Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y113G7B_5
(939 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17566470|ref|NP_507896.1| feminization Of Germline FOG-2, cyc... 632 e-180
gi|17566468|ref|NP_507895.1| cyclin-like F-box and Protein of un... 398 e-110
gi|17566474|ref|NP_507897.1| cyclin-like F-box and Protein of un... 228 2e-58
gi|17566466|ref|NP_507893.1| cyclin-like F-box and Protein of un... 197 2e-49
gi|17566472|ref|NP_507898.1| cyclin-like F-box and Protein of un... 192 9e-48
gi|17566462|ref|NP_507892.1| cyclin-like F-box and Protein of un... 182 7e-45
gi|17566384|ref|NP_507285.1| predicted CDS, cyclin-like F-box an... 173 6e-42
gi|17565400|ref|NP_507536.1| cyclin-like F-box and Protein of un... 172 7e-42
gi|17550772|ref|NP_510807.1| cyclin-like F-box and Protein of un... 168 2e-40
gi|17561690|ref|NP_507468.1| cyclin-like F-box and Protein of un... 165 2e-39
gi|17566080|ref|NP_507530.1| cyclin-like F-box and Protein of un... 158 1e-37
gi|17566376|ref|NP_507281.1| cyclin-like F-box and Protein of un... 151 2e-35
gi|17562698|ref|NP_507832.1| predicted CDS, cyclin-like F-box an... 147 3e-34
gi|50727060|gb|AAT81200.1| Hypothetical protein F14D2.13 [Caenor... 140 5e-32
gi|17566382|ref|NP_507284.1| predicted CDS, putative cytoplasmic... 124 2e-27
gi|32564766|ref|NP_871999.1| cyclin-like F-box and BTB/POZ domai... 119 7e-26
gi|7499081|pir||T32791 hypothetical protein F14D2.8 - Caenorhabd... 119 7e-26
gi|17538572|ref|NP_502631.1| cyclin-like F-box and Protein of un... 119 1e-25
gi|47606781|sp|Q09336|YOF9_CAEEL Hypothetical protein ZK1290.9 i... 116 6e-25
gi|17555040|ref|NP_497302.1| cyclin-like F-box and Protein of un... 116 6e-25
gi|17561154|ref|NP_507392.1| cyclin-like F-box and Protein of un... 116 8e-25
gi|17566374|ref|NP_507280.1| cyclin-like F-box and Protein of un... 115 2e-24
gi|17557506|ref|NP_504892.1| cyclin-like F-box and Protein of un... 112 1e-23
gi|17556202|ref|NP_497534.1| predicted CDS, cyclin-like F-box an... 112 1e-23
gi|17552576|ref|NP_497513.1| cyclin-like F-box and Protein of un... 110 3e-23
gi|17560982|ref|NP_507061.1| protein of unknown function DUF38 a... 109 8e-23
gi|17558538|ref|NP_507448.1| predicted CDS, cyclin-like F-box an... 109 1e-22
gi|17561148|ref|NP_507389.1| cyclin-like F-box and Protein of un... 108 1e-22
gi|17566392|ref|NP_507290.1| cyclin-like F-box and Protein of un... 105 2e-21
gi|32567140|ref|NP_503905.2| predicted CDS, cyclin-like F-box an... 104 3e-21
gi|17555602|ref|NP_497448.1| cyclin-like F-box and Protein of un... 104 3e-21
gi|7508625|pir||T28991 hypothetical protein T28A11.21 - Caenorha... 104 3e-21
gi|17565402|ref|NP_507537.1| cyclin-like F-box and Protein of un... 104 3e-21
gi|17564170|ref|NP_506746.1| cyclin-like F-box and Protein of un... 103 4e-21
gi|7507552|pir||T24767 hypothetical protein T09F5.11 - Caenorhab... 103 4e-21
gi|32698040|emb|CAA21741.2| Hypothetical protein Y47H9C.10 [Caen... 103 6e-21
gi|32697987|emb|CAE11303.1| Hypothetical protein F28F8.8 [Caenor... 103 7e-21
gi|17557364|ref|NP_506879.1| cyclin-like F-box and Protein of un... 103 7e-21
gi|17570499|ref|NP_508071.1| predicted CDS, cyclin-like F-box an... 103 7e-21
gi|7494907|pir||T18734 hypothetical protein B0391.6 - Caenorhabd... 103 7e-21
gi|30145722|emb|CAD89725.1| Hypothetical protein B0391.6 [Caenor... 103 7e-21
gi|17557362|ref|NP_506880.1| cyclin-like F-box and Protein of un... 103 7e-21
gi|17565404|ref|NP_507538.1| predicted CDS, cyclin-like F-box an... 102 9e-21
gi|17556771|ref|NP_497367.1| predicted CDS, cyclin-like F-box an... 101 3e-20
gi|17542918|ref|NP_500676.1| u6 small nuclear RNA (4F695) [Caeno... 100 5e-20
gi|32565209|ref|NP_497381.2| cyclin-like F-box and Protein of un... 100 6e-20
gi|17558196|ref|NP_506704.1| predicted CDS, cyclin-like F-box an... 100 6e-20
gi|17556767|ref|NP_497365.1| predicted CDS, cyclin-like F-box an... 100 6e-20
gi|17561146|ref|NP_507388.1| cyclin-like F-box and Protein of un... 100 8e-20
gi|17543752|ref|NP_502778.1| predicted CDS, protein of unknown f... 100 8e-20
gi|17556204|ref|NP_497535.1| predicted CDS, cyclin-like F-box an... 99 1e-19
gi|17558050|ref|NP_503929.1| cyclin-like F-box and Protein of un... 99 2e-19
gi|17542926|ref|NP_500678.1| predicted CDS, cyclin-like F-box an... 99 2e-19
gi|17556769|ref|NP_497366.1| predicted CDS, cyclin-like F-box an... 98 2e-19
gi|17563922|ref|NP_504642.1| cyclin-like F-box and Protein of un... 97 5e-19
gi|17561360|ref|NP_506948.1| cyclin-like F-box and Protein of un... 96 9e-19
gi|17552766|ref|NP_497124.1| cyclin-like F-box and Protein of un... 96 2e-18
gi|17560668|ref|NP_507008.1| cyclin-like F-box and Protein of un... 95 2e-18
gi|25148588|ref|NP_494270.2| cyclin-like F-box and Protein of un... 95 2e-18
gi|32564782|ref|NP_872001.1| cyclin-like F-box and Protein of un... 95 2e-18
gi|7503264|pir||T32285 hypothetical protein F42G2.4 - Caenorhabd... 95 2e-18
gi|17556586|ref|NP_497385.1| cyclin-like F-box and Protein of un... 94 6e-18
gi|17556590|ref|NP_497383.1| predicted CDS, cyclin-like F-box an... 94 6e-18
gi|17561582|ref|NP_507460.1| cyclin-like F-box and Protein of un... 94 6e-18
gi|17561150|ref|NP_507390.1| cyclin-like F-box and Protein of un... 93 1e-17
gi|32565381|ref|NP_497299.2| cyclin-like F-box and Protein of un... 93 1e-17
gi|17556775|ref|NP_497363.1| predicted CDS, cyclin-like F-box an... 93 1e-17
gi|7507726|pir||T33677 hypothetical protein T12B5.8 - Caenorhabd... 93 1e-17
gi|17570013|ref|NP_510419.1| cyclin-like F-box and Protein of un... 92 1e-17
gi|17564298|ref|NP_507106.1| cyclin-like F-box and Protein of un... 92 2e-17
gi|17561590|ref|NP_507465.1| predicted CDS, cyclin-like F-box an... 92 2e-17
gi|17555928|ref|NP_499435.1| putative cytoplasmic protein family... 92 2e-17
gi|17556588|ref|NP_497384.1| cyclin-like F-box and Protein of un... 92 2e-17
gi|17510235|ref|NP_493038.1| cyclin-like F-box and Protein of un... 91 4e-17
gi|17564010|ref|NP_506827.1| cyclin-like F-box and Protein of un... 91 4e-17
gi|17565420|ref|NP_507573.1| cyclin-like F-box and Protein of un... 91 5e-17
gi|32565399|ref|NP_497446.2| cyclin-like F-box and Protein of un... 90 6e-17
gi|29570408|gb|AAO91685.1| Hypothetical protein Y22D7AR.9 [Caeno... 90 6e-17
gi|17567995|ref|NP_508366.1| cyclin-like F-box and Protein of un... 90 8e-17
gi|17509743|ref|NP_493255.1| cyclin-like F-box and Protein of un... 89 1e-16
gi|17536139|ref|NP_494084.1| predicted CDS, cyclin-like F-box an... 89 1e-16
gi|17531635|ref|NP_494012.1| cyclin-like F-box and Protein of un... 89 1e-16
gi|17543462|ref|NP_502641.1| cyclin-like F-box and Protein of un... 88 2e-16
gi|17556773|ref|NP_497364.1| cyclin-like F-box and Protein of un... 88 2e-16
gi|34555909|emb|CAB07340.2| Hypothetical protein F10A3.2 [Caenor... 87 4e-16
gi|49035158|gb|AAT48621.1| Hypothetical protein F42G2.4b [Caenor... 87 7e-16
gi|49035157|gb|AAT48620.1| Hypothetical protein F42G2.4a [Caenor... 87 7e-16
gi|17556721|ref|NP_497373.1| predicted CDS, cyclin-like F-box an... 87 7e-16
gi|17555038|ref|NP_497300.1| cyclin-like F-box and Protein of un... 86 9e-16
gi|17559682|ref|NP_507041.1| predicted CDS, cyclin-like F-box an... 86 9e-16
gi|17555032|ref|NP_497296.1| transposase family member (3B552) [... 86 1e-15
gi|17555026|ref|NP_497304.1| cyclin-like F-box and Protein of un... 86 1e-15
gi|17558540|ref|NP_507447.1| cyclin-like F-box and Protein of un... 86 2e-15
gi|17531641|ref|NP_494015.1| cyclin-like F-box and Protein of un... 86 2e-15
gi|32699248|gb|AAB70969.2| Hypothetical protein C08E3.10 [Caenor... 86 2e-15
gi|17540364|ref|NP_500327.1| putative cytoplasmic protein family... 86 2e-15
gi|17564868|ref|NP_504615.1| predicted CDS, cyclin-like F-box an... 85 2e-15
gi|17556598|ref|NP_497382.1| predicted CDS, cyclin-like F-box an... 85 3e-15
gi|17510245|ref|NP_493040.1| cyclin-like F-box and Protein of un... 84 3e-15
gi|17556733|ref|NP_497354.1| predicted CDS, cyclin-like F-box an... 84 6e-15
gi|17556584|ref|NP_497386.1| cyclin-like F-box and Protein of un... 84 6e-15
gi|17560312|ref|NP_506871.1| cyclin-like F-box and Protein of un... 83 8e-15
gi|32697988|emb|CAB03015.2| Hypothetical protein F28F8.4 [Caenor... 83 8e-15
gi|17556715|ref|NP_497377.1| predicted CDS, cyclin-like F-box an... 83 1e-14
gi|17532193|ref|NP_496869.1| cyclin-like F-box and Protein of un... 82 1e-14
gi|17531637|ref|NP_494013.1| cyclin-like F-box and Protein of un... 82 1e-14
gi|17566364|ref|NP_507275.1| cyclin-like F-box and Protein of un... 82 1e-14
gi|17552578|ref|NP_497512.1| predicted CDS, cyclin-like F-box an... 82 1e-14
gi|17555200|ref|NP_497526.1| putative protein family member (3D3... 82 2e-14
gi|17555024|ref|NP_497305.1| cyclin-like F-box and Protein of un... 81 3e-14
gi|17556594|ref|NP_497378.1| predicted CDS, cyclin-like F-box an... 81 3e-14
gi|17558528|ref|NP_507449.1| predicted CDS, cyclin-like F-box an... 81 4e-14
gi|17559464|ref|NP_507065.1| predicted CDS, cyclin-like F-box an... 80 5e-14
gi|17556719|ref|NP_497375.1| predicted CDS, cyclin-like F-box an... 80 5e-14
gi|17552410|ref|NP_497143.1| predicted CDS, cyclin-like F-box an... 80 5e-14
gi|17555202|ref|NP_497525.1| predicted CDS, putative cytoplasmic... 80 5e-14
gi|39587353|emb|CAE75007.1| Hypothetical protein CBG22908 [Caeno... 80 7e-14
gi|17565954|ref|NP_507584.1| cyclin-like F-box and Protein of un... 80 9e-14
gi|32565204|ref|NP_497530.2| cyclin-like F-box and Protein of un... 80 9e-14
gi|17510067|ref|NP_493019.1| putative protein family member (1M4... 80 9e-14
gi|39590089|emb|CAE61087.1| Hypothetical protein CBG04840 [Caeno... 79 1e-13
gi|17558544|ref|NP_507445.1| predicted CDS, cyclin-like F-box an... 79 1e-13
gi|17556785|ref|NP_497371.1| predicted CDS, cyclin-like F-box an... 79 2e-13
gi|17543930|ref|NP_502739.1| cyclin-like F-box and Protein of un... 79 2e-13
gi|17565408|ref|NP_507540.1| cyclin-like F-box and Protein of un... 79 2e-13
gi|39590173|emb|CAE61171.1| Hypothetical protein CBG04939 [Caeno... 78 2e-13
gi|17562142|ref|NP_507432.1| predicted CDS, cyclin-like F-box an... 78 2e-13
gi|34850041|gb|AAC17005.2| Hypothetical protein F56C3.2 [Caenorh... 78 3e-13
gi|32564758|ref|NP_494660.2| putative cytoplasmic protein family... 78 3e-13
gi|17568223|ref|NP_508255.1| cyclin-like F-box and Protein of un... 78 3e-13
gi|7504166|pir||T33613 hypothetical protein F54D10.2 - Caenorhab... 78 3e-13
gi|17556737|ref|NP_497352.1| predicted CDS, cyclin-like F-box an... 77 4e-13
gi|17555028|ref|NP_497303.1| cyclin-like F-box and Protein of un... 77 4e-13
gi|17557360|ref|NP_506881.1| cyclin-like F-box and Protein of un... 77 6e-13
gi|17556779|ref|NP_497368.1| predicted CDS, cyclin-like F-box an... 77 6e-13
gi|17557722|ref|NP_507510.1| predicted CDS, cyclin-like F-box an... 76 9e-13
gi|7507718|pir||T33684 hypothetical protein T12B5.12 - Caenorhab... 76 1e-12
gi|17555204|ref|NP_497524.1| predicted CDS, cyclin-like F-box an... 76 1e-12
gi|17552570|ref|NP_497515.1| cyclin-like F-box and Protein of un... 75 2e-12
gi|17566368|ref|NP_507277.1| cyclin-like F-box and Protein of un... 75 2e-12
gi|17560420|ref|NP_503290.1| predicted CDS, putative cytoplasmic... 75 3e-12
gi|17556717|ref|NP_497376.1| predicted CDS, cyclin-like F-box an... 74 5e-12
gi|17555022|ref|NP_497307.1| cyclin-like F-box and Protein of un... 74 6e-12
gi|30145758|emb|CAD89750.1| Hypothetical protein T25E12.12 [Caen... 73 1e-11
gi|17565048|ref|NP_507824.1| putative cytoplasmic protein family... 73 1e-11
gi|17531633|ref|NP_494010.1| cyclin-like F-box and Protein of un... 73 1e-11
gi|17556600|ref|NP_497380.1| predicted CDS, cyclin-like F-box an... 72 1e-11
gi|17552580|ref|NP_497517.1| cyclin-like F-box and Protein of un... 72 2e-11
gi|17560388|ref|NP_507384.1| cyclin-like F-box and Protein of un... 72 2e-11
gi|17556518|ref|NP_499593.1| predicted CDS, cyclin-like F-box an... 72 2e-11
gi|32565389|ref|NP_497353.2| predicted CDS, cyclin-like F-box an... 72 2e-11
gi|7495580|pir||T19028 hypothetical protein C06H5.1 - Caenorhabd... 71 3e-11
gi|14530343|emb|CAB07161.2| Hypothetical protein C06H5.1 [Caenor... 71 3e-11
gi|39590174|emb|CAE61172.1| Hypothetical protein CBG04940 [Caeno... 71 4e-11
gi|7510785|pir||T27601 hypothetical protein ZC47.12 - Caenorhabd... 70 9e-11
gi|17559414|ref|NP_507270.1| predicted CDS, cyclin-like F-box an... 69 1e-10
gi|34556089|emb|CAB54324.2| Hypothetical protein Y113G7B.1 [Caen... 69 1e-10
gi|32566510|ref|NP_508355.2| predicted CDS, cyclin-like F-box an... 69 2e-10
gi|17567983|ref|NP_508358.1| predicted CDS, cyclin-like F-box an... 69 2e-10
gi|39587335|emb|CAE74989.1| Hypothetical protein CBG22882 [Caeno... 69 2e-10
gi|17531639|ref|NP_494014.1| putative cytoplasmic protein family... 69 2e-10
gi|49035104|gb|AAB66207.2| Hypothetical protein F45C12.8 [Caenor... 69 2e-10
gi|39579646|emb|CAE56645.1| Hypothetical protein CBG24406 [Caeno... 69 2e-10
gi|17559410|ref|NP_507267.1| cyclin-like F-box and Protein of un... 68 3e-10
gi|17556787|ref|NP_497370.1| cyclin-like F-box and Protein of un... 68 3e-10
gi|17556783|ref|NP_497372.1| predicted CDS, cyclin-like F-box an... 67 4e-10
gi|17505364|ref|NP_492787.1| cyclin-like F-box and Protein of un... 67 4e-10
gi|32566983|ref|NP_507232.2| protein of unknown function DUF38 a... 67 6e-10
gi|17564030|ref|NP_506837.1| putative protein family member (5P9... 67 6e-10
gi|7508443|pir||T25281 hypothetical protein T25E12.11 - Caenorha... 67 6e-10
gi|17561692|ref|NP_507467.1| putative cytoplasmic protein family... 67 8e-10
gi|17550870|ref|NP_508309.1| cyclin-like F-box and Protein of un... 66 1e-09
gi|7495522|pir||T19004 hypothetical protein C06C3.9 - Caenorhabd... 66 1e-09
gi|39590024|emb|CAE61022.1| Hypothetical protein CBG04764 [Caeno... 65 2e-09
gi|17531631|ref|NP_494009.1| cyclin-like F-box and Protein of un... 65 2e-09
gi|17560964|ref|NP_504516.1| cyclin-like F-box and Protein of un... 65 2e-09
gi|39590188|emb|CAE61186.1| Hypothetical protein CBG04959 [Caeno... 65 2e-09
gi|39582930|emb|CAE72995.1| Hypothetical protein CBG20341 [Caeno... 65 3e-09
gi|7510151|pir||T27120 hypothetical protein Y53C10A.8 - Caenorha... 65 3e-09
gi|7510788|pir||T27598 hypothetical protein ZC47.2 - Caenorhabdi... 64 4e-09
gi|39590113|emb|CAE61111.1| Hypothetical protein CBG04868 [Caeno... 64 4e-09
gi|17556755|ref|NP_497358.1| cyclin-like F-box and Protein of un... 64 5e-09
gi|39580077|emb|CAE56837.1| Hypothetical protein CBG24662 [Caeno... 64 5e-09
gi|17560554|ref|NP_506398.1| cyclin-like F-box and Protein of un... 64 5e-09
gi|39579644|emb|CAE56643.1| Hypothetical protein CBG24404 [Caeno... 64 5e-09
gi|17556753|ref|NP_497356.1| predicted CDS, cyclin-like F-box an... 64 5e-09
gi|17556757|ref|NP_497360.1| predicted CDS, cyclin-like F-box an... 64 5e-09
gi|7507723|pir||T33676 hypothetical protein T12B5.5 - Caenorhabd... 64 6e-09
gi|17506555|ref|NP_493496.1| cyclin-like F-box and Protein of un... 63 8e-09
gi|32699249|gb|AAB70963.2| Hypothetical protein C08E3.5 [Caenorh... 63 8e-09
gi|32565379|ref|NP_497298.2| predicted CDS, putative cytoplasmic... 63 8e-09
gi|17565426|ref|NP_504572.1| cyclin-like F-box and Protein of un... 63 8e-09
gi|17556602|ref|NP_497387.1| predicted CDS, protein of unknown f... 63 1e-08
gi|7510786|pir||T27590 hypothetical protein ZC47.13 - Caenorhabd... 62 1e-08
gi|39582866|emb|CAE71642.1| Hypothetical protein CBG18613 [Caeno... 62 2e-08
gi|39590189|emb|CAE61187.1| Hypothetical protein CBG04960 [Caeno... 62 2e-08
gi|17565406|ref|NP_507539.1| predicted CDS, cyclin-like F-box an... 61 3e-08
gi|17510243|ref|NP_493039.1| cyclin-like F-box and Protein of un... 61 3e-08
gi|17560392|ref|NP_507385.1| predicted CDS, cyclin-like F-box an... 61 4e-08
gi|45430252|gb|AAC68937.2| Hypothetical protein T12B5.13 [Caenor... 61 4e-08
gi|17555044|ref|NP_497301.1| predicted CDS, putative cytoplasmic... 61 4e-08
gi|17531897|ref|NP_495069.1| predicted CDS, cyclin-like F-box fa... 60 5e-08
gi|17534061|ref|NP_494052.1| cyclin-like F-box and Protein of un... 60 5e-08
gi|17556781|ref|NP_497369.1| cyclin-like F-box and Protein of un... 60 5e-08
gi|17556731|ref|NP_497355.1| cyclin-like F-box and Protein of un... 60 7e-08
gi|17555584|ref|NP_497449.1| predicted CDS, protein of unknown f... 60 7e-08
gi|39589972|emb|CAE60970.1| Hypothetical protein CBG04702 [Caeno... 60 9e-08
gi|39587340|emb|CAE74994.1| Hypothetical protein CBG22887 [Caeno... 60 9e-08
gi|39579643|emb|CAE56642.1| Hypothetical protein CBG24403 [Caeno... 60 9e-08
gi|39580079|emb|CAE56839.1| Hypothetical protein CBG24664 [Caeno... 59 1e-07
gi|17552408|ref|NP_497142.1| cyclin-like F-box and Protein of un... 59 1e-07
gi|39590092|emb|CAE61090.1| Hypothetical protein CBG04843 [Caeno... 59 2e-07
gi|17565394|ref|NP_506838.1| cyclin-like F-box and Protein of un... 59 2e-07
gi|39587817|emb|CAE67835.1| Hypothetical protein CBG13419 [Caeno... 59 2e-07
gi|39582885|emb|CAE71661.1| Hypothetical protein CBG18633 [Caeno... 59 2e-07
gi|39590091|emb|CAE61089.1| Hypothetical protein CBG04842 [Caeno... 58 3e-07
gi|39582886|emb|CAE71662.1| Hypothetical protein CBG18634 [Caeno... 58 3e-07
gi|39587823|emb|CAE67841.1| Hypothetical protein CBG13427 [Caeno... 58 3e-07
gi|17557372|ref|NP_506878.1| cyclin-like F-box and Protein of un... 58 3e-07
gi|39590109|emb|CAE61107.1| Hypothetical protein CBG04864 [Caeno... 58 3e-07
gi|17556192|ref|NP_497531.1| predicted CDS, cyclin-like F-box an... 57 5e-07
gi|17565246|ref|NP_507455.1| protein of unknown function DUF38 a... 57 5e-07
gi|7510422|pir||T27342 hypothetical protein Y6G8.2 - Caenorhabdi... 57 5e-07
gi|39587359|emb|CAE75013.1| Hypothetical protein CBG22915 [Caeno... 57 5e-07
gi|39582833|emb|CAE71609.1| Hypothetical protein CBG18569 [Caeno... 57 5e-07
gi|17509669|ref|NP_493419.1| cyclin-like F-box and Protein of un... 57 6e-07
gi|17538115|ref|NP_495583.1| cyclin-like F-box and Protein of un... 57 6e-07
gi|7510795|pir||T27599 hypothetical protein ZC47.9 - Caenorhabdi... 57 8e-07
gi|39590048|emb|CAE61046.1| Hypothetical protein CBG04791 [Caeno... 57 8e-07
gi|39582417|emb|CAE74801.1| Hypothetical protein CBG22632 [Caeno... 56 1e-06
gi|17563966|ref|NP_506963.1| putative cytoplasmic protein family... 56 1e-06
gi|39587355|emb|CAE75009.1| Hypothetical protein CBG22910 [Caeno... 55 2e-06
gi|49035143|gb|AAB66190.2| Hypothetical protein T07D3.1 [Caenorh... 55 2e-06
gi|17536079|ref|NP_493845.1| putative cytoplasmic protein family... 55 2e-06
gi|7496779|pir||T19604 hypothetical protein C31C9.4 - Caenorhabd... 55 2e-06
gi|39582869|emb|CAE71645.1| Hypothetical protein CBG18616 [Caeno... 55 3e-06
gi|17556626|ref|NP_497399.1| predicted CDS, cyclin-like F-box fa... 54 4e-06
gi|17531645|ref|NP_494017.1| predicted CDS, putative cytoplasmic... 54 4e-06
gi|7509472|pir||T22376 hypothetical protein Y20C6A.1 - Caenorhab... 54 5e-06
gi|32565233|ref|NP_494134.2| protein of unknown function DUF38 a... 54 7e-06
gi|25148484|ref|NP_494090.2| protein of unknown function DUF38 a... 54 7e-06
gi|32566899|ref|NP_507397.2| protein of unknown function DUF38 a... 54 7e-06
gi|50470582|emb|CAA16306.3| Hypothetical protein Y20C6A.1 [Caeno... 54 7e-06
gi|7511049|pir||T32415 hypothetical protein ZK250.5 - Caenorhabd... 54 7e-06
gi|7507461|pir||T33394 hypothetical protein T08E11.1 - Caenorhab... 54 7e-06
gi|17555196|ref|NP_497523.1| predicted CDS, putative mitochondri... 53 9e-06
gi|17541774|ref|NP_500159.1| predicted CDS, cyclin-like F-box an... 53 1e-05
gi|50507813|emb|CAB07204.2| Hypothetical protein F47H4.2 [Caenor... 52 1e-05
gi|17561144|ref|NP_507396.1| protein of unknown function DUF38 a... 52 1e-05
gi|39596276|emb|CAE69914.1| Hypothetical protein CBG16271 [Caeno... 52 1e-05
gi|17552568|ref|NP_497516.1| predicted CDS, cyclin-like F-box an... 52 1e-05
gi|17559796|ref|NP_504580.1| putative cytoplasmic protein family... 52 2e-05
gi|39580581|emb|CAE70477.1| Hypothetical protein CBG17070 [Caeno... 52 2e-05
gi|39587284|emb|CAE74938.1| Hypothetical protein CBG22826 [Caeno... 52 2e-05
gi|39587357|emb|CAE75011.1| Hypothetical protein CBG22913 [Caeno... 52 2e-05
gi|39589971|emb|CAE60969.1| Hypothetical protein CBG04701 [Caeno... 52 3e-05
gi|32564809|ref|NP_494008.2| putative cytoplasmic protein family... 51 3e-05
gi|7495668|pir||T32354 hypothetical protein C08E3.4 - Caenorhabd... 51 3e-05
gi|17531895|ref|NP_495070.1| putative protein family member (2F8... 51 4e-05
gi|39581728|emb|CAE71061.1| Hypothetical protein CBG17904 [Caeno... 50 6e-05
gi|32566897|ref|NP_507444.2| cyclin-like F-box and Protein of un... 50 6e-05
gi|39584334|emb|CAE65498.1| Hypothetical protein CBG10468 [Caeno... 50 6e-05
gi|39579997|emb|CAE56313.1| Hypothetical protein CBG23976 [Caeno... 50 7e-05
gi|7510783|pir||T27592 hypothetical protein ZC47.1 - Caenorhabdi... 50 1e-04
gi|39579279|emb|CAE56952.1| Hypothetical protein CBG24802 [Caeno... 50 1e-04
gi|17532195|ref|NP_496870.1| predicted CDS, cyclin-like F-box an... 49 2e-04
gi|17559466|ref|NP_507066.1| cyclin-like F-box family member (5Q... 49 2e-04
gi|17558534|ref|NP_507452.1| predicted CDS, cyclin-like F-box an... 49 2e-04
gi|17532541|ref|NP_494091.1| protein of unknown function DUF38 a... 49 2e-04
gi|17551460|ref|NP_508315.1| putative protein family member (XC3... 49 2e-04
gi|17563968|ref|NP_506964.1| cyclin-like F-box and Protein of un... 48 4e-04
gi|39578822|emb|CAE57105.1| Hypothetical protein CBG25008 [Caeno... 48 4e-04
gi|17564680|ref|NP_507237.1| putative cytoplasmic protein (36.9 ... 48 4e-04
gi|39582868|emb|CAE71644.1| Hypothetical protein CBG18615 [Caeno... 47 5e-04
gi|17556578|ref|NP_497390.1| predicted CDS, cyclin-like F-box an... 47 5e-04
gi|39582834|emb|CAE71610.1| Hypothetical protein CBG18570 [Caeno... 47 6e-04
gi|17568453|ref|NP_510502.1| cyclin-like F-box and Protein of un... 47 6e-04
gi|17534375|ref|NP_494659.1| cyclin-like F-box and Protein of un... 47 6e-04
gi|39588757|emb|CAE58281.1| Hypothetical protein CBG01388 [Caeno... 47 6e-04
gi|39590098|emb|CAE61096.1| Hypothetical protein CBG04851 [Caeno... 47 8e-04
gi|17557368|ref|NP_506876.1| putative cytoskeletal protein famil... 46 0.001
gi|17556727|ref|NP_497359.1| predicted CDS, putative protein fam... 46 0.001
gi|17509607|ref|NP_491152.1| cyclin-like F-box and Protein of un... 46 0.001
gi|39580000|emb|CAE56316.1| Hypothetical protein CBG23979 [Caeno... 46 0.001
gi|17558112|ref|NP_507438.1| putative protein family member (5S5... 45 0.002
gi|39582870|emb|CAE71646.1| Hypothetical protein CBG18617 [Caeno... 45 0.002
gi|39579280|emb|CAE56953.1| Hypothetical protein CBG24803 [Caeno... 44 0.004
gi|17562964|ref|NP_506633.1| predicted CDS, cyclin-like F-box an... 44 0.004
gi|39588236|emb|CAE68161.1| Hypothetical protein CBG13818 [Caeno... 44 0.004
gi|17556194|ref|NP_497529.1| predicted CDS, cyclin-like F-box an... 44 0.005
gi|39590114|emb|CAE61112.1| Hypothetical protein CBG04869 [Caeno... 44 0.005
gi|39583376|emb|CAE66350.1| Hypothetical protein CBG11602 [Caeno... 44 0.005
gi|39580442|emb|CAE73131.1| Hypothetical protein CBG20515 [Caeno... 44 0.007
gi|33300422|emb|CAB07255.2| Hypothetical protein K10G4.5 [Caenor... 43 0.009
gi|17567309|ref|NP_510401.1| cyclin-like F-box and Protein of un... 43 0.009
gi|17558522|ref|NP_503432.1| predicted CDS, cyclin-like F-box an... 43 0.009
gi|17562494|ref|NP_507379.1| cyclin-like F-box and Protein of un... 43 0.009
gi|17533287|ref|NP_494269.1| predicted CDS, putative cytoplasmic... 43 0.012
gi|17506541|ref|NP_493266.1| cyclin-like F-box and Protein of un... 43 0.012
gi|17566210|ref|NP_507204.1| cyclin-like F-box and Protein of un... 42 0.015
gi|39592605|emb|CAE63682.1| Hypothetical protein CBG08185 [Caeno... 42 0.015
gi|17560784|ref|NP_507340.1| cyclin-like F-box and Protein of un... 42 0.015
gi|17536141|ref|NP_494089.1| putative cytoplasmic protein family... 42 0.020
gi|25354037|pir||D89407 protein R10E8.6 [imported] - Caenorhabdi... 42 0.020
gi|17563098|ref|NP_507572.1| protein of unknown function DUF38 a... 42 0.020
gi|38176015|gb|AAC68786.2| Hypothetical protein F54D10.6 [Caenor... 42 0.026
gi|39588624|emb|CAE58148.1| Hypothetical protein CBG01238 [Caeno... 42 0.026
gi|17543932|ref|NP_502738.1| predicted CDS, putative cytoplasmic... 41 0.034
gi|17533921|ref|NP_494273.1| putative cytoplasmic protein family... 41 0.044
gi|32565215|ref|NP_493020.2| cyclin-like F-box and Protein of un... 41 0.044
gi|7509942|pir||T26970 hypothetical protein Y47H9C.11 - Caenorha... 41 0.044
gi|17563026|ref|NP_503412.1| predicted CDS, cyclin-like F-box an... 40 0.075
gi|17563088|ref|NP_507568.1| putative mitochondrial protein fami... 40 0.075
gi|39580938|emb|CAE65568.1| Hypothetical protein CBG10562 [Caeno... 40 0.075
gi|34555885|emb|CAB04643.2| Hypothetical protein R10E8.1 [Caenor... 40 0.075
gi|17540812|ref|NP_500352.1| protein of unknown function DUF38 a... 40 0.098
gi|39587290|emb|CAE74944.1| Hypothetical protein CBG22833 [Caeno... 40 0.098
gi|17566380|ref|NP_507283.1| predicted CDS, cyclin-like F-box fa... 39 0.13
gi|17506067|ref|NP_493267.1| cyclin-like F-box and Protein of un... 39 0.13
gi|17561576|ref|NP_507457.1| predicted CDS, putative protein fam... 39 0.13
gi|17566378|ref|NP_507282.1| predicted CDS, cyclin-like F-box fa... 39 0.13
gi|39579715|emb|CAE56228.1| Hypothetical protein CBG23863 [Caeno... 39 0.13
gi|39588618|emb|CAE58142.1| Hypothetical protein CBG01231 [Caeno... 39 0.17
gi|22299093|ref|NP_682340.1| ORF_ID:tll1550~hypothetical protein... 39 0.17
gi|17561156|ref|NP_507395.1| predicted CDS, putative cytoplasmic... 39 0.17
gi|39581729|emb|CAE71062.1| Hypothetical protein CBG17905 [Caeno... 39 0.22
gi|39582903|emb|CAE71679.1| Hypothetical protein CBG18652 [Caeno... 39 0.22
gi|39582107|emb|CAE60783.1| Hypothetical protein CBG04472 [Caeno... 38 0.29
gi|34850050|gb|AAF02103.2| Hypothetical protein F52D2.8 [Caenorh... 38 0.29
gi|39585364|emb|CAE61686.1| Hypothetical protein CBG05632 [Caeno... 38 0.29
gi|32566891|ref|NP_507862.2| cyclin-like F-box and Protein of un... 38 0.29
gi|17551296|ref|NP_510413.1| predicted CDS, cyclin-like F-box an... 38 0.37
gi|17540810|ref|NP_500353.1| protein of unknown function DUF38 a... 37 0.49
gi|39581347|emb|CAE71556.1| Hypothetical protein CBG18504 [Caeno... 37 0.64
gi|31203347|ref|XP_310622.1| ENSANGP00000020048 [Anopheles gambi... 37 0.83
gi|39582902|emb|CAE71678.1| Hypothetical protein CBG18651 [Caeno... 37 0.83
gi|17565608|ref|NP_503556.1| predicted CDS, protein of unknown f... 37 0.83
gi|39582908|emb|CAE71684.1| Hypothetical protein CBG18658 [Caeno... 37 0.83
gi|39590093|emb|CAE61091.1| Hypothetical protein CBG04844 [Caeno... 36 1.1
gi|17568447|ref|NP_510500.1| predicted CDS, putative cytoplasmic... 36 1.4
gi|39588617|emb|CAE58141.1| Hypothetical protein CBG01230 [Caeno... 35 1.9
gi|39589945|emb|CAE60943.1| Hypothetical protein CBG04669 [Caeno... 35 3.2
gi|38102931|gb|EAA49705.1| hypothetical protein MG09696.4 [Magna... 35 3.2
gi|39589974|emb|CAE60972.1| Hypothetical protein CBG04704 [Caeno... 35 3.2
gi|39997703|ref|NP_953654.1| type IV pilus assembly protein, put... 34 4.1
gi|33620962|gb|AAB65278.2| Hypothetical protein F17A9.1 [Caenorh... 34 4.1
gi|17562492|ref|NP_507378.1| predicted CDS, putative cytoplasmic... 34 4.1
gi|39582410|emb|CAE74794.1| Hypothetical protein CBG22625 [Caeno... 34 4.1
gi|39592060|emb|CAE75280.1| Hypothetical protein CBG23246 [Caeno... 34 5.4
gi|50507783|emb|CAB04645.2| Hypothetical protein R10E8.2 [Caenor... 34 5.4
gi|39585342|emb|CAE61664.1| Hypothetical protein CBG05602 [Caeno... 34 5.4
gi|38085389|ref|XP_124811.2| similar to tubulin, beta 3 [Mus mus... 34 5.4
gi|17563090|ref|NP_507570.1| putative cytoplasmic protein family... 34 5.4
gi|34896902|ref|NP_909795.1| hypothetical protein [Oryza sativa ... 33 7.0
gi|17561152|ref|NP_507391.1| cyclin-like F-box and Protein of un... 33 7.0
gi|42408778|dbj|BAD10013.1| hypothetical protein [Oryza sativa (... 33 7.0
gi|33151990|ref|NP_873343.1| 3'-phosphoadenosine 5'-phosphosulfa... 33 9.2
gi|42408781|dbj|BAD10016.1| hypothetical protein [Oryza sativa (... 33 9.2
gi|29436402|gb|AAH49852.1| Sympk protein [Mus musculus] 33 9.2
gi|23486062|gb|EAA20704.1| hypothetical protein [Plasmodium yoel... 33 9.2
>gi|17566470|ref|NP_507896.1| feminization Of Germline FOG-2,
cyclin-like F-box and Protein of unknown function DUF38
family member (35.8 kD) (fog-2) [Caenorhabditis elegans]
gi|7509334|pir||T26439 hypothetical protein Y113G7B.5 -
Caenorhabditis elegans
gi|5824693|emb|CAB54327.1| Hypothetical protein Y113G7B.5
[Caenorhabditis elegans]
Length = 312
Score = 632 bits (1630), Expect = e-180
Identities = 312/312 (100%), Positives = 312/312 (100%)
Frame = +1
Query: 1 MSENLTDELDLMKISGPPSFSDMPMETVYKIVGKVDPYSRLAVRKVCRNLRNVIDDTDPG 180
MSENLTDELDLMKISGPPSFSDMPMETVYKIVGKVDPYSRLAVRKVCRNLRNVIDDTDPG
Sbjct: 1 MSENLTDELDLMKISGPPSFSDMPMETVYKIVGKVDPYSRLAVRKVCRNLRNVIDDTDPG 60
Query: 181 FKYVKVDLSRYASRLWLTNIGRGAICYSRNSNDPGCTVRRTSQSKSIEKTQLDAILDDLA 360
FKYVKVDLSRYASRLWLTNIGRGAICYSRNSNDPGCTVRRTSQSKSIEKTQLDAILDDLA
Sbjct: 61 FKYVKVDLSRYASRLWLTNIGRGAICYSRNSNDPGCTVRRTSQSKSIEKTQLDAILDDLA 120
Query: 361 VIVKNPKLRLDNFVIVSSHEASKQFVEWIRDIAQSGILLHTKKIKLDIFPLKDVFGVLSH 540
VIVKNPKLRLDNFVIVSSHEASKQFVEWIRDIAQSGILLHTKKIKLDIFPLKDVFGVLSH
Sbjct: 121 VIVKNPKLRLDNFVIVSSHEASKQFVEWIRDIAQSGILLHTKKIKLDIFPLKDVFGVLSH 180
Query: 541 CKPGFLEDIEFYCYDSAGKMDEIINLEQWKRAKSINIEGRVCEDIPIEHFFHFSRITIKL 720
CKPGFLEDIEFYCYDSAGKMDEIINLEQWKRAKSINIEGRVCEDIPIEHFFHFSRITIKL
Sbjct: 181 CKPGFLEDIEFYCYDSAGKMDEIINLEQWKRAKSINIEGRVCEDIPIEHFFHFSRITIKL 240
Query: 721 RKLSVSDAIKIRDDLMKSAHFEYAYIKIIEGVDPDVLRAINPNYHPYDALDPFEHGNYTF 900
RKLSVSDAIKIRDDLMKSAHFEYAYIKIIEGVDPDVLRAINPNYHPYDALDPFEHGNYTF
Sbjct: 241 RKLSVSDAIKIRDDLMKSAHFEYAYIKIIEGVDPDVLRAINPNYHPYDALDPFEHGNYTF 300
Query: 901 RISSDKDDLALL 936
RISSDKDDLALL
Sbjct: 301 RISSDKDDLALL 312