Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y11D7A_12
         (942 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ...   295   1e-78
gi|39598361|emb|CAE69054.1| Hypothetical protein CBG15063 [Caeno...    95   2e-18
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ...    75   2e-12
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ...    72   2e-11
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno...    71   3e-11
gi|39598359|emb|CAE69052.1| Hypothetical protein CBG15061 [Caeno...    71   3e-11
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ...    70   5e-11
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ...    70   5e-11
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ...    70   7e-11
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor...    70   7e-11
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno...    70   9e-11
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno...    69   2e-10
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ...    69   2e-10
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno...    69   2e-10
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co...    69   2e-10
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno...    68   3e-10
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ...    67   4e-10
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno...    64   4e-09
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno...    64   4e-09
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ...    64   5e-09
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno...    62   1e-08
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno...    59   1e-07
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [...    57   6e-07
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ...    55   2e-06
gi|39596236|emb|CAE69873.1| Hypothetical protein CBG16210 [Caeno...    54   4e-06
gi|7508918|pir||T26125 hypothetical protein W03G11.1 - Caenorhab...    54   7e-06
gi|17570227|ref|NP_510021.1| COLlagen structural gene (col-181) ...    54   7e-06
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c...    53   9e-06
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno...    53   9e-06
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ...    52   2e-05
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [...    52   3e-05
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno...    52   3e-05
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno...    51   4e-05
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans]             50   7e-05
gi|687634|gb|AAA62504.1| collagen                                      50   1e-04
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno...    49   2e-04
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab...    49   2e-04
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg...    49   2e-04
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [...    49   2e-04
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ...    49   2e-04
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ...    48   4e-04
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd...    48   4e-04
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ...    48   4e-04
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ...    47   5e-04
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno...    46   0.001
gi|1222642|emb|CAA63070.1| collagen [Brugia pahangi]                   45   0.002
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno...    45   0.002
gi|7378665|emb|CAB85468.1| putative cuticular collagen [Brugia p...    45   0.002
gi|16552857|dbj|BAB71393.1| unnamed protein product [Homo sapiens]     45   0.003
gi|39579438|emb|CAE56766.1| Hypothetical protein CBG24569 [Caeno...    45   0.003
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum]            44   0.004
gi|5514647|emb|CAB50767.1| putative cuticular collagen protein [...    44   0.004
gi|42601246|gb|AAS21320.1| major royal jelly protein MRJP5 precu...    44   0.005
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno...    44   0.005
gi|46195903|gb|AAB37842.2| Collagen protein 20 [Caenorhabditis e...    44   0.005
gi|7498929|pir||T29980 hypothetical protein F11G11.10 - Caenorha...    44   0.005
gi|42660655|ref|XP_370881.2| similar to FLJ40113 protein [Homo s...    44   0.007
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno...    44   0.007
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ...    44   0.007
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ...    44   0.007
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8]                 43   0.009
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv...    43   0.009
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ...    43   0.009
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno...    43   0.009
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2                    43   0.009
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano...    43   0.012
gi|17550810|ref|NP_509869.1| COLlagen structural gene (27.8 kD) ...    43   0.012
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8]                  43   0.012
gi|17550812|ref|NP_509870.1| COLlagen structural gene (col-179) ...    43   0.012
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd...    43   0.012
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno...    43   0.012
gi|17533115|ref|NP_494880.1| COLlagen structural gene (col-73) [...    42   0.015
gi|39594817|emb|CAE70685.1| Hypothetical protein CBG17402 [Caeno...    42   0.015
gi|39594818|emb|CAE70686.1| Hypothetical protein CBG17403 [Caeno...    42   0.015
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p...    42   0.015
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ...    42   0.020
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par...    42   0.026
gi|20138902|sp|O97432|MRJ5_APIME Major royal jelly protein 5 pre...    42   0.026
gi|39591241|emb|CAE73294.1| Hypothetical protein CBG20714 [Caeno...    42   0.026
gi|17551374|ref|NP_510617.1| COLlagen structural gene (col-186) ...    42   0.026
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ...    42   0.026
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [...    42   0.026
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [...    42   0.026
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi...    41   0.034
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ...    41   0.044
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno...    41   0.044
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ...    41   0.044
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn...    41   0.044
gi|33589142|emb|CAE45096.1| Hypothetical protein Y51H4A.28 [Caen...    41   0.044
gi|39595279|emb|CAE60316.1| Hypothetical protein CBG03907 [Caeno...    40   0.058
gi|32567349|ref|NP_872207.1| COLlagen structural gene (col-42) [...    40   0.058
gi|23508443|ref|NP_701112.1| hypothetical protein [Plasmodium fa...    40   0.058
gi|49114816|gb|AAH72760.1| Unknown (protein for IMAGE:5073172) [...    40   0.058
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ...    40   0.058
gi|50731940|ref|XP_418425.1| PREDICTED: similar to collagen, typ...    40   0.076
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno...    40   0.076
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel...    40   0.099
gi|42528111|ref|NP_973209.1| conserved hypothetical protein [Tre...    40   0.099
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-...    40   0.099
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno...    40   0.099
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [...    40   0.099
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl...    39   0.13
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ...    39   0.13
gi|17507553|ref|NP_490679.1| COLlagen structural gene (col-45) [...    39   0.13
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C...    39   0.13
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno...    39   0.13
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40                   39   0.13
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ...    39   0.13
gi|32564228|ref|NP_499057.3| CoLlagen, Basement membrane type, a...    39   0.17
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ...    39   0.17
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc...    39   0.17
gi|23612739|ref|NP_704278.1| hypothetical protein [Plasmodium fa...    39   0.22
gi|34881491|ref|XP_343817.1| similar to TAF7-like RNA polymerase...    38   0.29
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para...    38   0.29
gi|47216921|emb|CAG02093.1| unnamed protein product [Tetraodon n...    38   0.29
gi|34784364|gb|AAH57170.1| Hypothetical protein E430029F06 [Mus ...    38   0.29
gi|27370144|ref|NP_766365.1| hypothetical protein E430029F06 [Mu...    38   0.29
gi|419944|pir||B44982 collagen COLA4 - pig roundworm >gnl|BL_ORD...    38   0.29
gi|4826998|ref|NP_005057.1| splicing factor proline/glutamine ri...    38   0.38
gi|29881667|gb|AAH51192.1| Splicing factor proline/glutamine ric...    38   0.38
gi|23712|emb|CAA34747.1| myoblast antigen 24.1D5 [Homo sapiens]        38   0.38
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno...    38   0.38
gi|38014635|gb|AAH04534.2| SFPQ protein [Homo sapiens]                 38   0.38
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa]                    38   0.38
gi|10442545|gb|AAG17365.1| PTB-associated splicing factor [Mus m...    38   0.38
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ...    38   0.38
gi|17532741|ref|NP_495367.1| DumPY : shorter than wild-type DPY-...    37   0.49
gi|7332272|gb|AAA17398.2| collagen [Caenorhabditis elegans]            37   0.49
gi|543967|sp|P35799|CCD2_CAEEL Cuticle collagen dpy-2 precursor        37   0.49
gi|7494560|pir||T37285 collagen dpy-2 - Caenorhabditis elegans         37   0.49
gi|23612199|ref|NP_703779.1| hypothetical protein [Plasmodium fa...    37   0.49
gi|40786396|ref|NP_955370.1| FLJ35171 protein [Homo sapiens] >gn...    37   0.49
gi|23510135|ref|NP_702801.1| hypothetical protein [Plasmodium fa...    37   0.49
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ...    37   0.64
gi|7512173|pir||T30336 nuclear/mitotic apparatus protein - Afric...    37   0.64
gi|7446352|pir||S69282 polypyrimidine tract-binding protein-asso...    37   0.64
gi|34871066|ref|XP_342921.1| similar to PTB-associated splicing ...    37   0.64
gi|2674209|gb|AAD05362.1| NonO/p54nrb homolog [Rattus norvegicus]      37   0.64
gi|50759792|ref|XP_417784.1| PREDICTED: similar to PTB-associate...    37   0.64
gi|23956214|ref|NP_076092.1| splicing factor proline/glutamine r...    37   0.64
gi|15077111|gb|AAK83075.1| collagen [Meloidogyne javanica]             37   0.64
gi|1480444|gb|AAC59935.1| gizzard PTB-associated splicing factor       37   0.64
gi|29351587|gb|AAH49227.1| Similar to no on or off transient A [...    37   0.64
gi|46390038|dbj|BAD15414.1| putative ZipA [Oryza sativa (japonic...    37   0.84
gi|50311883|ref|XP_455973.1| unnamed protein product [Kluyveromy...    37   0.84
gi|320995|pir||A44982 collagen UCOL1 - pig roundworm (fragment) ...    37   0.84
gi|34852384|ref|XP_228081.2| similar to pericentrin [Rattus norv...    37   0.84
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]...    37   0.84
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g...    36   1.1
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd...    36   1.1
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno...    36   1.1
gi|16800754|ref|NP_471022.1| similar to ATP-dependent dsDNA exon...    36   1.1
gi|23468050|ref|ZP_00123621.1| COG5295: Autotransporter adhesin ...    36   1.1
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira...    36   1.1
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ...    36   1.1
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ...    36   1.1
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [...    36   1.1
gi|32453015|gb|AAP82656.1| Collagen protein 172, isoform b [Caen...    36   1.1
gi|14588885|emb|CAA70302.1| asparagine-rich protein [Plasmodium ...    36   1.4
gi|50294870|ref|XP_449846.1| unnamed protein product [Candida gl...    36   1.4
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp...    35   1.9
gi|23508380|ref|NP_701049.1| hypothetical protein [Plasmodium fa...    35   1.9
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa]                    35   1.9
gi|17536751|ref|NP_495952.1| predicted CDS, COLlagen structural ...    35   1.9
gi|7494171|pir||T28635 glutamate synthase (NADH2) (EC 1.4.1.14) ...    35   1.9
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [...    35   1.9
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa]                    35   2.4
gi|17551704|ref|NP_508747.1| COLlagen structural gene (33.9 kD) ...    35   2.4
gi|27370634|gb|AAH35913.1| Similar to pericentrin 2 (kendrin) [H...    35   2.4
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [...    35   2.4
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno...    35   2.4
gi|17507951|ref|NP_491958.1| COLlagen structural gene (col-59) [...    35   2.4
gi|7959947|gb|AAF71144.1| low-affinity IgE receptor; CD23 [Equus...    35   2.4
gi|39597872|emb|CAE68564.1| Hypothetical protein CBG14399 [Caeno...    35   2.4
gi|34857829|ref|XP_218907.2| similar to RIKEN cDNA 4930554C01 [R...    35   2.4
gi|4204829|gb|AAD10838.1| kendrin                                      35   2.4
gi|16804949|ref|NP_472978.1| hypothetical protein [Plasmodium fa...    35   2.4
gi|39595798|emb|CAE67301.1| Hypothetical protein CBG12754 [Caeno...    35   2.4
gi|34328010|dbj|BAA23698.3| KIAA0402 [Homo sapiens]                    35   2.4
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno...    35   2.4
gi|41053636|ref|NP_956573.1| hypothetical protein MGC56525 [Dani...    35   2.4
gi|23488575|gb|EAA21352.1| hypothetical protein [Plasmodium yoel...    35   2.4
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|...    35   2.4
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel...    35   2.4
gi|23510201|ref|NP_702867.1| erythrocyte membrane-associated ant...    35   2.4
gi|22035674|ref|NP_006022.2| pericentrin B; kendrin; pericentrin...    35   2.4
gi|50403702|sp|O95613|PCN2_HUMAN Pericentrin 2 (Pericentrin B) (...    35   2.4
gi|31296687|gb|AAP46636.1| pericentrin B [Homo sapiens]                35   2.4
gi|41351179|gb|AAH65624.1| Unknown (protein for MGC:77193) [Dani...    35   2.4
gi|23613827|ref|NP_704848.1| hypothetical protein [Plasmodium fa...    35   2.4
gi|1813688|gb|AAC47626.1| unknown [Brugia malayi] >gnl|BL_ORD_ID...    35   2.4
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno...    35   2.4
gi|50755811|ref|XP_425231.1| PREDICTED: similar to mitotic check...    35   3.2
gi|41203898|ref|XP_372522.1| similar to Plasmodium falciparum tr...    35   3.2
gi|47229302|emb|CAG04054.1| unnamed protein product [Tetraodon n...    35   3.2
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633...    35   3.2
gi|42660296|ref|XP_375084.1| similar to hypothetical protein [Ho...    35   3.2
gi|46444915|gb|EAL04187.1| hypothetical protein CaO19.12167 [Can...    35   3.2
gi|46444759|gb|EAL04032.1| hypothetical protein CaO19.4697 [Cand...    35   3.2
gi|23509556|ref|NP_702223.1| NAD(P)H-dependent glutamate synthas...    35   3.2
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD...    35   3.2
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel...    35   3.2
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa]                    35   3.2
gi|47219440|emb|CAG10804.1| unnamed protein product [Tetraodon n...    34   4.2
gi|23508404|ref|NP_701073.1| hypothetical protein [Plasmodium fa...    34   4.2
gi|23613137|ref|NP_703459.1| hypothetical protein [Plasmodium fa...    34   4.2
gi|34865435|ref|XP_236463.2| similar to tripartite motif-contain...    34   4.2
gi|46437420|gb|EAK96767.1| hypothetical protein CaO19.2850 [Cand...    34   4.2
gi|40850918|gb|AAH65238.1| ENAH protein [Homo sapiens]                 34   5.4
gi|21755689|dbj|BAC04736.1| unnamed protein product [Homo sapiens]     34   5.4
gi|22788782|ref|NP_690494.1| DNA-directed RNA polymerase [Heliot...    34   5.4
gi|42660665|ref|XP_208835.4| similar to hypothetical protein FLJ...    34   5.4
gi|23508883|ref|NP_701551.1| erythrocyte membrane protein 1 (PfE...    34   5.4
gi|12839062|dbj|BAB24421.1| unnamed protein product [Mus musculus]     34   5.4
gi|39930375|ref|NP_060682.2| enabled homolog [Homo sapiens] >gnl...    34   5.4
gi|39584073|emb|CAE66479.1| Hypothetical protein CBG11758 [Caeno...    34   5.4
gi|48428086|sp|Q8N8S7|ENAH_HUMAN Enabled protein homolog >gnl|BL...    34   5.4
gi|17556076|ref|NP_499628.1| putative protein, with 6 coiled coi...    33   7.1
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1                   33   7.1
gi|50546040|ref|XP_500551.1| hypothetical protein [Yarrowia lipo...    33   7.1
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di...    33   7.1
gi|24657160|ref|NP_611594.1| CG10321-PA [Drosophila melanogaster...    33   7.1
gi|32404182|ref|XP_322704.1| hypothetical protein ( hypothetical...    33   7.1
gi|32565629|ref|NP_871700.1| putative protein, with 6 coiled coi...    33   7.1
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc...    33   7.1
gi|9229886|dbj|BAB00616.1| ezrin/radixin/moesin (ERM)-like prote...    33   7.1
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa...    33   7.1
gi|24648281|ref|NP_650839.1| CG17186-PA [Drosophila melanogaster...    33   7.1
gi|39581493|emb|CAE68023.1| Hypothetical protein CBG13639 [Caeno...    33   7.1
gi|32410297|ref|XP_325629.1| predicted protein [Neurospora crass...    33   9.3
gi|50591421|ref|ZP_00332733.1| COG0608: Single-stranded DNA-spec...    33   9.3
gi|29245302|gb|EAA36949.1| GLP_333_12799_10208 [Giardia lamblia ...    33   9.3
gi|23508577|ref|NP_701246.1| hypothetical protein [Plasmodium fa...    33   9.3
gi|33300117|emb|CAE17682.1| Hypothetical protein C17H1.9 [Caenor...    33   9.3
gi|38044110|ref|NP_937824.1| similar to golgi autoantigen, golgi...    33   9.3
gi|16945892|gb|AAL32171.1| chromosome 17 open reading frame 27 [...    33   9.3
gi|31207101|ref|XP_312517.1| ENSANGP00000014236 [Anopheles gambi...    33   9.3
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)...    33   9.3
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno...    33   9.3


>gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120)
           [Caenorhabditis elegans]
 gi|7509391|pir||T26465 hypothetical protein Y11D7A.11 -
           Caenorhabditis elegans
 gi|3880729|emb|CAA21586.1| Hypothetical protein Y11D7A.11
           [Caenorhabditis elegans]
          Length = 313

 Score =  295 bits (755), Expect = 1e-78
 Identities = 174/313 (55%), Positives = 174/313 (55%)
 Frame = -1

Query: 942 MNLKKNLVNSEEDELRKXXXXXXXXXXXSGIMCIILIPGLYTYLQYIQSSVQTDVGFCVD 763
           MNLKKNLVNSEEDELRK           SGIMCIILIPGLYTYLQYIQSSVQTDVGFCVD
Sbjct: 1   MNLKKNLVNSEEDELRKVAFVATVVSAASGIMCIILIPGLYTYLQYIQSSVQTDVGFCVD 60

Query: 762 GAKNLENMYESTKAVGSGPVKRQAGYGASSPSRASGSHXXXXXXXXXXXXXXXXXXXXXX 583
           GAKNLENMYESTKAVGSGPVKRQAGYGASSPSRASGSH
Sbjct: 61  GAKNLENMYESTKAVGSGPVKRQAGYGASSPSRASGSHPAPSPYDAASTSSSSSSDSCCS 120

Query: 582 CGIXXXXXXXXXXXXXXXXXXXXXGKPGRDGQDLDGESSSDGSQIELDCXXXXXXXXXXX 403
           CGI                     GKPGRDGQDLDGESSSDGSQIELDC
Sbjct: 121 CGIGLAGPAGFPGRPGRDGIDGPAGKPGRDGQDLDGESSSDGSQIELDCPAGPPGPPGNP 180

Query: 402 XXXXXXXXXGMDGMPGRNGRCGRPGEQXXXXXXXXXXXXXXXXXXXXXGTVNEIXXXXXX 223
                    GMDGMPGRNGRCGRPGEQ                     GTVNEI
Sbjct: 181 GPQGNSGRPGMDGMPGRNGRCGRPGEQGERGPNGEDGRPGRRGDDGMPGTVNEIPGQAGP 240

Query: 222 XXXXXXXXXXGSQGPRGNDGRPGNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLGAKGE 43
                     GSQGPRGNDGRPGNK                            PLGAKGE
Sbjct: 241 PGLRGAPGATGSQGPRGNDGRPGNKGPAGPPGDQGFDGAPGGPGADGEPGAQGPLGAKGE 300

Query: 42  CSHCPPPRTAPGY 4
           CSHCPPPRTAPGY
Sbjct: 301 CSHCPPPRTAPGY 313




[DB home][top]