Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y116F11A_3
(543 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17566502|ref|NP_507820.1| putative cytoplasmic protein of anc... 360 1e-98
gi|17550334|ref|NP_510656.1| putative nuclear protein of ancient... 266 2e-70
gi|50290603|ref|XP_447734.1| unnamed protein product [Candida gl... 79 7e-14
gi|6321820|ref|NP_011896.1| involved in rDNA replication and Ty1... 75 6e-13
gi|11282390|pir||T47241 RRM3/PIF1 helicase homolog - fission yea... 70 2e-11
gi|19113280|ref|NP_596488.1| rrm3-pif1 helicase homolog [Schizos... 70 2e-11
gi|50085149|ref|YP_046659.1| putative helicase [Acinetobacter sp... 69 5e-11
gi|45190733|ref|NP_984987.1| AER128Wp [Eremothecium gossypii] >g... 69 5e-11
gi|45190836|ref|NP_985090.1| AER233Cp [Eremothecium gossypii] >g... 67 2e-10
gi|9631016|ref|NP_047686.1| Ld-helicase-2 [Lymantria dispar nucl... 67 2e-10
gi|49072088|ref|XP_400333.1| hypothetical protein UM02718.1 [Ust... 67 3e-10
gi|50421909|ref|XP_459513.1| unnamed protein product [Debaryomyc... 65 1e-09
gi|50307359|ref|XP_453658.1| unnamed protein product [Kluyveromy... 65 1e-09
gi|48097793|ref|XP_393890.1| similar to CG3238-PA [Apis mellifera] 64 1e-09
gi|46433720|gb|EAK93151.1| hypothetical protein CaO19.6133 [Cand... 64 2e-09
gi|46433759|gb|EAK93189.1| hypothetical protein CaO19.13552 [Can... 64 2e-09
gi|21686778|ref|NP_663278.1| helicase 2 [Phthorimaea operculella... 63 3e-09
gi|50259189|gb|EAL21864.1| hypothetical protein CNBC4370 [Crypto... 63 3e-09
gi|34365520|tpg|DAA01286.1| TPA: replicase/helicase/endonuclease... 63 4e-09
gi|34539934|ref|NP_904413.1| TPR domain protein [Porphyromonas g... 63 4e-09
gi|32698647|ref|NP_872562.1| helicase-2 [Adoxophyes orana granul... 63 4e-09
gi|50876876|emb|CAG36716.1| related to 5' to 3' DNA helicase [De... 62 6e-09
gi|46309338|ref|YP_006228.1| ORF116 [Agrotis segetum granuloviru... 61 1e-08
gi|50546699|ref|XP_500819.1| hypothetical protein [Yarrowia lipo... 61 1e-08
gi|50293687|ref|XP_449255.1| unnamed protein product [Candida gl... 61 1e-08
gi|38488735|ref|NP_942102.1| zgc:56161; wu:fe11d03; ORFNames=wu:... 60 2e-08
gi|34365524|tpg|DAA01287.1| TPA: replicase/helicase/endonuclease... 60 2e-08
gi|50751808|ref|XP_426648.1| PREDICTED: similar to Zgc:56161 [Ga... 60 3e-08
gi|37535038|ref|NP_921821.1| putative helicase [Oryza sativa (ja... 59 4e-08
gi|15078743|ref|NP_149493.1| 030L [Invertebrate iridescent virus... 59 4e-08
gi|14602363|ref|NP_148910.1| ORF126 HELICASE-2 [Cydia pomonella ... 59 4e-08
gi|25353667|pir||F84517 probable helicase [imported] - Arabidops... 59 5e-08
gi|29248851|gb|EAA40375.1| GLP_567_39852_37534 [Giardia lamblia ... 59 5e-08
gi|28201555|gb|AAO34493.1| putative helicase [Oryza sativa (japo... 59 5e-08
gi|50303643|ref|XP_451763.1| unnamed protein product [Kluyveromy... 58 9e-08
gi|37533896|ref|NP_921250.1| Helicase-like protein [Oryza sativa... 58 9e-08
gi|15219133|ref|NP_175704.1| hypothetical protein [Arabidopsis t... 58 1e-07
gi|19920652|ref|NP_608782.1| CG3238-PA [Drosophila melanogaster]... 57 2e-07
gi|32414651|ref|XP_327805.1| hypothetical protein [Neurospora cr... 57 2e-07
gi|23466269|ref|NP_696872.1| possible helicase [Bifidobacterium ... 57 2e-07
gi|23335557|ref|ZP_00120792.1| COG0507: ATP-dependent exoDNAse (... 57 2e-07
gi|46122289|ref|XP_385698.1| hypothetical protein FG05522.1 [Gib... 57 2e-07
gi|15221815|ref|NP_175845.1| hypothetical protein [Arabidopsis t... 57 2e-07
gi|9635396|ref|NP_059294.1| ORF146 [Xestia c-nigrum granulovirus... 57 2e-07
gi|34910280|ref|NP_916487.1| helicase-like protein [Oryza sativa... 57 3e-07
gi|20197614|gb|AAM15154.1| unknown protein [Arabidopsis thaliana... 57 3e-07
gi|25143421|ref|NP_490774.2| yeast PIF1p helicase homolog (75.2 ... 57 3e-07
gi|29346131|ref|NP_809634.1| DNA repair and recombination protei... 57 3e-07
gi|37531978|ref|NP_920291.1| putative helicase [Oryza sativa (ja... 56 4e-07
gi|50878398|gb|AAT85173.1| hypothetical protein [Oryza sativa (j... 56 4e-07
gi|34904560|ref|NP_913627.1| putative helicase [Oryza sativa (ja... 56 4e-07
gi|22857576|gb|AAN09850.1| putative helicase, 3'-partial [Oryza ... 56 4e-07
gi|31226638|ref|XP_317740.1| ENSANGP00000010202 [Anopheles gambi... 56 5e-07
gi|37535030|ref|NP_921817.1| hypothetical protein [Oryza sativa ... 56 5e-07
gi|37531806|ref|NP_920205.1| putative DNA helicase homolog [Oryz... 55 6e-07
gi|50549723|ref|XP_502332.1| hypothetical protein [Yarrowia lipo... 55 6e-07
gi|34911738|ref|NP_917216.1| P0707D10.33 [Oryza sativa (japonica... 55 8e-07
gi|34883005|ref|XP_346238.1| similar to AI449441 protein [Rattus... 55 1e-06
gi|34864703|ref|XP_236355.2| similar to AI449441 protein [Rattus... 55 1e-06
gi|10177991|dbj|BAB11364.1| helicase [Arabidopsis thaliana] 54 1e-06
gi|130196|sp|P07271|PIF1_YEAST DNA repair and recombination prot... 54 1e-06
gi|34902784|ref|NP_912739.1| unnamed protein product [Oryza sati... 54 1e-06
gi|6323579|ref|NP_013650.1| involved in repair and recombination... 54 1e-06
gi|29349538|ref|NP_813041.1| putative helicase [Bacteroides thet... 54 1e-06
gi|558414|emb|CAA86260.1| PIF1 [Saccharomyces cerevisiae] 54 1e-06
gi|21741343|emb|CAD40616.1| OSJNBb0066J23.21 [Oryza sativa (japo... 54 1e-06
gi|27369615|ref|NP_766041.1| PIF1 homolog; DNA helicase-like pro... 54 2e-06
gi|30313414|gb|AAM50051.1| DNA helicase-like protein [Mus muscul... 54 2e-06
gi|25404482|pir||C96668 unknown protein F15H21.18 [imported] - A... 54 2e-06
gi|22549428|ref|NP_689201.1| putative helicase 2 [Mamestra confi... 54 2e-06
gi|42562935|ref|NP_176623.2| hypothetical protein [Arabidopsis t... 54 2e-06
gi|28302235|gb|AAH46611.1| AI449441 protein [Mus musculus] 54 2e-06
gi|34015367|gb|AAQ56555.1| hypothetical protein OSJNBa0070J19.12... 54 2e-06
gi|32403802|ref|XP_322514.1| hypothetical protein [Neurospora cr... 54 2e-06
gi|40882151|emb|CAF05978.1| related to PIF1 protein precursor [N... 54 2e-06
gi|21743013|emb|CAD40308.1| OSJNBb0013O03.3 [Oryza sativa (japon... 53 3e-06
gi|15230775|ref|NP_189662.1| hypothetical protein [Arabidopsis t... 53 3e-06
gi|50254997|gb|EAL17737.1| hypothetical protein CNBL2510 [Crypto... 53 3e-06
gi|34541633|ref|NP_906112.1| helicase, putative [Porphyromonas g... 53 3e-06
gi|34903106|ref|NP_912900.1| unnamed protein product [Oryza sati... 53 4e-06
gi|48855600|ref|ZP_00309759.1| COG0507: ATP-dependent exoDNAse (... 53 4e-06
gi|33622316|ref|NP_891963.1| helicase-2 [Cryptophlebia leucotret... 53 4e-06
gi|38099217|gb|EAA46591.1| hypothetical protein MG08934.4 [Magna... 52 5e-06
gi|50423051|ref|XP_460104.1| unnamed protein product [Debaryomyc... 52 7e-06
gi|31197075|ref|XP_307485.1| ENSANGP00000002164 [Anopheles gambi... 52 7e-06
gi|46440474|gb|EAK99780.1| hypothetical protein CaO19.7538 [Cand... 52 7e-06
gi|39585904|emb|CAE61318.1| Hypothetical protein CBG05155 [Caeno... 52 7e-06
gi|15231181|ref|NP_187933.1| hypothetical protein [Arabidopsis t... 52 9e-06
gi|9294530|dbj|BAB02793.1| helicase-like protein [Arabidopsis th... 52 9e-06
gi|15228453|ref|NP_189796.1| AT hook motif-containing protein-re... 52 9e-06
gi|24960752|gb|AAN65446.1| Putative helicase [Oryza sativa (japo... 51 1e-05
gi|38424032|dbj|BAD01692.1| helicase-like protein [Oryza sativa ... 51 1e-05
gi|50543152|ref|XP_499742.1| hypothetical protein [Yarrowia lipo... 51 1e-05
gi|31196209|ref|XP_307052.1| ENSANGP00000011910 [Anopheles gambi... 51 1e-05
gi|42524898|ref|NP_970278.1| RRM3/PIF1 helicase homolog [Bdellov... 50 2e-05
gi|34914948|ref|NP_918821.1| helicase-like protein [Oryza sativa... 50 2e-05
gi|38106177|gb|EAA52520.1| hypothetical protein MG05212.4 [Magna... 50 3e-05
gi|34912980|ref|NP_917837.1| B1158C05.18 [Oryza sativa (japonica... 50 3e-05
gi|34394334|dbj|BAC84865.1| helicase-like protein [Oryza sativa ... 50 3e-05
gi|34906276|ref|NP_914485.1| P0489A01.23 [Oryza sativa (japonica... 50 3e-05
gi|38346906|emb|CAE03875.2| OSJNBb0015N08.3 [Oryza sativa (japon... 49 4e-05
gi|11068110|ref|NP_068326.1| PxORF107 peptide [Plutella xylostel... 49 4e-05
gi|25353661|pir||H84464 probable helicase [imported] - Arabidops... 49 6e-05
gi|42568948|ref|NP_178583.2| hypothetical protein [Arabidopsis t... 49 6e-05
gi|34365522|tpg|DAA01288.1| TPA: replicase/helicase/endonuclease... 49 7e-05
gi|25353663|pir||H84486 probable helicase [imported] - Arabidops... 48 1e-04
gi|31212315|ref|XP_315142.1| ENSANGP00000000840 [Anopheles gambi... 48 1e-04
gi|15229268|ref|NP_189921.1| helicase-related [Arabidopsis thali... 48 1e-04
gi|34365516|tpg|DAA01284.1| TPA: replicase/helicase/endonuclease... 48 1e-04
gi|15231996|ref|NP_189741.1| hypothetical protein [Arabidopsis t... 47 2e-04
gi|7687929|emb|CAB89609.1| possible DNA helicase homologue [Leis... 47 2e-04
gi|31202585|ref|XP_310241.1| ENSANGP00000017255 [Anopheles gambi... 47 2e-04
gi|34365518|tpg|DAA01285.1| TPA: replicase/helicase/endonuclease... 46 4e-04
gi|10176813|dbj|BAB10021.1| unnamed protein product [Arabidopsis... 45 6e-04
gi|17537113|ref|NP_493834.1| putative endoplasmic reticulum prot... 45 0.001
gi|34905464|ref|NP_914079.1| P0487H02.26 [Oryza sativa (japonica... 45 0.001
gi|17533663|ref|NP_494302.1| predicted CDS, putative protein of ... 45 0.001
gi|46115252|ref|XP_383644.1| hypothetical protein FG03468.1 [Gib... 45 0.001
gi|31229703|ref|XP_318271.1| ENSANGP00000001497 [Anopheles gambi... 45 0.001
gi|17534623|ref|NP_494149.1| predicted CDS, putative protein of ... 45 0.001
gi|15792274|ref|NP_282097.1| putative helicase [Campylobacter je... 45 0.001
gi|50550305|ref|XP_502625.1| hypothetical protein [Yarrowia lipo... 44 0.001
gi|15230800|ref|NP_189677.1| hypothetical protein [Arabidopsis t... 44 0.001
gi|31194667|ref|XP_306281.1| ENSANGP00000015451 [Anopheles gambi... 44 0.001
gi|50543634|ref|XP_499983.1| hypothetical protein [Yarrowia lipo... 44 0.001
gi|14140286|gb|AAK54292.1| putative helicase [Oryza sativa (japo... 44 0.002
gi|17536989|ref|NP_494464.1| 7TM chemoreceptor, subfamily 2 (2D4... 44 0.002
gi|42630865|ref|ZP_00156404.1| COG0507: ATP-dependent exoDNAse (... 43 0.003
gi|33620434|ref|NP_891582.1| Dda DNA helicase [Enterobacteria ph... 43 0.003
gi|9279565|dbj|BAB01023.1| helicase-like protein [Arabidopsis th... 43 0.004
gi|7487549|pir||T01955 hypothetical protein T2L5.8 - Arabidopsis... 43 0.004
gi|38346787|emb|CAE02205.2| OSJNBa0095H06.12 [Oryza sativa (japo... 42 0.007
gi|17536913|ref|NP_494143.1| predicted CDS, putative protein of ... 42 0.009
gi|17537853|ref|NP_494142.1| predicted CDS, putative endoplasmic... 42 0.009
gi|31207429|ref|XP_312681.1| ENSANGP00000000228 [Anopheles gambi... 41 0.012
gi|17158548|ref|NP_477969.1| wsv447 [shrimp white spot syndrome ... 41 0.015
gi|19482099|gb|AAL89375.1| WSSV507 [shrimp white spot syndrome v... 41 0.015
gi|15220267|ref|NP_174828.1| AT hook motif-containing protein-re... 40 0.020
gi|31200647|ref|XP_309271.1| ENSANGP00000011991 [Anopheles gambi... 40 0.020
gi|49475825|ref|YP_033866.1| hypothetical protein BH10910 [Barto... 38 0.099
gi|25353665|pir||H84515 probable helicase [imported] - Arabidops... 38 0.13
gi|12324712|gb|AAG52315.1| hypothetical protein, 5' partial; 938... 37 0.17
gi|15924609|ref|NP_372143.1| hypothetical protein SAV1619 [Staph... 37 0.22
gi|49483864|ref|YP_041088.1| conserved hypothetical protein [Sta... 37 0.22
gi|21283298|ref|NP_646386.1| ORFID:MW1569~hypothetical protein, ... 37 0.22
gi|46445644|ref|YP_007009.1| putative exodeoxyribonuclease V alp... 37 0.22
gi|49095908|ref|XP_409415.1| hypothetical protein AN5278.2 [Aspe... 37 0.29
gi|24380231|ref|NP_722186.1| putative exodeoxyribonuclease V, si... 37 0.29
gi|15236364|ref|NP_192278.1| hypothetical protein [Arabidopsis t... 36 0.38
gi|50083655|ref|YP_045165.1| exonuclease V, alpha subunit [Acine... 36 0.49
gi|38636971|dbj|BAD03231.1| putative NBS-LRR disease resistance ... 36 0.49
gi|29349390|ref|NP_812893.1| ATP-dependent exoDNAse (exonuclease... 36 0.49
gi|13471448|ref|NP_103014.1| hypothetical protein mll1421 [Mesor... 35 0.64
gi|48765582|ref|ZP_00270132.1| COG1112: Superfamily I DNA and RN... 35 0.64
gi|26554342|ref|NP_758276.1| excinuclease ABC subunit B [Mycopla... 35 0.84
gi|15604751|ref|NP_219535.1| Exodeoxyribonuclease V, Alpha [Chla... 35 0.84
gi|48893996|ref|ZP_00327194.1| COG3854: Uncharacterized protein ... 35 1.1
gi|22969880|ref|ZP_00017084.1| hypothetical protein [Chloroflexu... 35 1.1
gi|50365138|ref|YP_053563.1| exodeoxyribonuclease V [Mesoplasma ... 34 1.4
gi|12324328|gb|AAG52137.1| putative ATPase; 52924-55985 [Arabido... 34 1.4
gi|11465517|ref|NP_045092.1| unknown [Cyanidium caldarium] >gnl|... 34 1.4
gi|50657706|gb|AAT79691.1| conserved hypothetical plastid protei... 34 1.4
gi|22330595|ref|NP_177460.2| expressed protein [Arabidopsis thal... 34 1.4
gi|47209162|emb|CAF90337.1| unnamed protein product [Tetraodon n... 34 1.9
gi|23321155|gb|AAN23087.1| putative rp3 protein [Zea mays] 34 1.9
gi|38344164|emb|CAE03495.2| OSJNBa0053K19.3 [Oryza sativa (japon... 34 1.9
gi|27468220|ref|NP_764857.1| deoxyribonuclease [Staphylococcus e... 34 1.9
gi|2706531|emb|CAA75825.1| hypothetical protein [Coxiella burnetii] 34 1.9
gi|23321163|gb|AAN23091.1| putative rp3 protein [Zea mays] 34 1.9
gi|45934295|gb|AAS79233.1| rust resistance protein rp3-1 [Zea mays] 34 1.9
gi|17935912|ref|NP_532702.1| exodeoxyribonuclease V [Agrobacteri... 34 1.9
gi|18086459|gb|AAL57683.1| At1g73170/T18K17_17 [Arabidopsis thal... 34 1.9
gi|6322835|ref|NP_012908.1| Hexameric DNA polymerase alpha-assoc... 34 1.9
gi|22537863|ref|NP_688714.1| helicase, putative [Streptococcus a... 34 1.9
gi|25011808|ref|NP_736203.1| Unknown [Streptococcus agalactiae N... 34 1.9
gi|15232624|ref|NP_190257.1| disease resistance protein (CC-NBS ... 33 2.4
gi|39593524|emb|CAE61816.1| Hypothetical protein CBG05784 [Caeno... 33 2.4
gi|50876234|emb|CAG36074.1| related to exodeoxyribonuclease V, a... 33 2.4
gi|29375517|ref|NP_814671.1| conserved hypothetical protein [Ent... 33 2.4
gi|27379377|ref|NP_770906.1| bll4266 [Bradyrhizobium japonicum U... 33 2.4
gi|37678445|ref|NP_933054.1| conserved hypothetical protein [Vib... 33 2.4
gi|11467491|ref|NP_043637.1| ORF455 [Odontella sinensis] >gnl|BL... 33 2.4
gi|23321143|gb|AAN23081.1| putative rp3 protein [Zea mays] >gnl|... 33 2.4
gi|25353659|pir||A96586 hypothetical protein F20D21.24 [imported... 33 2.4
gi|23321147|gb|AAN23083.1| putative rp3 protein [Zea mays] 33 2.4
gi|17506005|ref|NP_491343.1| cell Division Cycle related (57.7 k... 33 2.4
gi|23321145|gb|AAN23082.1| putative rp3 protein [Zea mays] 33 2.4
gi|38505774|ref|NP_942288.1| exodeoxyribonuclease V alpha chain ... 33 2.4
gi|45914209|ref|ZP_00192536.2| COG0507: ATP-dependent exoDNAse (... 33 2.4
gi|49474430|ref|YP_032472.1| hypothetical protein BQ08560 [Barto... 33 2.4
gi|50426053|ref|XP_461623.1| unnamed protein product [Debaryomyc... 33 2.4
gi|50802732|ref|XP_424244.1| PREDICTED: similar to KIAA1709 prot... 33 3.2
gi|23321157|gb|AAN23088.1| putative rp3 protein [Zea mays] 33 3.2
gi|25403484|pir||B86483 protein F5J5.15 [imported] - Arabidopsis... 33 3.2
gi|30264464|ref|NP_846841.1| helicase, putative [Bacillus anthra... 33 3.2
gi|33866596|ref|NP_898155.1| conserved hypothetical protein [Syn... 33 3.2
gi|23321153|gb|AAN23086.1| putative rp3 protein [Zea mays] 33 3.2
gi|23321165|gb|AAN23092.1| putative rp3 protein [Zea mays] 33 3.2
gi|46913863|emb|CAG20645.1| conserved hypothetical protein, memb... 33 3.2
gi|15834922|ref|NP_296681.1| exodeoxyribonuclease V, alpha subun... 33 3.2
gi|49481477|ref|YP_038444.1| exodeoxyribonuclease V, alpha subun... 33 3.2
gi|21402438|ref|NP_658423.1| hypothetical protein predicted by G... 33 3.2
gi|30022470|ref|NP_834101.1| Exodeoxyribonuclease V alpha chain ... 33 3.2
gi|47566582|ref|ZP_00237404.1| helicase, RecD/TraA family [Bacil... 33 3.2
gi|42783523|ref|NP_980770.1| helicase, putative [Bacillus cereus... 33 3.2
gi|17986902|ref|NP_539536.1| EXODEOXYRIBONUCLEASE V ALPHA CHAIN ... 33 3.2
gi|23321149|gb|AAN23084.1| putative rp3 protein [Zea mays] 33 3.2
gi|15232622|ref|NP_190255.1| disease resistance protein (CC-NBS-... 33 4.2
gi|33863996|ref|NP_895556.1| AAA ATPase superfamily [Prochloroco... 33 4.2
gi|33519732|ref|NP_878564.1| exonuclease V, alpha chain [Candida... 33 4.2
gi|47458928|ref|YP_015790.1| exodeoxyribonuclease V alpha chain ... 33 4.2
gi|42561047|ref|NP_975498.1| Exodeoxyribonuclease V alpha subuni... 33 4.2
gi|27817864|dbj|BAC55632.1| helicase-like protein [Oryza sativa ... 32 5.4
gi|50309135|ref|XP_454573.1| unnamed protein product [Kluyveromy... 32 5.4
gi|21228807|ref|NP_634729.1| type I restriction-modification sys... 32 5.4
gi|46228358|gb|EAK89257.1| replication factor RFC3 AAA+ ATpase [... 32 5.4
gi|45185944|ref|NP_983660.1| ACR258Wp [Eremothecium gossypii] >g... 32 5.4
gi|37524634|ref|NP_927978.1| Exodeoxyribonuclease V alpha chain ... 32 5.4
gi|48865497|ref|ZP_00319357.1| COG3410: Uncharacterized conserve... 32 5.4
gi|10956028|ref|NP_052850.1| hypothetical protein [Coxiella burn... 32 5.4
gi|49094704|ref|XP_408813.1| hypothetical protein AN4676.2 [Aspe... 32 7.1
gi|34763074|ref|ZP_00144046.1| Sigma-54-dependent transcriptiona... 32 7.1
gi|4324420|gb|AAD16881.1| prespore-specific protein [Dictyosteli... 32 7.1
gi|15618661|ref|NP_224947.1| Exodeoxyribonuclease V, Alpha [Chla... 32 7.1
gi|15836285|ref|NP_300809.1| exodeoxyribonuclease V, alpha [Chla... 32 7.1
gi|37523337|ref|NP_926714.1| hypothetical protein gvip509 [Gloeo... 32 7.1
gi|32408431|ref|XP_324697.1| hypothetical protein [Neurospora cr... 32 7.1
gi|15894427|ref|NP_347776.1| Exodeoxyribonuclease V, Alpha subun... 32 9.3
gi|30681308|ref|NP_566373.2| sporulation protein-related [Arabid... 32 9.3
gi|11465747|ref|NP_053891.1| unknown [Porphyra purpurea] >gnl|BL... 32 9.3
gi|50556978|ref|XP_505897.1| hypothetical protein [Yarrowia lipo... 32 9.3
gi|17534209|ref|NP_495768.1| thyroid peroxidase precursor family... 32 9.3
gi|37533690|ref|NP_921147.1| hypothetical protein [Oryza sativa ... 32 9.3
gi|321458|pir||A45068 5'-3' DNA helicase - phage T4 >gnl|BL_ORD_... 32 9.3
gi|13162655|gb|AAG23283.1| probable exodeoxyribonuclease V [Sacc... 32 9.3
gi|39594138|emb|CAE70248.1| Hypothetical protein CBG16740 [Caeno... 32 9.3
gi|15810179|gb|AAL06991.1| AT3g10420/F13M14_30 [Arabidopsis thal... 32 9.3
gi|30681303|ref|NP_850553.1| sporulation protein-related [Arabid... 32 9.3
gi|23127908|ref|ZP_00109767.1| COG3854: Uncharacterized protein ... 32 9.3
gi|39587191|emb|CAE57659.1| Hypothetical protein CBG00649 [Caeno... 32 9.3
gi|50260070|gb|EAL22733.1| hypothetical protein CNBB1810 [Crypto... 32 9.3
gi|23480940|gb|EAA17369.1| hypothetical protein [Plasmodium yoel... 32 9.3
>gi|17566502|ref|NP_507820.1| putative cytoplasmic protein of
ancient origin (5U201) [Caenorhabditis elegans]
gi|6433776|emb|CAB60760.1| Hypothetical protein Y116F11A.1
[Caenorhabditis elegans]
Length = 180
Score = 360 bits (923), Expect = 1e-98
Identities = 180/180 (100%), Positives = 180/180 (100%)
Frame = +1
Query: 1 MANDEQQQLLNKIVRDDSQDKQVLLMINGAAGTGKTFLIKLIENSMNRSVRKRVVLMTGS 180
MANDEQQQLLNKIVRDDSQDKQVLLMINGAAGTGKTFLIKLIENSMNRSVRKRVVLMTGS
Sbjct: 1 MANDEQQQLLNKIVRDDSQDKQVLLMINGAAGTGKTFLIKLIENSMNRSVRKRVVLMTGS 60
Query: 181 TGKAAKAIGGRTLHCTIGLPNEKPEDLERLKYQAFICVTTRLIIIDEITLLASWHLDATD 360
TGKAAKAIGGRTLHCTIGLPNEKPEDLERLKYQAFICVTTRLIIIDEITLLASWHLDATD
Sbjct: 61 TGKAAKAIGGRTLHCTIGLPNEKPEDLERLKYQAFICVTTRLIIIDEITLLASWHLDATD 120
Query: 361 MVLKRTPKRTDALFGGLSIILVGDLRQLNLGGWRGKKQIDTVFIKVGGYPDPISCQNVCD 540
MVLKRTPKRTDALFGGLSIILVGDLRQLNLGGWRGKKQIDTVFIKVGGYPDPISCQNVCD
Sbjct: 121 MVLKRTPKRTDALFGGLSIILVGDLRQLNLGGWRGKKQIDTVFIKVGGYPDPISCQNVCD 180