Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y17G7A_1
(948 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17536915|ref|NP_496544.1| high Mobility Group protein, AT hoo... 519 e-146
gi|1362172|pir||S57459 hook-containing protein AT1 - rice >gnl|B... 63 8e-09
gi|49328175|gb|AAT58871.1| AT1 protein [Oryza sativa (japonica c... 59 1e-07
gi|50556356|ref|XP_505586.1| hypothetical protein [Yarrowia lipo... 56 1e-06
gi|46128611|ref|XP_388859.1| hypothetical protein FG08683.1 [Gib... 53 9e-06
gi|1079018|pir||A55819 nonhistone chromosomal protein CHMG-I - m... 53 1e-05
gi|534887|emb|CAA85364.1| high mobility group protein I/Y [Chiro... 53 1e-05
gi|25553691|dbj|BAC24935.1| putative high mobility group I/Y (HM... 50 7e-05
gi|20502966|gb|AAM22691.1| HMG-I/Y protein HMGa [Triticum aestivum] 50 7e-05
gi|7439646|pir||T03931 DNA binding protein PF1 - rice >gnl|BL_OR... 50 7e-05
gi|46121709|ref|XP_385409.1| hypothetical protein FG05233.1 [Gib... 49 2e-04
gi|32412316|ref|XP_326638.1| predicted protein [Neurospora crass... 47 5e-04
gi|49087882|ref|XP_405827.1| hypothetical protein AN1690.2 [Aspe... 47 8e-04
gi|547938|sp|Q02496|MUC1_MOUSE Mucin 1 precursor (Polymorphic ep... 47 8e-04
gi|629769|pir||S43476 histone-like DNA-binding protein PF 1 - oa... 46 0.001
gi|46109050|ref|XP_381583.1| hypothetical protein FG01407.1 [Gib... 46 0.001
gi|46105358|ref|XP_380483.1| hypothetical protein FG00307.1 [Gib... 45 0.002
gi|38260668|gb|AAR15483.1| pollen coat oleosin-glycine rich prot... 45 0.003
gi|42571809|ref|NP_973995.1| AT hook motif-containing protein [A... 45 0.003
gi|8778701|gb|AAF79709.1| T1N15.24 [Arabidopsis thaliana] 45 0.003
gi|18402291|ref|NP_564531.1| AT hook motif-containing protein [A... 45 0.003
gi|7305293|ref|NP_038633.1| mucin 1, transmembrane [Mus musculus... 45 0.003
gi|7439879|pir||JC5933 high mobility group I HMGI chromosomal pr... 44 0.005
gi|34875309|ref|XP_214469.2| similar to PRP4 kinase [Rattus norv... 44 0.005
gi|50734082|ref|XP_418966.1| PREDICTED: similar to serine/threon... 44 0.007
gi|4504431|ref|NP_003474.1| high mobility group AT-hook 2; High-... 44 0.007
gi|13529407|gb|AAH05441.1| Mucin 1, transmembrane [Mus musculus] 44 0.007
gi|11544762|emb|CAB40848.2| HMGI/Y protein [Zea mays] 44 0.007
gi|33337998|gb|AAQ13621.1| MSTP108 [Homo sapiens] 43 0.009
gi|32415165|ref|XP_328062.1| hypothetical protein ( neurofilamen... 43 0.009
gi|24308067|ref|NP_056261.1| transcription factor ELYS [Homo sap... 43 0.009
gi|4585621|emb|CAB40849.1| HMGI/Y protein [Zea mays] 43 0.009
gi|3236351|gb|AAC32042.1| PRP4 protein kinase homolog [Mus muscu... 43 0.009
gi|26347383|dbj|BAC37340.1| unnamed protein product [Mus musculus] 43 0.009
gi|50308437|ref|XP_454220.1| unnamed protein product [Kluyveromy... 43 0.009
gi|7512672|pir||T12528 hypothetical protein DKFZp434N093.1 - hum... 43 0.009
gi|41281874|ref|NP_787061.1| transcription factor ELYS [Homo sap... 43 0.009
gi|26350865|dbj|BAC39069.1| unnamed protein product [Mus musculus] 43 0.009
gi|23956074|ref|NP_038858.1| PRP4 pre-mRNA processing factor 4 h... 43 0.009
gi|9837562|gb|AAG00601.1| high mobility group I/Y-2 [Zea mays] 43 0.009
gi|14091756|ref|NP_114459.1| non-histone chromosomal architectur... 43 0.012
gi|26554458|ref|NP_758392.1| ribosomal protein L29 [Mycoplasma p... 43 0.012
gi|7439876|pir||JC5931 high mobility group I HMGI chromosomal pr... 42 0.015
gi|7439877|pir||JC5932 high mobility group I HMGI chromosomal pr... 42 0.015
gi|32405506|ref|XP_323366.1| predicted protein [Neurospora crass... 42 0.015
gi|49069090|ref|XP_398834.1| hypothetical protein UM01219.1 [Ust... 42 0.020
gi|13094683|gb|AAK11966.1| ribosome receptor isoform mRRp15a [Mu... 42 0.020
gi|17534765|ref|NP_494825.1| high Mobility Group protein, I alph... 42 0.020
gi|8574029|emb|CAB94780.1| dJ1013A10.1 (PRP4 protein kinase homo... 41 0.034
gi|3043596|dbj|BAA25462.1| KIAA0536 protein [Homo sapiens] 41 0.034
gi|17999535|ref|NP_003904.2| serine/threonine-protein kinase PRP... 41 0.034
gi|23271009|gb|AAH34969.1| Serine/threonine-protein kinase PRP4K... 41 0.034
gi|45383422|ref|NP_989700.1| high mobility group AT-hook 1 [Gall... 41 0.045
gi|19112617|ref|NP_595825.1| origin recognition complex subunit ... 41 0.045
gi|30424862|ref|NP_780438.1| serine/arginine repetitive matrix 2... 40 0.059
gi|38109425|gb|EAA55303.1| hypothetical protein MG06960.4 [Magna... 40 0.059
gi|13094687|gb|AAK11968.1| ribosome receptor isoform mRRp16.8 [M... 40 0.077
gi|46125533|ref|XP_387320.1| hypothetical protein FG07144.1 [Gib... 40 0.077
gi|37655181|ref|NP_065746.2| transcription elongation factor B p... 40 0.077
gi|21595518|gb|AAH32244.1| Transcription elongation factor B pol... 40 0.077
gi|47213833|emb|CAG00637.1| unnamed protein product [Tetraodon n... 40 0.077
gi|4885513|ref|NP_005373.1| neurofilament 3 (150kDa medium); neu... 40 0.077
gi|6329915|dbj|BAA86452.1| KIAA1138 protein [Homo sapiens] 40 0.077
gi|45384530|ref|NP_990332.1| high mobility group protein I-C; li... 40 0.100
gi|47085947|ref|NP_998333.1| zgc:85677 [Danio rerio] >gnl|BL_ORD... 40 0.100
gi|7522167|pir||T31095 vitellogenin precursor - Oreochromis aure... 40 0.100
gi|34858829|ref|XP_230637.2| similar to Ribosome-binding protein... 39 0.13
gi|13094685|gb|AAK11967.1| ribosome receptor isoform mRRp15b [Mu... 39 0.13
gi|47218381|emb|CAG01902.1| unnamed protein product [Tetraodon n... 39 0.13
gi|150987|gb|AAA72068.1| alginate regulatory protein P 39 0.13
gi|46138495|ref|XP_390938.1| hypothetical protein FG10762.1 [Gib... 39 0.17
gi|7463002|pir||JC6146 CarD protein - Myxococcus xanthus >gnl|BL... 39 0.17
gi|34809533|gb|AAQ82687.1| Epa5p [Candida glabrata] 39 0.17
gi|5821143|dbj|BAA83713.1| RNA binding protein [Homo sapiens] 39 0.17
gi|5821145|dbj|BAA83714.1| RNA binding protein [Homo sapiens] 39 0.17
gi|6754210|ref|NP_034571.1| high mobility group AT-hook 2; high ... 39 0.17
gi|112945|sp|P14196|AAC2_DICDI AAC-rich mRNA clone AAC11 protein... 39 0.17
gi|38087494|ref|XP_357781.1| RIKEN cDNA 6330567E21 [Mus musculus] 39 0.17
gi|19923466|ref|NP_057417.2| splicing coactivator subunit SRm300... 39 0.17
gi|47124032|gb|AAH70050.1| SRRM2 protein [Homo sapiens] 39 0.17
gi|47122781|gb|AAH69985.1| Hmga2 protein [Mus musculus] 39 0.17
gi|42794020|emb|CAA86316.2| Hypothetical protein C38D4.3 [Caenor... 39 0.17
gi|38111069|gb|EAA56702.1| hypothetical protein MG07057.4 [Magna... 39 0.17
gi|6649242|gb|AAF21439.1| splicing coactivator subunit SRm300 [H... 39 0.17
gi|42564980|ref|NP_188431.3| histone H1/H5 family protein [Arabi... 39 0.17
gi|39594908|emb|CAE70776.1| Hypothetical protein CBG17530 [Caeno... 39 0.22
gi|50546453|ref|XP_500696.1| hypothetical protein [Yarrowia lipo... 39 0.22
gi|7439645|pir||T09585 high mobility group protein HMGI/Y-2 - sw... 39 0.22
gi|38109288|gb|EAA55181.1| hypothetical protein MG06838.4 [Magna... 39 0.22
gi|38569889|gb|AAR24462.1| neuron growth-associated protein 43 [... 39 0.22
gi|28972433|dbj|BAC65670.1| mKIAA0845 protein [Mus musculus] 39 0.22
gi|37534608|ref|NP_921606.1| putative regulatory protein [Oryza ... 39 0.22
gi|49086684|gb|AAT51371.1| PA5253 [synthetic construct] 38 0.29
gi|15600446|ref|NP_253940.1| alginate regulatory protein AlgP [P... 38 0.29
gi|32412982|ref|XP_326971.1| hypothetical protein [Neurospora cr... 38 0.38
gi|50593331|gb|AAT79412.1| multiple banded antigen [Ureaplasma u... 38 0.38
gi|21751020|dbj|BAC03887.1| unnamed protein product [Homo sapiens] 38 0.38
gi|7439663|pir||T09584 high mobility group protein HMGI/Y-1 - sw... 38 0.38
gi|38260630|gb|AAR15447.1| pollen coat oleosin-glycine rich prot... 38 0.38
gi|1708261|sp|Q00423|HMGA_SOYBN HMG-Y related protein A (SB16A p... 38 0.38
gi|1336029|gb|AAB01211.1| chromosomal protein D1 38 0.38
gi|28411872|dbj|BAC57402.1| DNA-binding protein family-like [Ory... 38 0.38
gi|24645272|ref|NP_524286.1| CG9745-PA [Drosophila melanogaster]... 38 0.38
gi|38111677|gb|EAA57217.1| hypothetical protein MG08186.4 [Magna... 38 0.38
gi|13195692|ref|NP_077243.1| ribosome binding protein 1 isoform ... 37 0.50
gi|21326451|ref|NP_647543.1| high mobility group AT-hook 1 [Ratt... 37 0.50
gi|306873|gb|AAA88076.1| high mobility group protein 37 0.50
gi|14133249|dbj|BAA92636.2| KIAA1398 protein [Homo sapiens] 37 0.50
gi|23822106|sp|Q99PL5|RRB1_MOUSE Ribosome-binding protein 1 (Rib... 37 0.50
gi|21739272|emb|CAD38684.1| hypothetical protein [Homo sapiens] 37 0.50
gi|23822112|sp|Q9P2E9|RRB1_HUMAN Ribosome-binding protein 1 (Rib... 37 0.50
gi|19482168|ref|NP_598329.1| ribosome binding protein 1 isoform ... 37 0.50
gi|482295|pir||A36128 regulatory protein algP - Pseudomonas aeru... 37 0.50
gi|13540397|gb|AAK29452.1| histone H1 [Lathyrus sativus] 37 0.65
gi|45553265|ref|NP_996160.1| CG17603-PB [Drosophila melanogaster... 37 0.65
gi|49080342|ref|XP_403702.1| hypothetical protein UM06087.1 [Ust... 37 0.65
gi|45553263|ref|NP_996159.1| CG17603-PC [Drosophila melanogaster... 37 0.65
gi|42733834|gb|AAS38752.1| similar to Staphylococcus epidermidis... 37 0.65
gi|478993|pir||S32373 DNA-binding protein TAF-II 250K - fruit fl... 37 0.65
gi|13540399|gb|AAK29453.1| histone H1 [Lathyrus sativus] 37 0.65
gi|40675335|gb|AAH64870.1| LOC395027 protein [Xenopus tropicalis] 37 0.65
gi|50593337|gb|AAT79415.1| multiple banded antigen [Ureaplasma u... 37 0.65
gi|45361164|ref|NP_989176.1| hypothetical protein MGC75972 [Xeno... 37 0.85
gi|21667872|gb|AAM74157.1| HMGA1b [Rattus norvegicus] 37 0.85
gi|42733594|ref|NP_976234.1| growth associated protein 43 [Bos t... 37 0.85
gi|46121269|ref|XP_385189.1| hypothetical protein FG05013.1 [Gib... 37 0.85
gi|48094793|ref|XP_392189.1| similar to ENSANGP00000019902 [Apis... 37 0.85
gi|128127|sp|P19246|NFH_MOUSE Neurofilament triplet H protein (2... 37 0.85
gi|48104706|ref|XP_392964.1| similar to ENSANGP00000012035 [Apis... 37 0.85
gi|7021495|gb|AAF35374.1| unknown [Drosophila melanogaster] 36 1.1
gi|2129885|pir||S57948 HMGI/Y protein - garden pea >gnl|BL_ORD_I... 36 1.1
gi|13592175|gb|AAK31375.1| ppg3 [Leishmania major] 36 1.1
gi|46275814|ref|NP_035034.1| neurofilament, heavy polypeptide [M... 36 1.1
gi|6003540|gb|AAF00492.1| neurofilament-3 (150 kD medium) [Homo ... 36 1.1
gi|18463959|gb|AAL73043.1| histone H1-like protein [Zea mays] 36 1.1
gi|49080292|ref|XP_403683.1| hypothetical protein UM06068.1 [Ust... 36 1.1
gi|463250|emb|CAA83229.1| Neurofilament protein, high molecular ... 36 1.1
gi|41407873|ref|NP_960709.1| hypothetical protein MAP1775 [Mycob... 36 1.1
gi|16151354|emb|CAC94788.1| 49J10.1.1 (KIAA0979, isoform 1) [Hom... 36 1.1
gi|47226697|emb|CAG07856.1| unnamed protein product [Tetraodon n... 36 1.1
gi|20521718|dbj|BAA76823.2| KIAA0979 protein [Homo sapiens] 36 1.4
gi|39586313|emb|CAE66724.1| Hypothetical protein CBG12070 [Caeno... 36 1.4
gi|13324788|gb|AAK18836.1| putative DNA-binding protein [Oryza s... 36 1.4
gi|34870088|ref|XP_221833.2| similar to androgen-induced prostat... 36 1.4
gi|39591342|emb|CAE73395.1| Hypothetical protein CBG20836 [Caeno... 36 1.4
gi|32411711|ref|XP_326336.1| hypothetical protein [Neurospora cr... 36 1.4
gi|23822071|sp|Q28298|RRB1_CANFA Ribosome-binding protein 1 (180... 36 1.4
gi|7657269|ref|NP_055847.1| androgen-induced prostate proliferat... 36 1.4
gi|3172248|gb|AAC18442.1| topoisomerase I [Cryptococcus neoforma... 36 1.4
gi|47210852|emb|CAF89718.1| unnamed protein product [Tetraodon n... 36 1.4
gi|26337115|dbj|BAC32242.1| unnamed protein product [Mus musculus] 36 1.4
gi|17506005|ref|NP_491343.1| cell Division Cycle related (57.7 k... 36 1.4
gi|151046|gb|AAA25724.1| alginate regulatory protein AlgR3 36 1.4
gi|50303341|ref|XP_451612.1| unnamed protein product [Kluyveromy... 35 1.9
gi|24654209|ref|NP_611143.1| CG5065-PA [Drosophila melanogaster]... 35 1.9
gi|24647448|ref|NP_650548.2| CG14896-PA [Drosophila melanogaster... 35 1.9
gi|15488621|gb|AAH13455.1| Hmga1 protein [Mus musculus] 35 1.9
gi|14531291|gb|AAK66159.1| high mobility group protein isoform I... 35 1.9
gi|15600253|ref|NP_253747.1| polyhydroxyalkanoate synthesis prot... 35 1.9
gi|6651027|gb|AAF22135.1| high mobility group protein I/Y [Brass... 35 1.9
gi|19528351|gb|AAL90290.1| LD30834p [Drosophila melanogaster] 35 1.9
gi|13540391|gb|AAK29449.1| histone H1 [Pisum sativum] 35 1.9
gi|46132797|ref|ZP_00171501.2| COG0793: Periplasmic protease [Ra... 35 1.9
gi|34880644|ref|XP_231274.2| similar to myeloid/lymphoid or mixe... 35 1.9
gi|42734036|gb|AAS38911.1| similar to Leishmania major. Ppg3 [Di... 35 1.9
gi|485464|pir||S29309 hypothetical protein 4 (phaC2 3' region) -... 35 1.9
gi|23484637|gb|EAA19900.1| hypothetical protein [Plasmodium yoel... 35 1.9
gi|39585752|emb|CAE59954.1| Hypothetical protein CBG03442 [Caeno... 35 2.5
gi|1808590|emb|CAA71797.1| HMG-I/Y [Arabidopsis thaliana] 35 2.5
gi|15223947|ref|NP_172943.1| high-mobility-group protein / HMG-I... 35 2.5
gi|13094681|gb|AAK11965.1| ribosome receptor isoform mRRp41 [Mus... 35 2.5
gi|2145149|gb|AAB60933.1| treacle [Mus musculus] 35 2.5
gi|4504433|ref|NP_002122.1| high mobility group AT-hook 1 isofor... 35 2.5
gi|6563390|gb|AAF06667.2| high mobility group-Y protein [Cricetu... 35 2.5
gi|38176351|gb|AAR13046.1| high mobiliy group protein A1B [Canis... 35 2.5
gi|30584665|gb|AAP36585.1| Homo sapiens high mobility group AT-h... 35 2.5
gi|840708|dbj|BAA09334.1| trans-sialidase [Trypanosoma cruzi] 35 2.5
gi|21739574|emb|CAD38822.1| hypothetical protein [Homo sapiens] 35 2.5
gi|32419631|ref|XP_330259.1| hypothetical protein ( neurofilamen... 35 2.5
gi|21536605|gb|AAM60937.1| linker histone protein, putative [Ara... 35 2.5
gi|7705417|ref|NP_057371.1| HP1-BP74; likely ortholog of mouse h... 35 2.5
gi|34785731|gb|AAH57342.1| Tcof1 protein [Mus musculus] 35 2.5
gi|46227103|gb|EAK88053.1| large low complexity protein with pro... 35 2.5
gi|6755742|ref|NP_035682.1| treacle [Mus musculus] >gnl|BL_ORD_I... 35 2.5
gi|31807869|gb|AAH52669.1| Tcof1 protein [Mus musculus] 35 2.5
gi|50753410|ref|XP_413974.1| PREDICTED: similar to Adenomatous p... 35 2.5
gi|11359569|pir||T49592 neurofilament triplet H1 related protein... 35 2.5
gi|37805376|gb|AAH60105.1| Tcof1 protein [Mus musculus] 35 2.5
gi|39934208|ref|NP_946484.1| unknown protein [Rhodopseudomonas p... 35 2.5
gi|46136571|ref|XP_389977.1| hypothetical protein FG09801.1 [Gib... 28 2.7
gi|15216184|emb|CAC51439.1| putative 67-11-3 protein [Mus musculus] 35 3.2
gi|21429082|gb|AAM50260.1| LD29979p [Drosophila melanogaster] 35 3.2
gi|17737433|ref|NP_523614.1| CG2207-PA [Drosophila melanogaster]... 35 3.2
gi|7511983|pir||T13610 parallel sister chromatids protein - frui... 35 3.2
gi|24639283|ref|NP_525042.2| CG3707-PA [Drosophila melanogaster]... 35 3.2
gi|15673889|ref|NP_268064.1| N-acetylmuramidase [Lactococcus lac... 35 3.2
gi|7710034|ref|NP_057869.1| high mobility group AT-hook 1; high ... 35 3.2
gi|14531290|gb|AAK66158.1| high mobility group protein isoform Y... 35 3.2
gi|46109212|ref|XP_381664.1| hypothetical protein FG01488.1 [Gib... 35 3.2
gi|2136142|pir||A58198 serine/proline-rich FEL protein, splice f... 35 3.2
gi|32351197|gb|AAP75616.1| inclusion body matrix protein [Dahlia... 35 3.2
gi|34856059|ref|XP_341853.1| similar to KIAA1205 protein [Rattus... 35 3.2
gi|15224877|ref|NP_181971.1| DNA-binding bromodomain-containing ... 35 3.2
gi|31215736|ref|XP_316086.1| ENSANGP00000012452 [Anopheles gambi... 35 3.2
gi|5420387|emb|CAB46679.1| proteophosphoglycan [Leishmania major] 35 3.2
gi|40018592|ref|NP_954539.1| Unknown (protein for MGC:72624) [Ra... 35 3.2
gi|1708262|sp|Q10370|HMGB_SOYBN HMG-Y related protein B (SB16B p... 35 3.2
gi|407324|gb|AAA36642.1| serine/proline-rich protein 35 3.2
gi|7511982|pir||T13349 parallel sister chromatids protein - frui... 35 3.2
gi|27382244|ref|NP_773773.1| blr7133 [Bradyrhizobium japonicum U... 35 3.2
gi|47225637|emb|CAG07980.1| unnamed protein product [Tetraodon n... 35 3.2
gi|5834649|emb|CAB55329.1| Mrp protein [Staphylococcus aureus] 35 3.2
gi|49084632|ref|XP_404497.1| hypothetical protein AN0360.2 [Aspe... 35 3.2
gi|18129616|ref|NP_082504.1| PIN2/TRF1-interacting protein [Mus ... 35 3.2
gi|26344698|dbj|BAC35998.1| unnamed protein product [Mus musculus] 35 3.2
gi|94816|pir||A35630 regulatory protein algR3 - Pseudomonas aeru... 35 3.2
gi|23112604|ref|ZP_00098067.1| COG0532: Translation initiation f... 35 3.2
gi|15805485|ref|NP_294181.1| hypothetical protein [Deinococcus r... 34 4.2
gi|20521816|dbj|BAA86568.2| KIAA1254 protein [Homo sapiens] 34 4.2
gi|423935|pir||A46194 neurofilament protein NF-220, high-molecul... 34 4.2
gi|47087073|ref|NP_998550.1| zgc:56266 [Danio rerio] >gnl|BL_ORD... 34 4.2
gi|47939723|gb|AAH72145.1| MGC80064 protein [Xenopus laevis] 34 4.2
gi|32414699|ref|XP_327829.1| hypothetical protein [Neurospora cr... 34 4.2
gi|22208967|ref|NP_665906.1| high mobility group AT-hook 1 isofo... 34 4.2
gi|50744782|ref|XP_419872.1| PREDICTED: similar to pleckstrin ho... 34 4.2
gi|9296984|sp|Q9QXP3|HMGI_CRIGR High mobility group protein HMG-... 34 4.2
gi|19401863|gb|AAL87694.1| non-transporter ABC protein AbcF4 [Di... 34 4.2
gi|28395035|ref|NP_004739.2| cell cycle progression 1; cell cycl... 34 4.2
gi|31621296|ref|NP_065790.1| cell cycle progression 1; cell cycl... 34 4.2
gi|10433862|dbj|BAB14042.1| unnamed protein product [Homo sapiens] 34 4.2
gi|50750704|ref|XP_422104.1| PREDICTED: similar to KIAA1237 prot... 34 4.2
gi|32413194|ref|XP_327077.1| predicted protein [Neurospora crass... 34 4.2
gi|13540395|gb|AAK29451.1| histone H1 [Pisum sativum] 34 4.2
gi|50257069|gb|EAL19784.1| hypothetical protein CNBG0770 [Crypto... 34 4.2
gi|38105842|gb|EAA52220.1| hypothetical protein MG04912.4 [Magna... 34 4.2
gi|39579617|emb|CAE56284.1| Hypothetical protein CBG23933 [Caeno... 34 4.2
gi|17551634|ref|NP_508124.1| kinase (40.9 kD) (XB213) [Caenorhab... 34 4.2
gi|34909036|ref|NP_915865.1| P0034E02.30 [Oryza sativa (japonica... 34 4.2
gi|7415524|dbj|BAA93438.1| FmtB [Staphylococcus aureus] 34 4.2
gi|50260219|gb|EAL22878.1| hypothetical protein CNBA6470 [Crypto... 34 4.2
gi|151002|gb|AAA25703.1| transcription regulatory protein 34 4.2
gi|50510845|dbj|BAD32408.1| mKIAA1205 protein [Mus musculus] 34 5.5
gi|50754145|ref|XP_429372.1| PREDICTED: hypothetical protein XP_... 34 5.5
gi|28574063|ref|NP_787998.1| CG13388-PD [Drosophila melanogaster... 34 5.5
gi|128097|sp|P06836|NEUM_BOVIN Neuromodulin (Axonal membrane pro... 34 5.5
gi|35193071|gb|AAH58674.1| BC058674 protein [Mus musculus] 34 5.5
gi|12855562|dbj|BAB30380.1| unnamed protein product [Mus musculu... 34 5.5
gi|17137716|ref|NP_477459.1| CG13388-PB [Drosophila melanogaster... 34 5.5
gi|5702206|gb|AAD47201.1| delta-A kinase anchor protein 200 [Dro... 34 5.5
gi|30421167|gb|AAP31051.1| D-Hordein [Hordeum vulgare] 34 5.5
gi|17137718|ref|NP_477460.1| CG13388-PA [Drosophila melanogaster... 34 5.5
gi|5702204|gb|AAD47200.1| A kinase anchor protein 200 [Drosophil... 34 5.5
gi|12655830|gb|AAK00616.1| cell division protein FtsZ [Anaplasma... 34 5.5
gi|47125144|gb|AAH70605.1| LOC431817 protein [Xenopus laevis] 34 5.5
gi|44917423|tpg|DAA02048.1| TPA: GRP21 [Arabidopsis thaliana] 34 5.5
gi|45199080|ref|NP_986109.1| AFR562Cp [Eremothecium gossypii] >g... 34 5.5
gi|50423793|ref|XP_460481.1| unnamed protein product [Debaryomyc... 34 5.5
gi|14149066|emb|CAC39142.1| bA462D18.3.2 (ribosome binding prote... 34 5.5
gi|34911868|ref|NP_917281.1| OSJNBb0032K15.11 [Oryza sativa (jap... 33 7.2
gi|21465095|gb|AAM54671.1| histone H1 [Pisum sativum subsp. abys... 33 7.2
gi|47228977|emb|CAG09492.1| unnamed protein product [Tetraodon n... 33 7.2
gi|4106696|dbj|BAA36284.1| ribosome-sedimenting protein [Pisum s... 33 7.2
gi|24663263|ref|NP_648573.2| CG32104-PB [Drosophila melanogaster... 33 7.2
gi|84059|pir||A24154 85K major surface antigen - Trypanosoma cru... 33 7.2
gi|48860741|ref|ZP_00314650.1| COG1530: Ribonucleases G and E [M... 33 7.2
gi|41149228|ref|XP_372331.1| similar to Sax-1 [Homo sapiens] 33 7.2
gi|32422133|ref|XP_331510.1| hypothetical protein [Neurospora cr... 33 7.2
gi|9629832|ref|NP_045316.1| processivity factor for DNA polymera... 33 7.2
gi|46125857|ref|XP_387482.1| hypothetical protein FG07306.1 [Gib... 33 7.2
gi|38344339|emb|CAD41755.2| OSJNBa0058K23.21 [Oryza sativa (japo... 33 7.2
gi|4996567|dbj|BAA78535.1| ribosome-sedimenting protein [Pisum s... 33 7.2
gi|47210708|emb|CAF90000.1| unnamed protein product [Tetraodon n... 33 7.2
gi|2765429|emb|CAA75050.1| vanillate demethylase A [Pseudomonas ... 33 7.2
gi|49088564|ref|XP_406092.1| hypothetical protein AN1955.2 [Aspe... 33 7.2
gi|17976985|dbj|BAB79591.1| vitellogenin II [Oryzias latipes] 33 7.2
gi|49075900|ref|XP_401981.1| hypothetical protein UM04366.1 [Ust... 33 7.2
gi|34014748|gb|AAQ56190.1| DNA polymerase beta-PAK [Trypanosoma ... 33 7.2
gi|42767027|gb|AAS45543.1| synapsin [Helix pomatia] 33 7.2
gi|34364783|emb|CAE45830.1| hypothetical protein [Homo sapiens] 33 9.4
gi|32413022|ref|XP_326991.1| hypothetical protein [Neurospora cr... 33 9.4
gi|21465093|gb|AAM54670.1| histone H1 [Lathyrus aphaca] 33 9.4
gi|32414669|ref|XP_327814.1| hypothetical protein [Neurospora cr... 33 9.4
gi|38146113|ref|NP_937992.1| similar to splicing factor, arginin... 33 9.4
gi|47086681|ref|NP_997845.1| Unknown (protein for MGC:77719); wu... 33 9.4
gi|34394712|dbj|BAC84075.1| hypothetical protein [Oryza sativa (... 33 9.4
gi|48861104|ref|ZP_00315009.1| COG0557: Exoribonuclease R [Micro... 33 9.4
gi|39595252|emb|CAE60289.1| Hypothetical protein CBG03873 [Caeno... 33 9.4
gi|32406408|ref|XP_323817.1| predicted protein [Neurospora crass... 33 9.4
gi|38146107|ref|NP_075388.2| similar to splicing factor, arginin... 33 9.4
gi|47497628|dbj|BAD19697.1| BRI1-KD interacting protein 135 [Ory... 33 9.4
gi|13386134|ref|NP_080921.1| RIKEN cDNA 1700012F17 [Mus musculus... 33 9.4
gi|49078768|ref|XP_403104.1| hypothetical protein UM05489.1 [Ust... 33 9.4
gi|47575808|ref|NP_001001248.1| hypothetical protein MGC76055 [X... 33 9.4
gi|50259955|gb|EAL22621.1| hypothetical protein CNBB2530 [Crypto... 33 9.4
gi|13540393|gb|AAK29450.1| histone H1 [Pisum sativum] 33 9.4
gi|42733530|dbj|BAD11362.1| BRI1-KD interacting protein 135 [Ory... 33 9.4
gi|25518689|pir||G86292 hypothetical protein F7H2.17 [imported] ... 33 9.4
gi|49072342|ref|XP_400460.1| hypothetical protein UM02845.1 [Ust... 33 9.4
gi|24645646|ref|NP_649988.1| CG3996-PA [Drosophila melanogaster]... 33 9.4
gi|28949944|emb|CAD70930.1| related to wound-responsive protein ... 33 9.4
gi|46447470|ref|YP_008835.1| putative histone H1-like protein [P... 33 9.4
>gi|17536915|ref|NP_496544.1| high Mobility Group protein, AT
hook-containing (33.0 kD) (hmg-12) [Caenorhabditis
elegans]
gi|11359754|pir||T43029 HMG protein I beta chain - Caenorhabditis
elegans
gi|3702832|gb|AAC78601.1| high mobility group protein I beta
[Caenorhabditis elegans]
gi|3880696|emb|CAA15962.1| Hypothetical protein Y17G7A.1
[Caenorhabditis elegans]
Length = 315
Score = 519 bits (1337), Expect = e-146
Identities = 269/315 (85%), Positives = 269/315 (85%)
Frame = +1
Query: 1 MSDVAEEKAEFLVIRTYGSESFRKECADLIEKELHKLNATIARVPVGEFVAYAENAVKNE 180
MSDVAEEKAEFLVIRTYGSESFRKECADLIEKELHKLNATIARVPVGEFVAYAENAVKNE
Sbjct: 1 MSDVAEEKAEFLVIRTYGSESFRKECADLIEKELHKLNATIARVPVGEFVAYAENAVKNE 60
Query: 181 TDSEAVGSSSVKRENSANDSPANTNDVDIVSSPVKRGRGRKAKNPSADADVNDTGSSPVK 360
TDSEAVGSSSVKRENSANDSPANTNDVDIVSSPVKRGRGRKAKNPSADADVNDTGSSPVK
Sbjct: 61 TDSEAVGSSSVKRENSANDSPANTNDVDIVSSPVKRGRGRKAKNPSADADVNDTGSSPVK 120
Query: 361 KGRGRPIKNPSADAGSPLVKKGRGRRXXXXXXXXXXXXXXSSPVKKGRGRPAKNPSADAG 540
KGRGRPIKNPSADAGSPLVKKGRGRR SSPVKKGRGRPAKNPSADAG
Sbjct: 121 KGRGRPIKNPSADAGSPLVKKGRGRRAQTPAADTDAIDTASSPVKKGRGRPAKNPSADAG 180
Query: 541 SPLVKKGRGRQAKNLXXXXXXXXXXSSPVKKGRGRPLKKTAAEADVNGLGSPSANRITGC 720
SPLVKKGRGRQAKNL SSPVKKGRGRPLKKTAAEADVNGLGSPSANRITGC
Sbjct: 181 SPLVKKGRGRQAKNLAADTDAIDTASSPVKKGRGRPLKKTAAEADVNGLGSPSANRITGC 240
Query: 721 PPSTKVSNQSSPPEPAVNESEEADEPVLKRGRSVKQXXXXXXXXXXXXXXXXXXXXXXRG 900
PPSTKVSNQSSPPEPAVNESEEADEPVLKRGRSVKQ RG
Sbjct: 241 PPSTKVSNQSSPPEPAVNESEEADEPVLKRGRSVKQPKDESESDDEDAEKAPAAIPKKRG 300
Query: 901 RPGKSAIDAFFDGSD 945
RPGKSAIDAFFDGSD
Sbjct: 301 RPGKSAIDAFFDGSD 315