UbcH5...    55   1e-06
gi|18398208|ref|NP_566332.1| ubiquitin-conjugating enzyme, putat...    55   1e-06
gi|7488595|pir||T14451 ubiquitin conjugating enzyme, E2 - wild c...    55   1e-06
gi|3915189|sp|P56616|UBCB_XENLA Ubiquitin-conjugating enzyme X (...    55   1e-06
gi|48095539|ref|XP_394467.1| similar to ENSANGP00000020629 [Apis...    55   1e-06
gi|23491070|gb|EAA22697.1| probable ubiquitin-conjugating enzyme...    55   1e-06
gi|16041138|dbj|BAB69736.1| hypothetical protein [Macaca fascicu...    55   1e-06
gi|26376813|dbj|BAC25019.1| unnamed protein product [Mus musculus]     55   2e-06
gi|27675436|ref|XP_214806.1| similar to RIKEN cDNA 6720465F12 [R...    55   2e-06
gi|19527004|ref|NP_598538.1| ubiquitin-conjugating enzyme E2S [M...    55   2e-06
gi|31216813|ref|XP_316306.1| ENSANGP00000020629 [Anopheles gambi...    55   2e-06
gi|34912446|ref|NP_917570.1| P0681B11.27 [Oryza sativa (japonica...    55   2e-06
gi|37779120|gb|AAP20220.1| ubiquitin-conjugating enzyme E2I [Pag...    54   2e-06
gi|18422281|ref|NP_568619.1| ubiquitin-conjugating enzyme 18 (UB...    54   2e-06
gi|7657046|ref|NP_055316.1| ubiquitin carrier protein; ubiquitin...    54   2e-06
gi|345829|pir||B42856 ubiquitin carrier protein E2 - human             54   2e-06
gi|23829978|sp|Q16763|UBCE_HUMAN Ubiquitin-conjugating enzyme E2...    54   2e-06
gi|26339210|dbj|BAC33276.1| unnamed protein product [Mus musculus]     54   2e-06
gi|40363451|dbj|BAD06216.1| ubiquitin conjugating enzyme E2 [Xen...    54   2e-06
gi|13489085|ref|NP_003333.1| ubiquitin-conjugating enzyme E2G 1 ...    54   2e-06
gi|30585349|gb|AAP36947.1| Homo sapiens ubiquitin-conjugating en...    54   2e-06
gi|41054097|ref|NP_956157.1| ubiquitin-conjugating enzyme E2G 1;...    54   2e-06
gi|49074318|ref|XP_401301.1| hypothetical protein UM03686.1 [Ust...    54   2e-06
gi|7509722|pir||T26773 hypothetical protein Y39G8C.a - Caenorhab...    54   3e-06
gi|31240017|ref|XP_320422.1| ENSANGP00000009198 [Anopheles gambi...    54   3e-06


>gi|17537739|ref|NP_494397.1| ubiquitin conjugating enzyme (24.5 kD)
           (ubc-15) [Caenorhabditis elegans]
 gi|14625313|gb|AAF60411.2| Ubiquitin conjugating enzyme protein 15
           [Caenorhabditis elegans]
          Length = 218

 Score =  471 bits (1213), Expect = e-132
 Identities = 218/218 (100%), Positives = 218/218 (100%)
 Frame = -1

Query: 657 MLNLGPGVSVPAAGTASSSAVRRLQKDYAKLMQDPVDGIKALPNEDNILEWHYCLRGSPD 478
           MLNLGPGVSVPAAGTASSSAVRRLQKDYAKLMQDPVDGIKALPNEDNILEWHYCLRGSPD
Sbjct: 1   MLNLGPGVSVPAAGTASSSAVRRLQKDYAKLMQDPVDGIKALPNEDNILEWHYCLRGSPD 60

Query: 477 TPFYGGYYWGKVIFKENFPWSPPAITMITPNGRFQTNTRLCLSISDYHPESWNPGWTVSA 298
           TPFYGGYYWGKVIFKENFPWSPPAITMITPNGRFQTNTRLCLSISDYHPESWNPGWTVSA
Sbjct: 61  TPFYGGYYWGKVIFKENFPWSPPAITMITPNGRFQTNTRLCLSISDYHPESWNPGWTVSA 120

Query: 297 ILIGLHSFMNENSPAAGSIAGTPQDQRMYAAASKEFNVKVYNWNLAGNPHCNFFLTRDEE 118
           ILIGLHSFMNENSPAAGSIAGTPQDQRMYAAASKEFNVKVYNWNLAGNPHCNFFLTRDEE
Sbjct: 121 ILIGLHSFMNENSPAAGSIAGTPQDQRMYAAASKEFNVKVYNWNLAGNPHCNFFLTRDEE 180

Query: 117 KWFLGHGRGADKFHRPFILLCFPPVFFCFSSIFPVFSY 4
           KWFLGHGRGADKFHRPFILLCFPPVFFCFSSIFPVFSY
Sbjct: 181 KWFLGHGRGADKFHRPFILLCFPPVFFCFSSIFPVFSY 218




[DB home][top]