Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y111B2A_13
(642 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17556687|ref|NP_499643.1| angio-associated migratory cell pro... 404 e-111
gi|39580905|emb|CAE72837.1| Hypothetical protein CBG20127 [Caeno... 306 2e-82
gi|47220976|emb|CAF98205.1| unnamed protein product [Tetraodon n... 122 4e-27
gi|34876801|ref|XP_217441.2| similar to angio-associated migrato... 118 1e-25
gi|4557229|ref|NP_001078.1| angio-associated, migratory cell pro... 117 1e-25
gi|31044189|gb|AAO38199.1| angio-associated migratory cell prote... 117 1e-25
gi|33874730|gb|AAH14122.1| AAMP protein [Homo sapiens] 117 1e-25
gi|18044384|gb|AAH20244.1| Similar to angio-associated, migrator... 117 1e-25
gi|22122619|ref|NP_666222.1| angio-associated migratory protein ... 116 3e-25
gi|50418219|gb|AAH77271.1| Unknown (protein for MGC:80037) [Xeno... 110 3e-23
gi|48097590|ref|XP_393830.1| similar to Angio-associated migrato... 108 1e-22
gi|47086159|ref|NP_998103.1| hypothetical protein zgc:85939 [Dan... 106 4e-22
gi|49901158|gb|AAH76126.1| Unknown (protein for MGC:92640) [Dani... 103 3e-21
gi|21358407|ref|NP_648731.1| CG5114-PA [Drosophila melanogaster]... 101 1e-20
gi|49081056|ref|XP_403977.1| hypothetical protein UM06362.1 [Ust... 100 2e-20
gi|39644832|gb|AAH08809.2| AAMP protein [Homo sapiens] 99 5e-20
gi|30698820|ref|NP_177329.2| transducin family protein / WD-40 r... 85 1e-15
gi|31195843|ref|XP_306869.1| ENSANGP00000013761 [Anopheles gambi... 85 1e-15
gi|31227743|ref|XP_317937.1| ENSANGP00000011371 [Anopheles gambi... 84 2e-15
gi|50872460|gb|AAT85060.1| WD domain, G-beta repeat containing p... 83 5e-15
gi|13174235|gb|AAK14409.1| putative angio-associated migratory c... 82 7e-15
gi|25406125|pir||A96741 hypothetical protein F14O23.22 [imported... 79 7e-14
gi|50547737|ref|XP_501338.1| hypothetical protein [Yarrowia lipo... 70 4e-11
gi|19114724|ref|NP_593812.1| hypothetical wd-40 repeat protein [... 67 2e-10
gi|49110822|ref|XP_411767.1| hypothetical protein AN7630.2 [Aspe... 60 3e-08
gi|25402650|pir||E86245 hypothetical protein [imported] - Arabid... 59 8e-08
gi|50260286|gb|EAL22945.1| hypothetical protein CNBA7130 [Crypto... 59 8e-08
gi|29247087|gb|EAA38661.1| GLP_59_34849_36189 [Giardia lamblia A... 58 2e-07
gi|50307559|ref|XP_453759.1| unnamed protein product [Kluyveromy... 57 2e-07
gi|42562854|ref|NP_176316.3| WD-40 repeat family protein / katan... 56 7e-07
gi|50260356|gb|EAL23015.1| hypothetical protein CNBA7820 [Crypto... 55 1e-06
gi|48892224|ref|ZP_00325622.1| COG2319: FOG: WD40 repeat [Tricho... 55 1e-06
gi|32398937|emb|CAD98402.1| hypothetical predicted WD-40 repeat ... 53 4e-06
gi|30688988|ref|NP_851064.1| transducin family protein / WD-40 r... 53 4e-06
gi|30688991|ref|NP_197734.2| transducin family protein / WD-40 r... 53 4e-06
gi|45201338|ref|NP_986908.1| AGR242Cp [Eremothecium gossypii] >g... 53 6e-06
gi|18415801|ref|NP_568194.1| transducin family protein / WD-40 r... 52 7e-06
gi|12845754|dbj|BAB26884.1| unnamed protein product [Mus musculus] 52 7e-06
gi|12655011|gb|AAH01353.1| Katanin p80 subunit B 1 [Homo sapiens... 52 7e-06
gi|27694663|gb|AAH43772.1| Katnb1-prov protein [Xenopus laevis] 52 7e-06
gi|26329699|dbj|BAC28588.1| unnamed protein product [Mus musculu... 52 7e-06
gi|26327487|dbj|BAC27487.1| unnamed protein product [Mus musculus] 52 7e-06
gi|30584393|gb|AAP36445.1| Homo sapiens katanin p80 (WD40-contai... 52 7e-06
gi|25404314|pir||A96638 hypothetical protein F11P17.7 [imported]... 52 1e-05
gi|50414726|gb|AAH77273.1| Unknown (protein for IMAGE:4031030) [... 52 1e-05
gi|50421067|ref|XP_459078.1| unnamed protein product [Debaryomyc... 52 1e-05
gi|47085751|ref|NP_998183.1| zgc:56071 [Danio rerio] >gnl|BL_ORD... 52 1e-05
gi|5031817|ref|NP_005877.1| katanin p80 subunit B 1; katanin (80... 51 2e-05
gi|415402|emb|CAA53516.1| unnamed protein product [Saccharomyces... 51 2e-05
gi|6322202|ref|NP_012277.1| Involved in a late step of 60S ribos... 51 2e-05
gi|9759081|dbj|BAB09559.1| unnamed protein product [Arabidopsis ... 50 4e-05
gi|23128236|ref|ZP_00110089.1| COG2319: FOG: WD40 repeat [Nostoc... 48 1e-04
gi|32422465|ref|XP_331676.1| hypothetical protein [Neurospora cr... 48 2e-04
gi|31242705|ref|XP_321783.1| ENSANGP00000016766 [Anopheles gambi... 48 2e-04
gi|29841245|gb|AAP06277.1| similar to NM_079059 GTP-binding-prot... 47 2e-04
gi|15220302|ref|NP_172582.1| WD-40 repeat family protein / katan... 47 4e-04
gi|50293559|ref|XP_449191.1| unnamed protein product [Candida gl... 47 4e-04
gi|48139947|ref|XP_397060.1| similar to ENSANGP00000016766 [Apis... 46 5e-04
gi|49124494|ref|XP_412605.1| hypothetical protein AN8468.2 [Aspe... 46 5e-04
gi|48893278|ref|ZP_00326547.1| COG0515: Serine/threonine protein... 46 5e-04
gi|13625467|gb|AAK35068.1| LACK protective antigen [Leishmania d... 46 7e-04
gi|49084494|ref|XP_404442.1| hypothetical protein AN0305.2 [Aspe... 46 7e-04
gi|15289878|dbj|BAB63574.1| P0010B10.21 [Oryza sativa (japonica ... 45 0.001
gi|24644361|ref|NP_730982.1| CG1109-PA [Drosophila melanogaster]... 45 0.001
gi|50728530|ref|XP_416163.1| PREDICTED: similar to neural precur... 45 0.002
gi|47209290|emb|CAF89573.1| unnamed protein product [Tetraodon n... 45 0.002
gi|47214359|emb|CAG01204.1| unnamed protein product [Tetraodon n... 45 0.002
gi|34878620|ref|XP_226076.2| similar to putative WDC146 [Rattus ... 44 0.002
gi|26341404|dbj|BAC34364.1| unnamed protein product [Mus musculus] 44 0.002
gi|19923529|ref|NP_060853.2| WD repeat domain 33 [Homo sapiens] ... 44 0.002
gi|3023856|sp|Q27434|GBLP_LEICH Guanine nucleotide-binding prote... 44 0.002
gi|2662479|gb|AAB88301.1| LACK [Leishmania braziliensis] >gnl|BL... 44 0.002
gi|50751913|ref|XP_422575.1| PREDICTED: similar to WD repeat dom... 44 0.002
gi|13991860|gb|AAK51530.1| p36 LACK protein [Leishmania amazonen... 44 0.002
gi|2662477|gb|AAB88300.1| LACK [Leishmania major] >gnl|BL_ORD_ID... 44 0.002
gi|21362285|ref|NP_083142.2| WD repeat domain 33 [Mus musculus] ... 44 0.002
gi|37522390|ref|NP_925767.1| WD-repeat protein [Gloeobacter viol... 44 0.003
gi|3122601|sp|P93107|PF20_CHLRE Flagellar WD-repeat protein PF20... 44 0.003
gi|46561762|gb|AAT01086.1| putative activated protein kinase C r... 44 0.003
gi|38089557|ref|XP_134311.2| katanin p80 (WD40-containing) subun... 44 0.003
gi|18859301|ref|NP_571519.1| guanine nucleotide binding protein ... 44 0.003
gi|3023855|sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding prote... 44 0.003
gi|28828113|gb|AAO50796.1| similar to Anabaena sp. (strain PCC 7... 44 0.003
gi|18543331|ref|NP_570090.1| guanine nucleotide binding protein,... 44 0.003
gi|50261761|gb|AAT72461.1| FY protein [Lolium perenne] 44 0.003
gi|11139411|gb|AAG31685.1| activated protein kinase C receptor L... 43 0.006
gi|206297|gb|AAA41909.1| protein phosphatase 2A 55 kD regulatory... 43 0.006
gi|32473974|ref|NP_866968.1| WD40 repeat protein [Pirellula sp. ... 43 0.006
gi|5326785|gb|AAD42045.1| activated protein kinase C receptor; R... 43 0.006
gi|3023850|sp|O42249|GBLP_ORENI Guanine nucleotide-binding prote... 43 0.006
gi|27371211|gb|AAH41541.1| Gnb2l1-prov protein [Xenopus laevis] 43 0.006
gi|37498964|gb|AAQ91574.1| receptor for activated protein kinase... 43 0.006
gi|49523265|gb|AAH75435.1| Unknown (protein for MGC:89209) [Xeno... 43 0.006
gi|46443880|gb|EAL03159.1| hypothetical protein CaO19.4029 [Cand... 42 0.008
gi|29465691|gb|AAL99251.1| TupA protein [Penicillium marneffei] 42 0.008
gi|24649265|ref|NP_651136.1| CG4448-PA [Drosophila melanogaster]... 42 0.010
gi|45773816|gb|AAS76712.1| At5g13480 [Arabidopsis thaliana] 42 0.010
gi|30025862|gb|AAP04406.1| G-protein beta subunit like-protein [... 42 0.010
gi|39582726|emb|CAE65932.1| Hypothetical protein CBG11105 [Caeno... 42 0.010
gi|45384758|gb|AAS59422.1| G-protein beta subunit like-protein [... 42 0.010
gi|30585331|gb|AAP36938.1| Homo sapiens guanine nucleotide bindi... 42 0.010
gi|9955540|emb|CAC05425.1| putative protein [Arabidopsis thaliana] 42 0.010
gi|12848861|dbj|BAB28114.1| unnamed protein product [Mus musculus] 42 0.010
gi|42567822|ref|NP_196852.2| WD-40 repeat family protein [Arabid... 42 0.010
gi|17225206|gb|AAL37299.1| beta transducin-like protein HET-E2C*... 42 0.010
gi|5174447|ref|NP_006089.1| guanine nucleotide binding protein (... 42 0.010
gi|17225204|gb|AAL37298.1| beta transducin-like protein HET-E2C ... 42 0.013
gi|17225208|gb|AAL37300.1| beta transducin-like protein HET-E2C*... 42 0.013
gi|19571763|emb|CAD27805.1| wdc146 [Tetraodon nigroviridis] 41 0.017
gi|49079960|ref|XP_403564.1| hypothetical protein UM05949.1 [Ust... 41 0.017
gi|49619007|gb|AAT68088.1| FLJ11294-like [Danio rerio] 41 0.017
gi|41054269|ref|NP_956070.1| Unknown (protein for MGC:63780); wu... 41 0.017
gi|13991907|gb|AAK51552.1| receptor for activated protein kinase... 41 0.017
gi|28201165|dbj|BAC56715.1| receptor for activated protein kinas... 41 0.017
gi|38083170|ref|XP_359298.1| similar to KIAA0590 gene product [M... 41 0.017
gi|50419399|ref|XP_458225.1| unnamed protein product [Debaryomyc... 41 0.017
gi|49075718|ref|XP_401906.1| hypothetical protein UM04291.1 [Ust... 41 0.017
gi|17535491|ref|NP_496985.1| trp-asp repeats containing protein ... 41 0.017
gi|28630243|gb|AAM88904.1| guanine nucleotide-binding protein [P... 41 0.017
gi|475012|dbj|BAA06185.1| G protein beta subuit like [Mus musculus] 41 0.017
gi|48891596|ref|ZP_00325089.1| COG0515: Serine/threonine protein... 41 0.022
gi|15229187|ref|NP_190535.1| transducin family protein / WD-40 r... 41 0.022
gi|17227974|ref|NP_484522.1| WD-40 repeat protein [Nostoc sp. PC... 40 0.029
gi|11066216|gb|AAG28504.1| TUPA [Emericella nidulans] 40 0.029
gi|23097254|ref|NP_690869.1| neural precursor cell expressed, de... 40 0.029
gi|21752027|dbj|BAC04099.1| unnamed protein product [Homo sapiens] 40 0.029
gi|49098364|ref|XP_410642.1| hypothetical protein AN6505.2 [Aspe... 40 0.029
gi|50755379|ref|XP_414722.1| PREDICTED: similar to mKIAA1924 pro... 40 0.038
gi|24652458|ref|NP_610589.2| CG12892-PA [Drosophila melanogaster... 40 0.038
gi|13569829|gb|AAK31264.1| chromatin assembly factor-1 p105 subu... 40 0.038
gi|34870543|ref|XP_220234.2| similar to KIAA0590 [Rattus norvegi... 40 0.038
gi|23124949|ref|ZP_00106905.1| COG2319: FOG: WD40 repeat [Nostoc... 40 0.050
gi|24651075|ref|NP_651702.1| CG7568-PA [Drosophila melanogaster]... 40 0.050
gi|31236053|ref|XP_319347.1| ENSANGP00000012560 [Anopheles gambi... 40 0.050
gi|47507401|gb|AAH70965.1| PP2A protein [Xenopus laevis] 39 0.065
gi|46435714|gb|EAK95090.1| hypothetical protein CaO19.8219 [Cand... 39 0.065
gi|47679343|gb|AAT36652.1| Tup1p [Exophiala dermatitidis] 39 0.065
gi|24652561|ref|NP_610618.1| CG12325-PA [Drosophila melanogaster... 39 0.065
gi|22329107|ref|NP_195025.2| transducin family protein / WD-40 r... 39 0.065
gi|7512187|pir||S65951 [phosphorylase] phosphatase (EC 3.1.3.17)... 39 0.065
gi|963087|emb|CAA56714.1| phosphorylase phosphatase [Xenopus lae... 39 0.065
gi|47222028|emb|CAG08283.1| unnamed protein product [Tetraodon n... 39 0.065
gi|31242579|ref|XP_321720.1| ENSANGP00000015224 [Anopheles gambi... 39 0.065
gi|47205447|emb|CAG14617.1| unnamed protein product [Tetraodon n... 39 0.085
gi|47205197|emb|CAG14614.1| unnamed protein product [Tetraodon n... 39 0.085
gi|19075440|ref|NP_587940.1| WD repeat protein [Schizosaccharomy... 39 0.085
gi|17533163|ref|NP_495256.1| transducin protein (103.2 kD) (2G56... 39 0.085
gi|19112474|ref|NP_595682.1| pop3, a WD repeat protein [Schizosa... 39 0.085
gi|50309847|ref|XP_454937.1| unnamed protein product [Kluyveromy... 39 0.085
gi|48142179|ref|XP_393586.1| similar to ENSANGP00000021406 [Apis... 39 0.085
gi|30679647|ref|NP_671857.2| transducin family protein / WD-40 r... 39 0.085
gi|26452438|dbj|BAC43304.1| unknown protein [Arabidopsis thaliana] 39 0.085
gi|26351585|dbj|BAC39429.1| unnamed protein product [Mus musculus] 39 0.11
gi|26354867|dbj|BAC41060.1| unnamed protein product [Mus musculus] 39 0.11
gi|12846145|dbj|BAB27048.1| unnamed protein product [Mus musculu... 39 0.11
gi|6679032|ref|NP_032708.1| neural precursor cell expressed, dev... 39 0.11
gi|26339300|dbj|BAC33321.1| unnamed protein product [Mus musculus] 39 0.11
gi|45219871|gb|AAH66870.1| Neural precursor cell expressed, deve... 39 0.11
gi|17230292|ref|NP_486840.1| WD-repeat protein [Nostoc sp. PCC 7... 39 0.11
gi|462692|sp|P33215|NED1_MOUSE NEDD1 protein 39 0.11
gi|23480360|gb|EAA16941.1| putative WD-40 repeat protein [Plasmo... 39 0.11
gi|45509197|ref|ZP_00161532.1| COG2319: FOG: WD40 repeat [Anabae... 39 0.11
gi|37520744|ref|NP_924121.1| WD-repeat protein [Gloeobacter viol... 39 0.11
gi|19173438|ref|NP_597241.1| GUANINE NUCLEOTIDE BINDING PROTEIN ... 39 0.11
gi|34851232|ref|XP_214635.2| similar to katanin p80 subunit B 1;... 39 0.11
gi|47209892|emb|CAF90621.1| unnamed protein product [Tetraodon n... 39 0.11
gi|45190361|ref|NP_984615.1| AEL246Cp [Eremothecium gossypii] >g... 38 0.14
gi|7446121|pir||T02617 hypothetical protein At2g26060 [imported]... 38 0.14
gi|18401018|ref|NP_565615.1| transducin family protein / WD-40 r... 38 0.14
gi|16758910|ref|NP_446451.1| alpha isoform of regulatory subunit... 38 0.14
gi|6226620|sp|Q94775|GBLP_TRYBB Guanine nucleotide-binding prote... 38 0.14
gi|4506019|ref|NP_002708.1| alpha isoform of regulatory subunit ... 38 0.14
gi|50759516|ref|XP_417674.1| PREDICTED: similar to alpha isoform... 38 0.14
gi|38076365|ref|XP_127816.2| alpha isoform of regulatory subunit... 38 0.14
gi|12845784|dbj|BAB26898.1| unnamed protein product [Mus musculus] 38 0.14
gi|38082810|ref|XP_289894.2| similar to nedd-1 protein [Mus musc... 38 0.14
gi|21356075|ref|NP_649969.1| CG3909-PA [Drosophila melanogaster]... 38 0.14
gi|48104663|ref|XP_392962.1| similar to putative activated prote... 38 0.14
gi|45549090|ref|NP_477294.2| CG2863-PA [Drosophila melanogaster]... 38 0.19
gi|4127781|emb|CAA10070.1| Notchless protein [Drosophila melanog... 38 0.19
gi|31199241|ref|XP_308568.1| ENSANGP00000016070 [Anopheles gambi... 38 0.19
gi|6319675|ref|NP_009757.1| Subunit (90 kDa) of TFIID and SAGA c... 38 0.19
gi|3406654|gb|AAC29438.1| transcriptional repressor TUP1 [Dictyo... 38 0.19
gi|38327642|ref|NP_060176.2| hypothetical protein FLJ20195 [Homo... 38 0.19
gi|17647459|ref|NP_523783.1| CG5519-PA [Drosophila melanogaster]... 38 0.19
gi|29245522|gb|EAA37156.1| GLP_321_16418_18568 [Giardia lamblia ... 38 0.19
gi|50556994|ref|XP_505905.1| hypothetical protein [Yarrowia lipo... 38 0.19
gi|14578288|gb|AAF99454.1| PV1H14040_P [Plasmodium vivax] 37 0.25
gi|17566626|ref|NP_505737.1| WD repeat domain 5B (54.5 kD) (5L21... 37 0.25
gi|23124810|ref|ZP_00106776.1| COG2319: FOG: WD40 repeat [Nostoc... 37 0.25
gi|23129632|ref|ZP_00111458.1| COG2319: FOG: WD40 repeat [Nostoc... 37 0.25
gi|19075884|ref|NP_588384.1| notchless-like; WD repeat protein [... 37 0.25
gi|46130702|ref|XP_389131.1| hypothetical protein FG08955.1 [Gib... 37 0.25
gi|48110232|ref|XP_393123.1| similar to ENSANGP00000010832 [Apis... 37 0.25
gi|49102841|ref|XP_411097.1| hypothetical protein AN6960.2 [Aspe... 37 0.25
gi|1346729|sp|P49695|PKWA_THECU Probable serine/threonine-protei... 37 0.25
gi|48835147|ref|ZP_00292148.1| COG2319: FOG: WD40 repeat [Thermo... 37 0.25
gi|6755682|ref|NP_035629.1| serine/threonine kinase receptor ass... 37 0.32
gi|4519417|dbj|BAA75544.1| WD-40 repeat protein [Homo sapiens] 37 0.32
gi|37521534|ref|NP_924911.1| WD-repeat protein [Gloeobacter viol... 37 0.32
gi|20149592|ref|NP_009109.2| serine/threonine kinase receptor as... 37 0.32
gi|26346366|dbj|BAC36834.1| unnamed protein product [Mus musculus] 37 0.32
gi|12643951|sp|Q9Y3F4|STRA_HUMAN Serine-threonine kinase recepto... 37 0.32
gi|26344646|dbj|BAC35972.1| unnamed protein product [Mus musculus] 37 0.32
gi|45387901|ref|NP_991308.1| WD repeat and FYVE domain containin... 37 0.32
gi|23130132|ref|ZP_00111951.1| COG2319: FOG: WD40 repeat [Nostoc... 37 0.32
gi|49072776|ref|XP_400674.1| hypothetical protein UM03059.1 [Ust... 37 0.32
gi|34858563|ref|XP_216287.2| similar to UNR-interacting protein ... 37 0.32
gi|19113046|ref|NP_596254.1| transcription initiation factor TFI... 37 0.32
gi|27229061|ref|NP_080740.2| RIKEN cDNA 2410080P20 [Mus musculus... 37 0.32
gi|21220714|ref|NP_626493.1| probable serine/threonine protein k... 37 0.32
gi|48097104|ref|XP_393688.1| similar to ENSANGP00000015367 [Apis... 37 0.32
gi|16805125|ref|NP_473153.1| regulatory protein, putative [Plasm... 37 0.32
gi|39597052|emb|CAE59279.1| Hypothetical protein CBG02611 [Caeno... 37 0.32
gi|50307607|ref|XP_453783.1| unnamed protein product [Kluyveromy... 37 0.32
gi|32414251|ref|XP_327605.1| hypothetical protein [Neurospora cr... 37 0.32
gi|34910318|ref|NP_916506.1| P0013F10.18 [Oryza sativa (japonica... 37 0.42
gi|29251180|gb|EAA42664.1| GLP_487_146397_149408 [Giardia lambli... 37 0.42
gi|19401686|gb|AAL87663.1| putative coatomer protein complex I s... 37 0.42
gi|48895671|ref|ZP_00328655.1| COG0515: Serine/threonine protein... 37 0.42
gi|41281447|ref|NP_055529.2| KIAA0590 gene product [Homo sapiens... 37 0.42
gi|7513032|pir||T00345 hypothetical protein KIAA0590 - human 37 0.42
gi|50419741|ref|XP_458399.1| unnamed protein product [Debaryomyc... 37 0.42
gi|47208426|emb|CAF87493.1| unnamed protein product [Tetraodon n... 37 0.42
gi|13027436|ref|NP_076469.1| apoptotic protease activating facto... 37 0.42
gi|40788297|dbj|BAA25516.2| KIAA0590 protein [Homo sapiens] 37 0.42
gi|32399032|emb|CAD98272.1| WD40 repeat myosin-like protein [Cry... 36 0.55
gi|46229320|gb|EAK90169.1| myosin'myosin' [Cryptosporidium parvum] 36 0.55
gi|48894577|ref|ZP_00327686.1| COG2319: FOG: WD40 repeat [Tricho... 36 0.55
gi|50424771|ref|XP_460975.1| unnamed protein product [Debaryomyc... 36 0.55
gi|17539982|ref|NP_501591.1| predicted CDS, abnormal DAuer Forma... 36 0.55
gi|50305279|ref|XP_452599.1| unnamed protein product [Kluyveromy... 36 0.55
gi|34878878|ref|XP_226010.2| similar to RIKEN cDNA 2410080P20 [R... 36 0.55
gi|25396103|pir||H88772 protein F23B2.4 [imported] - Caenorhabdi... 36 0.55
gi|46122933|ref|XP_386020.1| conserved hypothetical protein [Gib... 36 0.55
gi|34394959|dbj|BAC84508.1| putative WD40 protein Ciao1 [Oryza s... 36 0.55
gi|2290597|gb|AAB72148.1| RACK1 [Drosophila melanogaster] 36 0.55
gi|17137396|ref|NP_477269.1| CG7111-PA [Drosophila melanogaster]... 36 0.55
gi|37523920|ref|NP_927297.1| WD-repeat protein [Gloeobacter viol... 36 0.55
gi|49075200|ref|XP_401682.1| hypothetical protein UM04067.1 [Ust... 36 0.55
gi|45478106|gb|AAS66224.1| LRRG00133 [Rattus norvegicus] 36 0.55
gi|31417853|gb|AAH01614.2| WD repeat domain 34 [Homo sapiens] 36 0.72
gi|16418347|ref|NP_443076.1| WD repeat domain 34 [Homo sapiens] ... 36 0.72
gi|48854377|ref|ZP_00308540.1| COG2319: FOG: WD40 repeat [Cytoph... 36 0.72
gi|31198775|ref|XP_308335.1| ENSANGP00000010753 [Anopheles gambi... 36 0.72
gi|18029281|gb|AAL56459.1| similar to retinoblastoma binding pro... 36 0.72
gi|45190337|ref|NP_984591.1| AEL269Cp [Eremothecium gossypii] >g... 36 0.72
gi|46444073|gb|EAL03350.1| hypothetical protein CaO19.4913 [Cand... 36 0.72
gi|38111235|gb|EAA56843.1| hypothetical protein MG07198.4 [Magna... 36 0.72
gi|49389014|dbj|BAD26257.1| putative NEDD1 protein [Oryza sativa... 36 0.72
gi|17225210|gb|AAL37301.1| beta transducin-like protein HET-D2Y ... 36 0.72
gi|15230244|ref|NP_188525.1| transducin family protein / WD-40 r... 36 0.72
gi|46122641|ref|XP_385874.1| hypothetical protein FG05698.1 [Gib... 35 0.94
gi|23126059|ref|ZP_00107968.1| COG2319: FOG: WD40 repeat [Nostoc... 35 0.94
gi|46130696|ref|XP_389128.1| hypothetical protein FG08952.1 [Gib... 35 0.94
gi|38075494|ref|XP_207084.2| similar to hypothetical protein MGC... 35 0.94
gi|20823698|ref|XP_130136.1| RIKEN cDNA 3200002I06 [Mus musculus] 35 0.94
gi|34853184|ref|XP_216032.2| similar to hypothetical protein MGC... 35 0.94
gi|50294333|ref|XP_449578.1| unnamed protein product [Candida gl... 35 0.94
gi|45185777|ref|NP_983493.1| ACR091Wp [Eremothecium gossypii] >g... 35 0.94
gi|46439108|gb|EAK98430.1| hypothetical protein CaO19.536 [Candi... 35 0.94
gi|50258424|gb|EAL21113.1| hypothetical protein CNBD4890 [Crypto... 35 0.94
gi|38099466|gb|EAA46810.1| hypothetical protein MG10504.4 [Magna... 35 0.94
gi|21758953|dbj|BAC05425.1| unnamed protein product [Homo sapiens] 35 0.94
gi|32189425|ref|NP_849143.1| hypothetical protein FLJ25955 [Homo... 35 0.94
gi|48097586|ref|XP_393828.1| similar to transducin family protei... 35 0.94
gi|45509691|ref|ZP_00162024.1| COG2319: FOG: WD40 repeat [Anabae... 35 0.94
gi|38099099|gb|EAA46486.1| hypothetical protein MG08829.4 [Magna... 35 1.2
gi|22299041|ref|NP_682288.1| WD-40 repeat protein [Thermosynecho... 35 1.2
gi|17508661|ref|NP_492551.1| RetinoBlastoma Associated protein p... 35 1.2
gi|31209667|ref|XP_313800.1| ENSANGP00000011674 [Anopheles gambi... 35 1.2
gi|19112135|ref|NP_595343.1| WD repeat protein [Schizosaccharomy... 35 1.2
gi|45508310|ref|ZP_00160649.1| COG2319: FOG: WD40 repeat [Anabae... 35 1.2
gi|46117490|ref|XP_384763.1| hypothetical protein FG04587.1 [Gib... 35 1.2
gi|7500364|pir||T21672 hypothetical protein F32H2.4 - Caenorhabd... 35 1.2
gi|37521199|ref|NP_924576.1| WD-40 repeat protein [Gloeobacter v... 35 1.2
gi|47900542|gb|AAT39277.1| putative guanine nucleotide-binding p... 35 1.2
gi|32418102|ref|XP_329529.1| probable sepB protein [MIPS] [Neuro... 35 1.2
gi|39580637|emb|CAE72913.1| Hypothetical protein CBG20231 [Caeno... 35 1.2
gi|49087510|ref|XP_405682.1| hypothetical protein AN1545.2 [Aspe... 35 1.2
gi|46136709|ref|XP_390046.1| GBLP_NEUCR Guanine nucleotide-bindi... 35 1.2
gi|50729050|ref|XP_416406.1| PREDICTED: similar to UNR-interacti... 35 1.2
gi|17507091|ref|NP_492416.1| repeat protein (1J547) [Caenorhabdi... 35 1.2
gi|7486207|pir||T05307 hypothetical protein F26P21.110 - Arabido... 35 1.6
gi|7494450|pir||B71610 WD40 WEB-1 homolog PFB0640c - malaria par... 35 1.6
gi|23479085|gb|EAA16011.1| Arabidopsis thaliana At3g56990/F24I3_... 35 1.6
gi|3023857|sp|Q39336|GBLP_BRANA Guanine nucleotide-binding prote... 35 1.6
gi|38505813|ref|NP_942432.1| WD-repeat protein [Synechocystis sp... 35 1.6
gi|48098473|ref|XP_394082.1| similar to ENSANGP00000011674 [Apis... 35 1.6
gi|15240036|ref|NP_199205.1| transducin family protein / WD-40 r... 35 1.6
gi|50420725|ref|XP_458899.1| unnamed protein product [Debaryomyc... 35 1.6
gi|23490239|gb|EAA22065.1| notchless-related [Plasmodium yoelii ... 35 1.6
gi|46120249|ref|ZP_00179648.2| COG2319: FOG: WD40 repeat [Crocos... 35 1.6
gi|3023840|sp|O14435|GBB_CRYPA Guanine nucleotide-binding protei... 35 1.6
gi|23593308|ref|NP_473056.2| hypothetical protein, conserved [Pl... 35 1.6
gi|38104383|gb|EAA50960.1| hypothetical protein MG04719.4 [Magna... 35 1.6
gi|4589836|dbj|BAA76896.1| LeArcA2 protein [Lycopersicon esculen... 35 1.6
gi|19114336|ref|NP_593424.1| WD repeat protein [Schizosaccharomy... 35 1.6
gi|15234752|ref|NP_193325.1| PP1/PP2A phosphatases pleiotropic r... 34 2.1
gi|21537191|gb|AAM61532.1| PRL1 protein [Arabidopsis thaliana] 34 2.1
gi|27754713|gb|AAO22800.1| putative PRL1 protein [Arabidopsis th... 34 2.1
gi|10178281|emb|CAC08339.1| katanin p80 subunit-like protein [Ar... 34 2.1
gi|38047719|gb|AAR09762.1| similar to Drosophila melanogaster Ra... 34 2.1
gi|50747248|ref|XP_420804.1| PREDICTED: similar to gamma isoform... 34 2.1
gi|50255120|gb|EAL17859.1| hypothetical protein CNBL1210 [Crypto... 34 2.1
gi|50547673|ref|XP_501306.1| hypothetical protein [Yarrowia lipo... 34 2.1
gi|4322265|gb|AAD15986.1| protein phosphatase 2A regulatory B su... 34 2.1
gi|2494899|sp|P56093|TUP1_CANAL Transcriptional repressor TUP1 >... 34 2.1
gi|47086277|ref|NP_998045.1| hypothetical protein zgc:76887 [Dan... 34 2.1
gi|23484679|gb|EAA19926.1| myosin PfM-C-related [Plasmodium yoel... 34 2.1
gi|33284887|emb|CAE17633.1| SI:bZ1G18.6.3 (novel protein similar... 34 2.1
gi|34811519|pdb|1PGU|A Chain A, Yeast Actin Interacting Protein ... 34 2.1
gi|23484501|gb|EAA19811.1| Plasmodium vivax PV1H14040_P [Plasmod... 34 2.1
gi|17532675|ref|NP_495983.1| WD40- FYVE-domain containing protei... 34 2.1
gi|32423263|ref|XP_332069.1| hypothetical protein ( (AF077355) p... 34 2.1
gi|3023858|sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding prote... 34 2.1
gi|34911282|ref|NP_916988.1| guanine nucleotide-binding protein ... 34 2.1
gi|32415057|ref|XP_328008.1| hypothetical protein ( (AL355930) c... 34 2.7
gi|50546811|ref|XP_500875.1| hypothetical protein [Yarrowia lipo... 34 2.7
gi|11359378|pir||T49346 conserved hypothetical protein [imported... 34 2.7
gi|37521813|ref|NP_925190.1| WD-repeat protein [Gloeobacter viol... 34 2.7
gi|49094264|ref|XP_408593.1| hypothetical protein AN4456.2 [Aspe... 34 2.7
gi|34811521|pdb|1PI6|A Chain A, Yeast Actin Interacting Protein ... 34 2.7
gi|6323739|ref|NP_013810.1| Protein localizes to actin cortical ... 34 2.7
gi|23130558|ref|ZP_00112371.1| COG2319: FOG: WD40 repeat [Nostoc... 34 2.7
gi|34870580|ref|XP_213271.2| similar to 3230401M21Rik protein [R... 34 2.7
gi|3023852|sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding prote... 34 2.7
gi|32410369|ref|XP_325665.1| hypothetical protein [Neurospora cr... 34 2.7
gi|39597427|emb|CAE59657.1| Hypothetical protein CBG03075 [Caeno... 34 2.7
gi|3023956|sp|Q00808|HET1_PODAN Vegetatible incompatibility prot... 34 2.7
gi|31210799|ref|XP_314366.1| ENSANGP00000001275 [Anopheles gambi... 34 2.7
gi|19075378|ref|NP_587878.1| beta transducin [Schizosaccharomyce... 33 3.6
gi|41724850|ref|ZP_00151660.1| COG2319: FOG: WD40 repeat [Dechlo... 33 3.6
gi|39581518|emb|CAE64254.1| Hypothetical protein CBG08899 [Caeno... 33 3.6
gi|48895476|ref|ZP_00328460.1| COG2319: FOG: WD40 repeat [Tricho... 33 3.6
gi|19386827|dbj|BAB86205.1| B1147A04.22 [Oryza sativa (japonica ... 33 3.6
gi|28195673|gb|AAO27803.1| NADH dehydrogenase subunit I [Phoenix... 33 3.6
gi|15625564|gb|AAL04162.1| WD40- and FYVE-domain containing prot... 33 3.6
gi|46135357|ref|ZP_00162759.2| COG2319: FOG: WD40 repeat [Anabae... 33 3.6
gi|1297043|emb|CAA61707.1| L3116 [Saccharomyces cerevisiae] 33 3.6
gi|49097298|ref|XP_410109.1| hypothetical protein AN5972.2 [Aspe... 33 3.6
gi|31242707|ref|XP_321784.1| ENSANGP00000009742 [Anopheles gambi... 33 3.6
gi|5902681|sp|Q29090|2ABA_PIG Serine/threonine protein phosphata... 33 3.6
gi|49087306|ref|XP_405605.1| hypothetical protein AN1468.2 [Aspe... 33 3.6
gi|48099312|ref|XP_394888.1| similar to Hypothetical protein MGC... 33 3.6
gi|7446126|pir||T16970 GTP-binding protein beta chain homolog - ... 33 3.6
gi|49092654|ref|XP_407788.1| hypothetical protein AN3651.2 [Aspe... 33 3.6
gi|6323158|ref|NP_013230.1| Nucleolar protein, specifically asso... 33 3.6
gi|46227355|gb|EAK88290.1| cdh1, similar to fizzy-related protei... 33 3.6
gi|50346839|ref|YP_053210.1| NADH dehydrogenase 18kD subunit [Ny... 33 3.6
gi|121026|sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protei... 33 3.6
gi|48102237|ref|XP_395312.1| similar to PAK1 interacting protein... 33 3.6
gi|50293265|ref|XP_449044.1| unnamed protein product [Candida gl... 33 3.6
gi|34500968|ref|NP_904153.1| NADH dehydrogenase 18kD subunit [Am... 33 3.6
gi|48478735|ref|YP_024342.1| NADH dehydrogenase subunit I [Sacch... 33 3.6
gi|32480899|ref|NP_862809.1| NADH dehydrogenase subunit I [Calyc... 33 3.6
gi|38106166|gb|EAA52509.1| hypothetical protein MG05201.4 [Magna... 33 3.6
gi|48840987|ref|ZP_00297913.1| COG2319: FOG: WD40 repeat [Methan... 33 3.6
gi|41053501|ref|NP_956598.1| serine/threonine kinase receptor as... 33 3.6
gi|19113764|ref|NP_592852.1| WD domian, G-beta repeat protein [S... 33 3.6
gi|49093678|ref|XP_408300.1| GBLP_NEUCR Guanine nucleotide-bindi... 33 3.6
gi|46229726|gb|EAK90544.1| apicomplexan conserved protein [Crypt... 33 3.6
gi|2494906|sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding prote... 33 3.6
gi|37682095|gb|AAQ97974.1| TUWD12 [Danio rerio] 33 3.6
gi|41056233|ref|NP_956412.1| Unknown (protein for MGC:63538); wu... 33 3.6
gi|226483|prf||1515205A PRP4 gene 33 3.6
gi|15229589|ref|NP_188441.1| guanine nucleotide-binding family p... 33 3.6
gi|45506958|ref|ZP_00159306.1| COG2319: FOG: WD40 repeat [Anabae... 33 3.6
gi|38108901|gb|EAA54846.1| hypothetical protein MG05637.4 [Magna... 33 3.6
gi|23478705|gb|EAA15718.1| hypothetical protein [Plasmodium yoel... 33 3.6
gi|23612162|ref|NP_703742.1| hypothetical protein, conserved [Pl... 33 3.6
gi|29248498|gb|EAA40030.1| GLP_387_3231_6113 [Giardia lamblia AT... 33 3.6
gi|37535206|ref|NP_921905.1| putative WD-repeat containing prote... 33 4.7
gi|29246385|gb|EAA37984.1| GLP_64_35175_29128 [Giardia lamblia A... 33 4.7
gi|14150171|ref|NP_115737.1| THO complex 3 [Homo sapiens] >gnl|B... 33 4.7
gi|21312090|ref|NP_082873.1| THO complex 3 [Mus musculus] >gnl|B... 33 4.7
gi|46397748|sp|Q8VE80|THO3_MOUSE THO complex subunit 3 (Tho3) >g... 33 4.7
gi|49096540|ref|XP_409730.1| hypothetical protein AN5593.2 [Aspe... 33 4.7
gi|11875643|gb|AAG40737.1| Bap1 [Myxococcus xanthus] 33 4.7
gi|47228311|emb|CAG07706.1| unnamed protein product [Tetraodon n... 33 4.7
gi|11992988|gb|AAA56865.2| guanine nucleotide regulatory protein... 33 4.7
gi|19114682|ref|NP_593770.1| guanine nucleotide-binding protein ... 33 4.7
gi|42490855|gb|AAH66325.1| Unknown (protein for MGC:87234) [Homo... 33 4.7
gi|50255360|gb|EAL18095.1| hypothetical protein CNBK1160 [Crypto... 33 4.7
gi|23612855|ref|NP_704394.1| hypothetical protein, conserved [Pl... 33 4.7
gi|46329534|gb|AAH68952.1| MGC83225 protein [Xenopus laevis] 33 4.7
gi|16041100|dbj|BAB69717.1| hypothetical protein [Macaca fascicu... 33 4.7
gi|31203443|ref|XP_310670.1| ENSANGP00000020760 [Anopheles gambi... 33 4.7
gi|32307119|ref|NP_858063.1| beta isoform of regulatory subunit ... 33 4.7
gi|47197653|emb|CAF88650.1| unnamed protein product [Tetraodon n... 33 4.7
gi|37523230|ref|NP_926607.1| WD-40 repeat protein [Gloeobacter v... 33 4.7
gi|46444349|gb|EAL03624.1| hypothetical protein CaO19.9043 [Cand... 33 4.7
gi|34873865|ref|XP_237957.2| similar to RIKEN cDNA 2410044K02 [R... 33 4.7
gi|784944|emb|CAA60151.1| sepB [Emericella nidulans] 33 4.7
gi|25387428|pir||S54152 sepB protein - Emericella nidulans 33 4.7
gi|49095630|ref|XP_409276.1| hypothetical protein AN5139.2 [Aspe... 33 4.7
gi|47216595|emb|CAG00630.1| unnamed protein product [Tetraodon n... 33 6.1
gi|9294469|dbj|BAB02688.1| unnamed protein product [Arabidopsis ... 33 6.1
gi|50308323|ref|XP_454163.1| unnamed protein product [Kluyveromy... 33 6.1
gi|50309993|ref|XP_455010.1| unnamed protein product [Kluyveromy... 33 6.1
gi|46126233|ref|XP_387670.1| hypothetical protein FG07494.1 [Gib... 33 6.1
gi|39580327|emb|CAE64482.1| Hypothetical protein CBG09206 [Caeno... 33 6.1
gi|50255745|gb|EAL18477.1| hypothetical protein CNBJ1190 [Crypto... 33 6.1
gi|38344202|emb|CAE05767.2| OSJNBa0064G10.18 [Oryza sativa (japo... 33 6.1
gi|24460598|gb|AAN61739.1| NADH dehydrogenase subunit I [Hulsea ... 33 6.1
gi|50549155|ref|XP_502048.1| hypothetical protein [Yarrowia lipo... 33 6.1
gi|6650997|gb|AAF22119.1| guanine nucleotide-binding protein; RA... 33 6.1
gi|2289095|gb|AAB82647.1| WD-40 repeat protein [Arabidopsis thal... 33 6.1
gi|15220941|ref|NP_173248.1| WD-40 repeat family protein / auxin... 33 6.1
gi|50752787|ref|XP_413745.1| PREDICTED: similar to recombination... 33 6.1
gi|46108974|ref|XP_381545.1| hypothetical protein FG01369.1 [Gib... 33 6.1
gi|19922278|ref|NP_610996.1| CG12797-PA [Drosophila melanogaster... 33 6.1
gi|11346447|pir||T43158 probable GTP-binding protein beta chain ... 33 6.1
gi|18418034|ref|NP_567896.1| WD-40 repeat family protein (LEUNIG... 33 6.1
gi|25143538|ref|NP_490902.2| chromatin assembly (55.0 kD) (1C297... 33 6.1
gi|11141605|gb|AAG32022.1| LEUNIG [Arabidopsis thaliana] 33 6.1
gi|49121662|ref|XP_412430.1| hypothetical protein AN8293.2 [Aspe... 33 6.1
gi|50545667|ref|XP_500372.1| hypothetical protein [Yarrowia lipo... 33 6.1
gi|19548930|gb|AAL90861.1| G-protein beta subunit [Sporothrix sc... 33 6.1
gi|21624378|dbj|BAC01165.1| heterotrimeric G-protein beta subuni... 33 6.1
gi|46437324|gb|EAK96673.1| hypothetical protein CaO19.9539 [Cand... 33 6.1
gi|12667270|gb|AAK01368.1| serine-threonine kinase receptor-asso... 33 6.1
gi|31206925|ref|XP_312429.1| ENSANGP00000021922 [Anopheles gambi... 33 6.1
gi|25143535|ref|NP_490901.2| chromatin assembly (55.2 kD) (1C297... 33 6.1
gi|4589834|dbj|BAA76895.1| LeArcA1 protein [Lycopersicon esculen... 33 6.1
gi|3023847|sp|O24076|GBLP_MEDSA Guanine nucleotide-binding prote... 33 6.1
gi|18405469|ref|NP_566822.1| transducin family protein / WD-40 r... 33 6.1
gi|47210286|emb|CAF93639.1| unnamed protein product [Tetraodon n... 32 8.0
gi|31873191|emb|CAD97692.1| fizzy related protein [Paramecium te... 32 8.0
gi|29348654|ref|NP_812157.1| putative iron-sulfur cluster-bindin... 32 8.0
gi|22537478|ref|NP_688329.1| R5 protein [Streptococcus agalactia... 32 8.0
gi|17230661|ref|NP_487209.1| WD repeat protein with Ser/Thr prot... 32 8.0
gi|39595355|emb|CAE60392.1| Hypothetical protein CBG03993 [Caeno... 32 8.0
gi|16418439|ref|NP_443182.1| WD repeat- and FYVE domain-containi... 32 8.0
gi|30024660|gb|AAP13580.1| guanine nucleotide binding protein be... 32 8.0
gi|49078460|ref|XP_402980.1| hypothetical protein UM05365.1 [Ust... 32 8.0
gi|47200996|emb|CAF87752.1| unnamed protein product [Tetraodon n... 32 8.0
gi|50294620|ref|XP_449721.1| unnamed protein product [Candida gl... 32 8.0
gi|17233117|ref|NP_490207.1| WD-repeat protein [Nostoc sp. PCC 7... 32 8.0
gi|50292381|ref|XP_448623.1| unnamed protein product [Candida gl... 32 8.0
gi|46134639|ref|ZP_00158286.2| COG2319: FOG: WD40 repeat [Anabae... 32 8.0
gi|3213200|gb|AAC39085.1| contains multiple C2H2 Zn fingers [Dro... 32 8.0
gi|16554204|dbj|BAB71687.1| unnamed protein product [Homo sapiens] 32 8.0
gi|21426767|ref|NP_653347.1| protein phosphatase 2A B regulatory... 32 8.0
gi|31231745|ref|XP_318586.1| ENSANGP00000020892 [Anopheles gambi... 32 8.0
gi|31201995|ref|XP_309945.1| ENSANGP00000004397 [Anopheles gambi... 32 8.0
gi|17535671|ref|NP_496271.1| WD-repeat protein 18 (58.5 kD) (2K8... 32 8.0
gi|14031063|gb|AAK52092.1| WD-40 repeat protein [Lycopersicon es... 32 8.0
gi|47227557|emb|CAG04705.1| unnamed protein product [Tetraodon n... 32 8.0
gi|32967593|ref|NP_870991.1| gamma isoform of regulatory subunit... 32 8.0
gi|32967588|ref|NP_065149.2| gamma isoform of regulatory subunit... 32 8.0
gi|28175273|gb|AAH45219.1| MGC53013 protein [Xenopus laevis] 32 8.0
gi|19865481|sp|Q9Y2T4|2ABG_HUMAN Serine/threonine protein phosph... 32 8.0
gi|16923962|ref|NP_476457.1| protein phosphatase 2 (formerly 2A)... 32 8.0
gi|49522596|gb|AAH75402.1| Unknown (protein for MGC:89145) [Xeno... 32 8.0
gi|1703001|sp|P50410|2ABG_RABIT Serine/threonine protein phospha... 32 8.0
gi|27370502|ref|NP_766582.1| RIKEN cDNA 6330548O06 [Mus musculus... 32 8.0
gi|19075071|ref|NP_586672.1| WD-REPEAT PROTEIN [Encephalitozoon ... 32 8.0
gi|33150802|gb|AAP97279.1| protein phosphatase 2A1 B gamma subun... 32 8.0
gi|49091992|ref|XP_407457.1| hypothetical protein AN3320.2 [Aspe... 32 8.0
gi|38141516|emb|CAE53390.1| G-protein receptor for activated pro... 32 8.0
gi|21313612|ref|NP_084522.1| WD repeat domain 21 [Mus musculus] ... 32 8.0
gi|2326345|emb|CAA72073.1| PRL1 protein [Arabidopsis thaliana] 32 8.0
gi|45184880|ref|NP_982598.1| AAR057Wp [Eremothecium gossypii] >g... 32 8.0
gi|21355127|ref|NP_649750.1| CG2678-PA [Drosophila melanogaster]... 32 8.0
gi|5733806|gb|AAD49742.1| G protein beta subunit [Pisum sativum] 32 8.0
gi|22476946|gb|AAM97354.1| G protein beta subunit [Pisum sativum] 32 8.0
gi|4929352|gb|AAD33959.1| G protein beta subunit [Pisum sativum] 32 8.0
gi|16765383|ref|NP_460998.1| polyhedral body protein [Salmonella... 32 8.0
>gi|17556687|ref|NP_499643.1| angio-associated migratory cell
protein (23.7 kD) (3N707) [Caenorhabditis elegans]
gi|13548464|emb|CAC35841.1| Hypothetical protein Y111B2A.12
[Caenorhabditis elegans]
Length = 213
Score = 404 bits (1037), Expect = e-111
Identities = 198/213 (92%), Positives = 198/213 (92%)
Frame = +1
Query: 1 MDEDNHRXXXXXXXXXXXXXXXAEMKYASDDEDQQSTSNADVPAEIIDDSLMSLQAHAQD 180
MDEDNHR AEMKYASDDEDQQSTSNADVPAEIIDDSLMSLQAHAQD
Sbjct: 1 MDEDNHRIEESEIDEIIEIDDDAEMKYASDDEDQQSTSNADVPAEIIDDSLMSLQAHAQD 60
Query: 181 CFTVALASNRWLATGGEDDVAFLFDQNQSESEPVLKVEHKDSVTQVMFNHSETLLATGDL 360
CFTVALASNRWLATGGEDDVAFLFDQNQSESEPVLKVEHKDSVTQVMFNHSETLLATGDL
Sbjct: 61 CFTVALASNRWLATGGEDDVAFLFDQNQSESEPVLKVEHKDSVTQVMFNHSETLLATGDL 120
Query: 361 SGKIMISEMATKKVRAEIDECNDLEWMCWHQTADILFAGDKDGILWMWLIGNKGIAQSKV 540
SGKIMISEMATKKVRAEIDECNDLEWMCWHQTADILFAGDKDGILWMWLIGNKGIAQSKV
Sbjct: 121 SGKIMISEMATKKVRAEIDECNDLEWMCWHQTADILFAGDKDGILWMWLIGNKGIAQSKV 180
Query: 541 YAGNGSSCTTGCLMPDGKRIMCGYSDGIVRKFL 639
YAGNGSSCTTGCLMPDGKRIMCGYSDGIVRKFL
Sbjct: 181 YAGNGSSCTTGCLMPDGKRIMCGYSDGIVRKFL 213