Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y18D10A_11
(945 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17509729|ref|NP_493247.1| transducin WD-40 repeat protein fam... 659 0.0
gi|32698449|emb|CAA22322.2| Hypothetical protein Y18D10A.9 [Caen... 645 0.0
gi|39592427|emb|CAE63504.1| Hypothetical protein CBG07981 [Caeno... 589 e-167
gi|47213175|emb|CAF92184.1| unnamed protein product [Tetraodon n... 230 3e-59
gi|19922278|ref|NP_610996.1| CG12797-PA [Drosophila melanogaster... 226 6e-58
gi|28279952|gb|AAH44534.1| Zgc:55911 protein [Danio rerio] 225 1e-57
gi|50233904|ref|NP_956441.2| similar to WD40 protein Ciao1 [Dani... 223 4e-57
gi|31542399|ref|NP_079572.2| WD40 protein Ciao1 [Mus musculus] >... 218 2e-55
gi|12832206|dbj|BAB22008.1| unnamed protein product [Mus musculus] 215 1e-54
gi|4757988|ref|NP_004795.1| WD40 protein Ciao1 [Homo sapiens] >g... 214 3e-54
gi|31203399|ref|XP_310648.1| ENSANGP00000020796 [Anopheles gambi... 210 4e-53
gi|34394959|dbj|BAC84508.1| putative WD40 protein Ciao1 [Oryza s... 208 2e-52
gi|48102256|ref|XP_395314.1| similar to CG12797-PA [Apis mellifera] 193 5e-48
gi|18401018|ref|NP_565615.1| transducin family protein / WD-40 r... 186 5e-46
gi|27732211|ref|XP_215837.1| WD40 protein Ciao1 [Rattus norvegicus] 177 2e-43
gi|7446121|pir||T02617 hypothetical protein At2g26060 [imported]... 177 4e-43
gi|50549007|ref|XP_501974.1| hypothetical protein [Yarrowia lipo... 169 8e-41
gi|33390985|gb|AAQ17185.1| WD40 protein Ciao1-like protein [Cras... 165 2e-39
gi|19113764|ref|NP_592852.1| WD domian, G-beta repeat protein [S... 160 5e-38
gi|49076638|ref|XP_402273.1| hypothetical protein UM04658.1 [Ust... 150 4e-35
gi|50255865|gb|EAL18596.1| hypothetical protein CNBJ0220 [Crypto... 148 2e-34
gi|46442476|gb|EAL01765.1| hypothetical protein CaO19.4293 [Cand... 145 1e-33
gi|50294620|ref|XP_449721.1| unnamed protein product [Candida gl... 143 5e-33
gi|50309847|ref|XP_454937.1| unnamed protein product [Kluyveromy... 142 1e-32
gi|45185777|ref|NP_983493.1| ACR091Wp [Eremothecium gossypii] >g... 140 5e-32
gi|6320473|ref|NP_010553.1| Protein required for cell viability;... 138 2e-31
gi|49087072|ref|XP_405522.1| hypothetical protein AN1385.2 [Aspe... 135 1e-30
gi|22329107|ref|NP_195025.2| transducin family protein / WD-40 r... 132 1e-29
gi|50426611|ref|XP_461902.1| unnamed protein product [Debaryomyc... 122 9e-27
gi|46116924|ref|XP_384480.1| hypothetical protein FG04304.1 [Gib... 122 2e-26
gi|7486207|pir||T05307 hypothetical protein F26P21.110 - Arabido... 112 1e-23
gi|49124494|ref|XP_412605.1| hypothetical protein AN8468.2 [Aspe... 106 9e-22
gi|32409601|ref|XP_325281.1| hypothetical protein ( hypothetical... 103 4e-21
gi|38105086|gb|EAA51555.1| hypothetical protein MG03150.4 [Magna... 103 7e-21
gi|23129632|ref|ZP_00111458.1| COG2319: FOG: WD40 repeat [Nostoc... 100 4e-20
gi|45508715|ref|ZP_00161052.1| COG2319: FOG: WD40 repeat [Anabae... 100 5e-20
gi|45507426|ref|ZP_00159770.1| COG2319: FOG: WD40 repeat [Anabae... 100 5e-20
gi|46134381|ref|ZP_00157805.2| COG2319: FOG: WD40 repeat [Anabae... 100 6e-20
gi|45509691|ref|ZP_00162024.1| COG2319: FOG: WD40 repeat [Anabae... 100 8e-20
gi|17227525|ref|NP_484073.1| WD-40 repeat protein [Nostoc sp. PC... 99 1e-19
gi|23130558|ref|ZP_00112371.1| COG2319: FOG: WD40 repeat [Nostoc... 99 1e-19
gi|17230661|ref|NP_487209.1| WD repeat protein with Ser/Thr prot... 99 2e-19
gi|37522390|ref|NP_925767.1| WD-repeat protein [Gloeobacter viol... 96 1e-18
gi|17230292|ref|NP_486840.1| WD-repeat protein [Nostoc sp. PCC 7... 96 1e-18
gi|17227780|ref|NP_484328.1| WD-40 repeat protein [Nostoc sp. PC... 96 2e-18
gi|23128236|ref|ZP_00110089.1| COG2319: FOG: WD40 repeat [Nostoc... 95 2e-18
gi|17230958|ref|NP_487506.1| WD-40 repeat protein [Nostoc sp. PC... 94 3e-18
gi|23130132|ref|ZP_00111951.1| COG2319: FOG: WD40 repeat [Nostoc... 94 4e-18
gi|45506973|ref|ZP_00159321.1| COG2319: FOG: WD40 repeat [Anabae... 93 8e-18
gi|17230611|ref|NP_487159.1| WD repeat protein with Ser/Thr prot... 93 8e-18
gi|37521534|ref|NP_924911.1| WD-repeat protein [Gloeobacter viol... 93 8e-18
gi|45509331|ref|ZP_00161665.1| COG2319: FOG: WD40 repeat [Anabae... 92 1e-17
gi|46134602|ref|ZP_00158196.2| COG2319: FOG: WD40 repeat [Anabae... 92 2e-17
gi|23128312|ref|ZP_00110163.1| COG2319: FOG: WD40 repeat [Nostoc... 91 3e-17
gi|23124439|ref|ZP_00106428.1| COG2319: FOG: WD40 repeat [Nostoc... 91 3e-17
gi|48893580|ref|ZP_00326778.1| COG2319: FOG: WD40 repeat [Tricho... 91 5e-17
gi|17233145|ref|NP_490235.1| WD-repeat protein [Nostoc sp. PCC 7... 90 6e-17
gi|48891596|ref|ZP_00325089.1| COG0515: Serine/threonine protein... 90 6e-17
gi|23129032|ref|ZP_00110866.1| COG2319: FOG: WD40 repeat [Nostoc... 90 8e-17
gi|23128981|ref|ZP_00110817.1| COG2319: FOG: WD40 repeat [Nostoc... 90 8e-17
gi|50794621|ref|XP_428026.1| PREDICTED: similar to WD-repeat con... 90 8e-17
gi|1346729|sp|P49695|PKWA_THECU Probable serine/threonine-protei... 90 8e-17
gi|48835147|ref|ZP_00292148.1| COG2319: FOG: WD40 repeat [Thermo... 90 8e-17
gi|48891324|ref|ZP_00324864.1| COG2319: FOG: WD40 repeat [Tricho... 89 1e-16
gi|46135387|ref|ZP_00162792.2| COG2319: FOG: WD40 repeat [Anabae... 89 1e-16
gi|37523230|ref|NP_926607.1| WD-40 repeat protein [Gloeobacter v... 89 1e-16
gi|17230283|ref|NP_486831.1| WD-repeat protein [Nostoc sp. PCC 7... 89 1e-16
gi|46130696|ref|XP_389128.1| hypothetical protein FG08952.1 [Gib... 88 2e-16
gi|29245648|gb|EAA37275.1| GLP_238_1235_2371 [Giardia lamblia AT... 88 2e-16
gi|49102841|ref|XP_411097.1| hypothetical protein AN6960.2 [Aspe... 88 3e-16
gi|46135416|ref|ZP_00203492.1| COG2319: FOG: WD40 repeat [Anabae... 88 3e-16
gi|37522457|ref|NP_925834.1| WD-repeat protein [Gloeobacter viol... 87 5e-16
gi|46135357|ref|ZP_00162759.2| COG2319: FOG: WD40 repeat [Anabae... 87 5e-16
gi|23508791|ref|NP_701459.1| hypothetical protein [Plasmodium fa... 87 5e-16
gi|17232326|ref|NP_488874.1| WD-repeat protein [Nostoc sp. PCC 7... 87 7e-16
gi|45525517|ref|ZP_00176748.1| COG2319: FOG: WD40 repeat [Crocos... 87 7e-16
gi|23126094|ref|ZP_00108001.1| COG2319: FOG: WD40 repeat [Nostoc... 87 7e-16
gi|17225210|gb|AAL37301.1| beta transducin-like protein HET-D2Y ... 86 9e-16
gi|46119952|ref|ZP_00179225.2| COG2319: FOG: WD40 repeat [Crocos... 86 9e-16
gi|37520744|ref|NP_924121.1| WD-repeat protein [Gloeobacter viol... 86 1e-15
gi|23124810|ref|ZP_00106776.1| COG2319: FOG: WD40 repeat [Nostoc... 86 1e-15
gi|17227934|ref|NP_484482.1| serine/threonine kinase with WD-40 ... 86 1e-15
gi|45508168|ref|ZP_00160508.1| COG2319: FOG: WD40 repeat [Anabae... 86 2e-15
gi|46130702|ref|XP_389131.1| hypothetical protein FG08955.1 [Gib... 86 2e-15
gi|49091992|ref|XP_407457.1| hypothetical protein AN3320.2 [Aspe... 86 2e-15
gi|23126805|ref|ZP_00108691.1| COG2319: FOG: WD40 repeat [Nostoc... 85 2e-15
gi|37520294|ref|NP_923671.1| WD-40 repeat protein [Gloeobacter v... 85 2e-15
gi|17228160|ref|NP_484708.1| WD-40 repeat protein [Nostoc sp. PC... 85 3e-15
gi|45509405|ref|ZP_00161739.1| COG2319: FOG: WD40 repeat [Anabae... 84 4e-15
gi|23484886|gb|EAA20068.1| WD40 protein Ciao1-related [Plasmodiu... 84 5e-15
gi|37521813|ref|NP_925190.1| WD-repeat protein [Gloeobacter viol... 84 5e-15
gi|23489862|gb|EAA21771.1| hypothetical protein [Plasmodium yoel... 84 5e-15
gi|47229875|emb|CAG07071.1| unnamed protein product [Tetraodon n... 84 6e-15
gi|23125398|ref|ZP_00107333.1| COG2319: FOG: WD40 repeat [Nostoc... 84 6e-15
gi|45506782|ref|ZP_00159132.1| COG2319: FOG: WD40 repeat [Anabae... 84 6e-15
gi|21674797|ref|NP_662862.1| WD-repeat family protein [Chlorobiu... 84 6e-15
gi|41724850|ref|ZP_00151660.1| COG2319: FOG: WD40 repeat [Dechlo... 83 8e-15
gi|49073067|ref|XP_400779.1| hypothetical protein UM03164.1 [Ust... 83 1e-14
gi|37523920|ref|NP_927297.1| WD-repeat protein [Gloeobacter viol... 83 1e-14
gi|46134601|ref|ZP_00158195.2| COG2319: FOG: WD40 repeat [Anabae... 83 1e-14
gi|48892224|ref|ZP_00325622.1| COG2319: FOG: WD40 repeat [Tricho... 82 1e-14
gi|23129645|ref|ZP_00111471.1| COG2319: FOG: WD40 repeat [Nostoc... 82 1e-14
gi|17227974|ref|NP_484522.1| WD-40 repeat protein [Nostoc sp. PC... 82 1e-14
gi|23129722|ref|ZP_00111547.1| COG2319: FOG: WD40 repeat [Nostoc... 82 1e-14
gi|37523925|ref|NP_927302.1| WD-repeat protein [Gloeobacter viol... 82 2e-14
gi|17225206|gb|AAL37299.1| beta transducin-like protein HET-E2C*... 82 2e-14
gi|17227743|ref|NP_484291.1| WD-40 repeat protein [Nostoc sp. PC... 82 2e-14
gi|17227779|ref|NP_484327.1| WD-40 repeat protein [Nostoc sp. PC... 81 3e-14
gi|3023956|sp|Q00808|HET1_PODAN Vegetatible incompatibility prot... 81 3e-14
gi|21222277|ref|NP_628056.1| putative WD-40 repeat protein [Stre... 81 4e-14
gi|17225204|gb|AAL37298.1| beta transducin-like protein HET-E2C ... 81 4e-14
gi|17225208|gb|AAL37300.1| beta transducin-like protein HET-E2C*... 81 4e-14
gi|48894805|ref|ZP_00327914.1| COG2319: FOG: WD40 repeat [Tricho... 81 4e-14
gi|5051805|emb|CAB45034.1| putative WD-repeat containing protein... 80 5e-14
gi|17488592|gb|AAL40359.1| unknown protein [Takifugu rubripes] 80 5e-14
gi|7479150|pir||T42045 beta transducin-like protein homolog - St... 80 5e-14
gi|23126059|ref|ZP_00107968.1| COG2319: FOG: WD40 repeat [Nostoc... 80 7e-14
gi|23124360|ref|ZP_00106355.1| COG2319: FOG: WD40 repeat [Nostoc... 80 7e-14
gi|41056233|ref|NP_956412.1| Unknown (protein for MGC:63538); wu... 80 7e-14
gi|48893630|ref|ZP_00326828.1| COG2319: FOG: WD40 repeat [Tricho... 79 1e-13
gi|37682095|gb|AAQ97974.1| TUWD12 [Danio rerio] 79 1e-13
gi|38505813|ref|NP_942432.1| WD-repeat protein [Synechocystis sp... 78 3e-13
gi|45508310|ref|ZP_00160649.1| COG2319: FOG: WD40 repeat [Anabae... 78 3e-13
gi|31240155|ref|XP_320491.1| ENSANGP00000008643 [Anopheles gambi... 78 3e-13
gi|19113796|ref|NP_592884.1| hypothetical trp-asp repeats contai... 78 3e-13
gi|2130260|pir||S62544 hypothetical protein SPAC12G12.13c - fiss... 78 3e-13
gi|23124949|ref|ZP_00106905.1| COG2319: FOG: WD40 repeat [Nostoc... 78 3e-13
gi|28829916|gb|AAO52407.1| similar to Xenopus laevis (African cl... 77 4e-13
gi|45508332|ref|ZP_00160671.1| COG2319: FOG: WD40 repeat [Anabae... 77 6e-13
gi|50259040|gb|EAL21719.1| hypothetical protein CNBC5830 [Crypto... 77 6e-13
gi|17137196|ref|NP_477160.1| CG8440-PA [Drosophila melanogaster]... 77 6e-13
gi|3983137|gb|AAC83821.1| Lis1 homolog [Drosophila melanogaster] 77 6e-13
gi|31377770|ref|NP_056241.2| DKFZP434C245 protein [Homo sapiens]... 77 6e-13
gi|17229616|ref|NP_486164.1| WD-40 repeat protein [Nostoc sp. PC... 77 7e-13
gi|37521199|ref|NP_924576.1| WD-40 repeat protein [Gloeobacter v... 77 7e-13
gi|37520475|ref|NP_923852.1| WD-repeat protein [Gloeobacter viol... 77 7e-13
gi|23130298|ref|ZP_00112115.1| COG2319: FOG: WD40 repeat [Nostoc... 77 7e-13
gi|48838134|ref|ZP_00295082.1| COG2319: FOG: WD40 repeat [Methan... 77 7e-13
gi|49101231|ref|XP_410940.1| hypothetical protein AN6803.2 [Aspe... 76 1e-12
gi|13938537|gb|AAH07417.1| DKFZP434C245 protein [Homo sapiens] 76 1e-12
gi|50728412|ref|XP_416132.1| PREDICTED: similar to TUWD12 [Gallu... 76 1e-12
gi|12846941|dbj|BAB27371.1| unnamed protein product [Mus musculus] 76 1e-12
gi|22028422|gb|AAH34901.1| 2510040D07Rik protein [Mus musculus] 76 1e-12
gi|23593529|ref|XP_135092.2| RIKEN cDNA 2510040D07 [Mus musculus] 76 1e-12
gi|49125072|ref|XP_412642.1| hypothetical protein AN8505.2 [Aspe... 76 1e-12
gi|50798183|ref|XP_423992.1| PREDICTED: similar to WD-repeat con... 76 1e-12
gi|33417154|gb|AAH56099.1| MGC69111 protein [Xenopus laevis] 75 2e-12
gi|20091353|ref|NP_617428.1| WD40-repeat containing protein [Met... 75 2e-12
gi|45508311|ref|ZP_00160650.1| COG2319: FOG: WD40 repeat [Anabae... 75 2e-12
gi|50289957|ref|XP_447410.1| unnamed protein product [Candida gl... 75 2e-12
gi|31240513|ref|XP_320670.1| ENSANGP00000021164 [Anopheles gambi... 75 2e-12
gi|4758560|ref|NP_004805.1| U5 snRNP-specific 40 kDa protein (hP... 75 2e-12
gi|45509197|ref|ZP_00161532.1| COG2319: FOG: WD40 repeat [Anabae... 75 2e-12
gi|32822805|gb|AAH54992.1| MGC64565 protein [Xenopus laevis] 75 3e-12
gi|47606212|sp|Q9H7D7|WD26_HUMAN WD-repeat protein 26 >gnl|BL_OR... 74 4e-12
gi|46120249|ref|ZP_00179648.2| COG2319: FOG: WD40 repeat [Crocos... 74 4e-12
gi|40538774|ref|NP_079436.2| WD repeat domain 26 [Homo sapiens] ... 74 4e-12
gi|50754099|ref|XP_414244.1| PREDICTED: similar to DKFZP434C245 ... 74 4e-12
gi|34783428|gb|AAH31471.2| WDR26 protein [Homo sapiens] 74 4e-12
gi|10437006|dbj|BAB14955.1| unnamed protein product [Homo sapiens] 74 4e-12
gi|30353950|gb|AAH52301.1| Unknown (protein for IMAGE:6420398) [... 74 4e-12
gi|27924436|gb|AAH45034.1| Prp8bp-pending-prov protein [Xenopus ... 74 4e-12
gi|5869874|emb|CAB55581.1| apoptotic protease activating factor ... 74 4e-12
gi|5869876|emb|CAB55582.1| apoptotic protease activating factor ... 74 5e-12
gi|32483361|ref|NP_863658.1| apoptotic protease activating facto... 74 5e-12
gi|5869872|emb|CAB55580.1| apoptotic protease activating factor ... 74 5e-12
gi|5869870|emb|CAB55579.1| apoptotic protease activating factor ... 74 5e-12
gi|33859775|ref|NP_663489.2| WD repeat domain 26 [Mus musculus] ... 74 5e-12
gi|34871679|ref|XP_232775.2| similar to U5 snRNP-specific protei... 74 5e-12
gi|4502123|ref|NP_001151.1| apoptotic protease activating factor... 74 5e-12
gi|47606167|sp|Q8C6G8|WD26_MOUSE WD-repeat protein 26 >gnl|BL_OR... 74 5e-12
gi|35193112|gb|AAH58601.1| Unknown (protein for IMAGE:6466707) [... 74 5e-12
gi|28174989|gb|AAH20044.2| Wdr26 protein [Mus musculus] 74 5e-12
gi|12856025|dbj|BAB30542.1| unnamed protein product [Mus musculu... 74 6e-12
gi|17510485|ref|NP_491069.1| coatomer (137.7 kD) (1D464) [Caenor... 74 6e-12
gi|47059149|ref|NP_082016.1| similar to TUWD12 [Mus musculus] >g... 74 6e-12
gi|23130123|ref|ZP_00111942.1| COG2319: FOG: WD40 repeat [Nostoc... 74 6e-12
gi|16331266|ref|NP_441994.1| beta transducin-like protein [Synec... 74 6e-12
gi|45187950|ref|NP_984173.1| ADR077Cp [Eremothecium gossypii] >g... 73 8e-12
gi|49098124|ref|XP_410522.1| hypothetical protein AN6385.2 [Aspe... 73 8e-12
gi|48096118|ref|XP_392399.1| similar to CG8440-PA [Apis mellifera] 73 8e-12
gi|5869878|emb|CAB55583.1| apoptotic protease activating factor ... 73 8e-12
gi|23126612|ref|ZP_00108502.1| COG2319: FOG: WD40 repeat [Nostoc... 73 1e-11
gi|50759611|ref|XP_417704.1| PREDICTED: similar to Prp8bp-pendin... 73 1e-11
gi|5869886|emb|CAB55587.1| protease activating factor-1 [Homo sa... 72 1e-11
gi|5869884|emb|CAB55586.1| apoptotic protease activating factor ... 72 1e-11
gi|37231578|gb|AAH58365.1| Prp8bp-pending protein [Mus musculus] 72 1e-11
gi|50421227|ref|XP_459159.1| unnamed protein product [Debaryomyc... 72 1e-11
gi|16306637|gb|AAH01494.1| U5 snRNP-specific 40 kDa protein (hPr... 72 1e-11
gi|45190361|ref|NP_984615.1| AEL246Cp [Eremothecium gossypii] >g... 72 1e-11
gi|41053421|ref|NP_956616.1| similar to U5 snRNP-specific 40 kDa... 72 1e-11
gi|45505417|ref|ZP_00157801.1| COG2319: FOG: WD40 repeat [Anabae... 72 1e-11
gi|47208915|emb|CAF93119.1| unnamed protein product [Tetraodon n... 72 2e-11
gi|19923529|ref|NP_060853.2| WD repeat domain 33 [Homo sapiens] ... 72 2e-11
gi|49523068|gb|AAH75548.1| Unknown (protein for MGC:89488) [Xeno... 72 2e-11
gi|19571763|emb|CAD27805.1| wdc146 [Tetraodon nigroviridis] 72 2e-11
gi|26341404|dbj|BAC34364.1| unnamed protein product [Mus musculus] 72 2e-11
gi|34878620|ref|XP_226076.2| similar to putative WDC146 [Rattus ... 72 2e-11
gi|21362285|ref|NP_083142.2| WD repeat domain 33 [Mus musculus] ... 72 2e-11
gi|45506958|ref|ZP_00159306.1| COG2319: FOG: WD40 repeat [Anabae... 72 2e-11
gi|45506821|ref|ZP_00159171.1| COG2319: FOG: WD40 repeat [Anabae... 72 2e-11
gi|15229187|ref|NP_190535.1| transducin family protein / WD-40 r... 71 3e-11
gi|49619007|gb|AAT68088.1| FLJ11294-like [Danio rerio] 71 3e-11
gi|45773816|gb|AAS76712.1| At5g13480 [Arabidopsis thaliana] 71 3e-11
gi|5921467|emb|CAB56462.1| apoptotic protease activating factor-... 71 3e-11
gi|37522224|ref|NP_925601.1| WD-repeat protein [Gloeobacter viol... 71 3e-11
gi|19112071|ref|NP_595279.1| putative coatomer alpha subunit [Sc... 71 4e-11
gi|5869882|emb|CAB55585.1| apoptotic protease activating factor ... 71 4e-11
gi|32483359|ref|NP_863651.1| apoptotic protease activating facto... 71 4e-11
gi|19173269|ref|NP_597072.1| hypothetical protein [Encephalitozo... 71 4e-11
gi|48895476|ref|ZP_00328460.1| COG2319: FOG: WD40 repeat [Tricho... 71 4e-11
gi|48102033|ref|XP_395272.1| similar to ENSANGP00000017775 [Apis... 71 4e-11
gi|20521041|dbj|BAA24843.2| KIAA0413 [Homo sapiens] 71 4e-11
gi|13445656|gb|AAK26326.1| alpha-COP-like protein [Pichia angusta] 71 4e-11
gi|7108333|ref|NP_037361.1| apoptotic protease activating factor... 71 4e-11
gi|50545019|ref|XP_500061.1| YlTUP1 [Yarrowia lipolytica] >gnl|B... 71 4e-11
gi|32264056|gb|AAO45688.1| activated protein kinase C receptor [... 70 5e-11
gi|46443681|gb|EAL02961.1| hypothetical protein CaO19.1672 [Cand... 70 5e-11
gi|46443553|gb|EAL02834.1| hypothetical protein CaO19.9241 [Cand... 70 5e-11
gi|47679343|gb|AAT36652.1| Tup1p [Exophiala dermatitidis] 70 5e-11
gi|47085759|ref|NP_998214.1| zgc:56055 [Danio rerio] >gnl|BL_ORD... 70 5e-11
gi|1903291|emb|CAA98718.1| COP1 [Saccharomyces cerevisiae] 70 7e-11
gi|6320056|ref|NP_010136.1| Alpha subunit of COPI vesicle coatom... 70 7e-11
gi|633648|emb|CAA58712.1| alpha-COP [Saccharomyces cerevisiae] >... 70 7e-11
gi|48893749|ref|ZP_00326947.1| COG2319: FOG: WD40 repeat [Tricho... 70 7e-11
gi|39589246|emb|CAE57979.1| Hypothetical protein CBG01041 [Caeno... 70 9e-11
gi|21312470|ref|NP_082359.1| chromatin assembly factor 1 subunit... 69 1e-10
gi|45544464|emb|CAF34034.1| putative WD-repeat-containing protei... 69 1e-10
gi|41019302|gb|AAR98560.1| GntN [Micromonospora echinospora] 69 1e-10
gi|26332517|dbj|BAC29976.1| unnamed protein product [Mus musculus] 69 1e-10
gi|20137267|sp|O88879|APAF_MOUSE Apoptotic protease activating f... 69 2e-10
gi|39595549|emb|CAE60587.1| Hypothetical protein CBG04223 [Caeno... 69 2e-10
gi|3746838|gb|AAC64084.1| 38kDa splicing factor; SPF 38 [Homo sa... 69 2e-10
gi|15220302|ref|NP_172582.1| WD-40 repeat family protein / katan... 69 2e-10
gi|6857755|ref|NP_033814.1| apoptotic protease activating factor... 69 2e-10
gi|25402650|pir||E86245 hypothetical protein [imported] - Arabid... 69 2e-10
gi|21313414|ref|NP_079921.1| U5 snRNP-specific protein (Prp8-bin... 69 2e-10
gi|48891514|ref|ZP_00325021.1| COG2319: FOG: WD40 repeat [Tricho... 69 2e-10
gi|11875643|gb|AAG40737.1| Bap1 [Myxococcus xanthus] 69 2e-10
gi|50305967|ref|XP_452944.1| unnamed protein product [Kluyveromy... 69 2e-10
gi|50729957|ref|XP_416723.1| PREDICTED: similar to Chromatin ass... 69 2e-10
gi|24210418|emb|CAD54457.1| LIS1 protein [Dictyostelium discoide... 69 2e-10
gi|50291315|ref|XP_448090.1| unnamed protein product [Candida gl... 69 2e-10
gi|47224493|emb|CAG08743.1| unnamed protein product [Tetraodon n... 69 2e-10
gi|34867673|ref|XP_213664.2| similar to Chromatin assembly facto... 68 3e-10
gi|23612749|ref|NP_704288.1| guanine nucleotide-binding protein,... 68 3e-10
gi|17554220|ref|NP_499755.1| human LISsencephaly gene related (4... 68 3e-10
gi|50309993|ref|XP_455010.1| unnamed protein product [Kluyveromy... 68 3e-10
gi|24652208|ref|NP_610526.1| CG1671-PA [Drosophila melanogaster]... 68 3e-10
gi|50308531|ref|XP_454268.1| unnamed protein product [Kluyveromy... 68 3e-10
gi|47216991|emb|CAG04933.1| unnamed protein product [Tetraodon n... 68 3e-10
gi|12667270|gb|AAK01368.1| serine-threonine kinase receptor-asso... 68 3e-10
gi|23124911|ref|ZP_00106869.1| COG2319: FOG: WD40 repeat [Nostoc... 68 3e-10
gi|50310563|ref|XP_455301.1| unnamed protein product [Kluyveromy... 67 4e-10
gi|18395507|ref|NP_564219.1| transducin family protein / WD-40 r... 67 4e-10
gi|34894702|ref|NP_908676.1| P0426D06.17 [Oryza sativa (japonica... 67 4e-10
gi|26665869|ref|NP_758440.1| TUWD12 [Homo sapiens] >gnl|BL_ORD_I... 67 4e-10
gi|12840673|dbj|BAB24913.1| unnamed protein product [Mus musculu... 67 4e-10
gi|45187689|ref|NP_983912.1| ADL184Wp [Eremothecium gossypii] >g... 67 4e-10
gi|5869880|emb|CAB55584.1| apoptotic protease activating factor ... 67 6e-10
gi|16331137|ref|NP_441865.1| beta transducin-like protein [Synec... 67 6e-10
gi|15235470|ref|NP_192182.1| transducin family protein / WD-40 r... 67 6e-10
gi|48893278|ref|ZP_00326547.1| COG0515: Serine/threonine protein... 67 6e-10
gi|50543284|ref|XP_499808.1| hypothetical protein [Yarrowia lipo... 67 6e-10
gi|17737533|ref|NP_523922.1| CG15010-PC [Drosophila melanogaster... 67 6e-10
gi|13027436|ref|NP_076469.1| apoptotic protease activating facto... 67 6e-10
gi|17544258|ref|NP_500086.1| protein transport protein SEC13 rel... 67 6e-10
gi|17224297|gb|AAL36935.1| apoptotic protease activating factor-... 67 8e-10
gi|17505895|ref|NP_492363.1| pre-mRNA factor (55.9 kD) (1J310) [... 67 8e-10
gi|17232051|ref|NP_488599.1| WD-40 repeat-protein [Nostoc sp. PC... 67 8e-10
gi|24651075|ref|NP_651702.1| CG7568-PA [Drosophila melanogaster]... 67 8e-10
gi|46134549|ref|ZP_00158076.2| COG2319: FOG: WD40 repeat [Anabae... 67 8e-10
gi|39545918|gb|AAR28022.1| TAF5 [Arabidopsis thaliana] 67 8e-10
gi|50411377|ref|XP_457041.1| unnamed protein product [Debaryomyc... 67 8e-10
gi|24663767|ref|NP_648640.1| CG10191-PA [Drosophila melanogaster... 67 8e-10
gi|17228167|ref|NP_484715.1| WD-repeat protein [Nostoc sp. PCC 7... 67 8e-10
gi|15227373|ref|NP_181681.1| WD-40 repeat family protein / small... 66 1e-09
gi|23127725|ref|ZP_00109588.1| COG2319: FOG: WD40 repeat [Nostoc... 66 1e-09
gi|50417036|ref|XP_457626.1| unnamed protein product [Debaryomyc... 66 1e-09
gi|31232083|ref|XP_318645.1| ENSANGP00000020999 [Anopheles gambi... 66 1e-09
gi|45190337|ref|NP_984591.1| AEL269Cp [Eremothecium gossypii] >g... 66 1e-09
gi|47226365|emb|CAG09333.1| unnamed protein product [Tetraodon n... 66 1e-09
gi|50256458|gb|EAL19183.1| hypothetical protein CNBH2820 [Crypto... 66 1e-09
gi|50258634|gb|EAL21321.1| hypothetical protein CNBD3750 [Crypto... 66 1e-09
gi|48895484|ref|ZP_00328468.1| COG2319: FOG: WD40 repeat [Tricho... 66 1e-09
gi|6323237|ref|NP_013309.1| cytoplasmic protein involved in rele... 66 1e-09
gi|15240710|ref|NP_201533.1| WD-40 repeat family protein [Arabid... 65 2e-09
gi|15242311|ref|NP_196473.1| transducin family protein / WD-40 r... 65 2e-09
gi|39586585|emb|CAE73712.1| Hypothetical protein CBG21225 [Caeno... 65 2e-09
gi|31198775|ref|XP_308335.1| ENSANGP00000010753 [Anopheles gambi... 65 2e-09
gi|17552164|ref|NP_497749.1| WD repeat domain 5B (3E795) [Caenor... 65 2e-09
gi|47215488|emb|CAG01596.1| unnamed protein product [Tetraodon n... 65 2e-09
gi|42567822|ref|NP_196852.2| WD-40 repeat family protein [Arabid... 65 2e-09
gi|50286567|ref|XP_445712.1| unnamed protein product [Candida gl... 65 2e-09
gi|4885105|ref|NP_005432.1| chromatin assembly factor 1 subunit ... 65 2e-09
gi|48846051|ref|ZP_00300319.1| COG2319: FOG: WD40 repeat [Geobac... 65 2e-09
gi|34910318|ref|NP_916506.1| P0013F10.18 [Oryza sativa (japonica... 65 2e-09
gi|38455441|gb|AAR20840.1| antigenic WD protein [Leishmania amaz... 65 3e-09
gi|48097023|ref|XP_393667.1| similar to ENSANGP00000022244 [Apis... 65 3e-09
gi|50428732|gb|AAT77083.1| putative WD G-beta repeat protein [Or... 65 3e-09
gi|26331128|dbj|BAC29294.1| unnamed protein product [Mus musculus] 65 3e-09
gi|15240036|ref|NP_199205.1| transducin family protein / WD-40 r... 65 3e-09
gi|46124619|ref|XP_386863.1| hypothetical protein FG06687.1 [Gib... 64 4e-09
gi|45185885|ref|NP_983601.1| ACR199Cp [Eremothecium gossypii] >g... 64 4e-09
gi|17232251|ref|NP_488799.1| WD-repeat protein [Nostoc sp. PCC 7... 64 4e-09
gi|30794128|gb|AAP40506.1| putative small nuclear ribonucleoprot... 64 4e-09
gi|47216142|emb|CAG10016.1| unnamed protein product [Tetraodon n... 64 4e-09
gi|22298032|ref|NP_681279.1| WD-40 repeat protein [Thermosynecho... 64 4e-09
gi|50426625|ref|XP_461910.1| unnamed protein product [Debaryomyc... 64 4e-09
gi|49115497|gb|AAH73405.1| Unknown (protein for MGC:80868) [Xeno... 64 4e-09
gi|50261761|gb|AAT72461.1| FY protein [Lolium perenne] 64 4e-09
gi|9955107|pdb|1ERJ|A Chain A, Crystal Structure Of The C-Termin... 64 5e-09
gi|14599401|emb|CAC43453.1| probable nuclear migration protein [... 64 5e-09
gi|45916042|ref|ZP_00194861.2| COG2319: FOG: WD40 repeat [Mesorh... 64 5e-09
gi|11066216|gb|AAG28504.1| TUPA [Emericella nidulans] 64 5e-09
gi|48894319|ref|ZP_00327428.1| COG2319: FOG: WD40 repeat [Tricho... 64 5e-09
gi|48895671|ref|ZP_00328655.1| COG0515: Serine/threonine protein... 64 5e-09
gi|48891847|ref|ZP_00325296.1| COG2319: FOG: WD40 repeat [Tricho... 64 6e-09
gi|49075446|ref|XP_401788.1| hypothetical protein UM04173.1 [Ust... 64 6e-09
gi|19115362|ref|NP_594450.1| putative chromatin assembly factor ... 64 6e-09
gi|49119215|gb|AAH73215.1| Unknown (protein for MGC:80502) [Xeno... 64 6e-09
gi|50797401|ref|XP_423947.1| PREDICTED: similar to nuclear recep... 64 6e-09
gi|31322517|gb|AAP20646.1| nuclear receptor co-repressor complex... 64 6e-09
gi|34855547|ref|XP_345196.1| similar to nuclear receptor co-repr... 64 6e-09
gi|32406122|ref|XP_323674.1| hypothetical protein [Neurospora cr... 64 6e-09
gi|12006104|gb|AAG44736.1| IRA1 [Homo sapiens] 64 6e-09
gi|10434648|dbj|BAB14331.1| unnamed protein product [Homo sapiens] 64 6e-09
gi|31543001|ref|NP_109657.2| IRA1 protein [Mus musculus] >gnl|BL... 64 6e-09
gi|19913371|ref|NP_078941.2| nuclear receptor co-repressor/HDAC3... 64 6e-09
gi|22330602|ref|NP_177513.2| transducin family protein / WD-40 r... 63 8e-09
gi|29465691|gb|AAL99251.1| TupA protein [Penicillium marneffei] 63 8e-09
gi|25406289|pir||D96764 unknown protein F25P22.14 [imported] - A... 63 8e-09
gi|9931971|gb|AAB81475.2| general transcriptional repressor Tup1... 63 8e-09
gi|40949819|gb|AAR97571.1| will die slowly [Bombyx mori] 63 8e-09
gi|10383804|ref|NP_009997.2| Protein required for cell viability... 63 8e-09
gi|49077276|ref|XP_402515.1| hypothetical protein UM04900.1 [Ust... 63 8e-09
gi|42408240|dbj|BAD09397.1| putative FAS2 [Oryza sativa (japonic... 63 8e-09
gi|19113822|ref|NP_592910.1| general transcriptional repressor t... 63 8e-09
gi|23126356|ref|ZP_00108255.1| COG2319: FOG: WD40 repeat [Nostoc... 63 1e-08
gi|83249|pir||S19487 hypothetical protein YCR072c - yeast (Sacch... 63 1e-08
gi|3687833|gb|AAC62236.1| notchless [Xenopus laevis] 63 1e-08
gi|27882062|gb|AAH44710.1| Nle-pending-prov protein [Xenopus lae... 63 1e-08
gi|50419087|ref|XP_458066.1| unnamed protein product [Debaryomyc... 63 1e-08
gi|41152231|ref|NP_958503.1| platelet-activating factor acetylhy... 63 1e-08
gi|46117490|ref|XP_384763.1| hypothetical protein FG04587.1 [Gib... 63 1e-08
gi|47226994|emb|CAG05886.1| unnamed protein product [Tetraodon n... 63 1e-08
gi|23490090|gb|EAA21947.1| hypothetical protein [Plasmodium yoel... 62 1e-08
gi|17537415|ref|NP_496100.1| transducin -like 3 (2K34) [Caenorha... 62 1e-08
gi|46127123|ref|XP_388115.1| conserved hypothetical protein [Gib... 62 1e-08
gi|47085751|ref|NP_998183.1| zgc:56071 [Danio rerio] >gnl|BL_ORD... 62 1e-08
gi|48840987|ref|ZP_00297913.1| COG2319: FOG: WD40 repeat [Methan... 62 1e-08
gi|50256763|gb|EAL19483.1| hypothetical protein CNBG4300 [Crypto... 62 1e-08
gi|17137500|ref|NP_477329.1| CG4063-PA [Drosophila melanogaster]... 62 1e-08
gi|3170523|gb|AAC18088.1| coatomer alpha subunit [Aspergillus ni... 62 1e-08
gi|48893643|ref|ZP_00326841.1| COG2319: FOG: WD40 repeat [Tricho... 62 1e-08
gi|49091404|ref|XP_407163.1| hypothetical protein AN3026.2 [Aspe... 62 1e-08
gi|22749103|ref|NP_689741.1| WD repeat and SAM domain containing... 62 1e-08
gi|24644361|ref|NP_730982.1| CG1109-PA [Drosophila melanogaster]... 62 1e-08
gi|41054303|ref|NP_956049.1| Unknown (protein for MGC:65943); mg... 62 1e-08
gi|50414726|gb|AAH77273.1| Unknown (protein for IMAGE:4031030) [... 62 1e-08
gi|29841234|gb|AAP06266.1| similar to GenBank Accession Number U... 62 2e-08
gi|42562854|ref|NP_176316.3| WD-40 repeat family protein / katan... 62 2e-08
gi|12006108|gb|AAG44738.1| IRA1 [Mus musculus] 62 2e-08
gi|25404314|pir||A96638 hypothetical protein F11P17.7 [imported]... 62 2e-08
gi|34854703|ref|XP_342438.1| similar to hypothetical protein FLJ... 62 2e-08
gi|15220684|ref|NP_176393.1| coatomer protein complex, subunit a... 62 2e-08
gi|14132774|gb|AAK52334.1| LIS1 [Xenopus laevis] 62 2e-08
gi|31226862|ref|XP_317781.1| ENSANGP00000022244 [Anopheles gambi... 62 2e-08
gi|31196347|ref|XP_307121.1| ENSANGP00000012135 [Anopheles gambi... 62 2e-08
gi|349828|gb|AAA02882.1| Miller-Dieker lissencephaly protein 62 2e-08
gi|15822537|gb|AAG16640.1| F-box protein SEL10 [Homo sapiens] 62 2e-08
gi|30685651|ref|NP_850206.1| transducin family protein / WD-40 r... 62 2e-08
gi|34783512|gb|AAH37320.1| FBXW7 protein [Homo sapiens] 62 2e-08
gi|21593236|gb|AAM65185.1| transport protein SEC13, putative [Ar... 62 2e-08
gi|30685653|ref|NP_850207.1| transducin family protein / WD-40 r... 62 2e-08
gi|16117781|ref|NP_361014.1| F-box protein FBW7 isoform 1; archi... 62 2e-08
gi|38105496|gb|EAA51916.1| hypothetical protein MG03511.4 [Magna... 62 2e-08
gi|17974548|gb|AAL50052.1| F-box protein [Mus musculus] 62 2e-08
gi|21218434|ref|NP_536353.2| F-box and WD-40 domain protein 7, a... 62 2e-08
gi|14326447|gb|AAK60269.1| F-box protein FBX30 [Homo sapiens] 62 2e-08
gi|18418034|ref|NP_567896.1| WD-40 repeat family protein (LEUNIG... 62 2e-08
gi|7023505|dbj|BAA91986.1| unnamed protein product [Homo sapiens] 62 2e-08
gi|11141605|gb|AAG32022.1| LEUNIG [Arabidopsis thaliana] 62 2e-08
gi|26328005|dbj|BAC27743.1| unnamed protein product [Mus musculus] 62 2e-08
gi|6324012|ref|NP_014082.1| Polyadenylation Factor I subunit 2; ... 62 2e-08
gi|2104937|gb|AAC63098.1| truncated form platelet-activating fac... 62 2e-08
gi|480009|pir||S36113 LIS-1 protein - human 62 2e-08
gi|449693|prf||1919424A Miller-Dieker lissencephaly gene 62 2e-08
gi|45360589|ref|NP_988967.1| hypothetical protein MGC76017 [Xeno... 62 2e-08
gi|15221675|ref|NP_173823.1| transducin family protein / WD-40 r... 62 2e-08
gi|31213285|ref|XP_315586.1| ENSANGP00000017775 [Anopheles gambi... 62 2e-08
gi|15232095|ref|NP_186783.1| protein transport protein SEC13 fam... 62 2e-08
gi|16117779|ref|NP_060785.2| F-box protein FBW7 isoform 2; archi... 62 2e-08
gi|24649631|ref|NP_732982.1| CG31132-PA [Drosophila melanogaster... 62 2e-08
gi|7305363|ref|NP_038653.1| platelet-activating factor acetylhyd... 62 2e-08
gi|17056921|gb|AAL34972.1| Miller-Dieker lissencephaly protein [... 62 2e-08
gi|45433584|ref|NP_991399.1| hypothetical protein MGC76037 [Xeno... 62 2e-08
gi|4557741|ref|NP_000421.1| platelet-activating factor acetylhyd... 62 2e-08
gi|50746331|ref|XP_420447.1| PREDICTED: similar to F-box protein... 62 2e-08
gi|4559414|gb|AAD23059.1| LIS [Mus musculus] 62 2e-08
gi|47087648|ref|NP_998177.1| zgc:56096 [Danio rerio] >gnl|BL_ORD... 61 3e-08
gi|26329699|dbj|BAC28588.1| unnamed protein product [Mus musculu... 61 3e-08
gi|26327487|dbj|BAC27487.1| unnamed protein product [Mus musculus] 61 3e-08
gi|50294333|ref|XP_449578.1| unnamed protein product [Candida gl... 61 3e-08
gi|49523567|emb|CAF18245.1| STYLOSA protein [Antirrhinum majus] 61 3e-08
gi|49098364|ref|XP_410642.1| hypothetical protein AN6505.2 [Aspe... 61 3e-08
gi|38089557|ref|XP_134311.2| katanin p80 (WD40-containing) subun... 61 3e-08
gi|34851232|ref|XP_214635.2| similar to katanin p80 subunit B 1;... 61 3e-08
gi|19112316|ref|NP_595524.1| trp asp repeat protein [Schizosacch... 61 3e-08
gi|12845754|dbj|BAB26884.1| unnamed protein product [Mus musculus] 61 3e-08
gi|50424771|ref|XP_460975.1| unnamed protein product [Debaryomyc... 61 3e-08
gi|46441861|gb|EAL01155.1| hypothetical protein CaO19.316 [Candi... 61 3e-08
gi|27807199|ref|NP_777088.1| platelet-activating factor acetylhy... 61 3e-08
gi|30689741|ref|NP_197897.2| transducin family protein / WD-40 r... 61 3e-08
gi|30584393|gb|AAP36445.1| Homo sapiens katanin p80 (WD40-contai... 61 3e-08
gi|12655011|gb|AAH01353.1| Katanin p80 subunit B 1 [Homo sapiens... 61 3e-08
gi|47216288|emb|CAF96584.1| unnamed protein product [Tetraodon n... 61 4e-08
gi|11120706|ref|NP_068525.1| pleiotropic regulator 1 [Rattus nor... 61 4e-08
gi|49257408|gb|AAH73381.1| Unknown (protein for MGC:80813) [Xeno... 61 4e-08
gi|47551119|ref|NP_999734.1| katanin p80 subunit [Strongylocentr... 61 4e-08
gi|45383504|ref|NP_989655.1| platelet-activating factor acetylhy... 61 4e-08
gi|23574762|dbj|BAC20600.1| platelet activating factor acetylhyd... 61 4e-08
gi|45361625|ref|NP_989387.1| hypothetical protein MGC75613 [Xeno... 61 4e-08
gi|25091532|sp|Q26544|WS17_SCHMA WD-repeat protein SL1-17 >gnl|B... 60 5e-08
gi|19569133|gb|AAL92025.1| PRP-like protein [Marsilea vestita] 60 5e-08
gi|50758306|ref|XP_415857.1| PREDICTED: similar to Nle-pending-p... 60 5e-08
gi|38074777|ref|XP_130321.3| RIKEN cDNA 2610014F08 [Mus musculus... 60 5e-08
gi|47221781|emb|CAG08835.1| unnamed protein product [Tetraodon n... 60 5e-08
gi|33945873|emb|CAE45585.1| coatomer alpha subunit-like protein ... 60 5e-08
gi|23126489|ref|ZP_00108383.1| COG2319: FOG: WD40 repeat [Nostoc... 60 5e-08
gi|46562016|gb|AAT01224.1| katanin p80 subunit PF15p [Chlamydomo... 60 5e-08
gi|17570175|ref|NP_508590.1| UNCoordinated locomotion UNC-78, WD... 60 5e-08
gi|19075884|ref|NP_588384.1| notchless-like; WD repeat protein [... 60 5e-08
gi|47523580|ref|NP_999415.1| platelet-activating factor acetylhy... 60 5e-08
gi|30048137|gb|AAH50792.1| 2610014F08Rik protein [Mus musculus] 60 5e-08
gi|20091406|ref|NP_617481.1| WD-domain containing protein [Metha... 60 5e-08
gi|5031817|ref|NP_005877.1| katanin p80 subunit B 1; katanin (80... 60 5e-08
gi|46229832|gb|EAK90650.1| coatomer complex beta [Cryptosporidiu... 60 7e-08
gi|50257760|gb|EAL20461.1| hypothetical protein CNBE3820 [Crypto... 60 7e-08
gi|20302740|gb|AAM18868.1| unknown [Branchiostoma floridae] 60 7e-08
gi|48123379|ref|XP_396532.1| similar to ENSANGP00000020955 [Apis... 60 7e-08
gi|18402031|ref|NP_566620.1| transducin family protein / WD-40 r... 60 7e-08
gi|30685107|ref|NP_850612.1| transducin family protein / WD-40 r... 60 7e-08
gi|41054505|ref|NP_955927.1| Unknown (protein for MGC:63905) [Da... 60 7e-08
gi|19113627|ref|NP_596835.1| WD repeat protein; human U5 SNRNP-s... 60 7e-08
gi|39597733|emb|CAE68424.1| Hypothetical protein CBG14204 [Caeno... 60 7e-08
gi|17864654|ref|NP_524984.1| CG17437-PA [Drosophila melanogaster... 60 7e-08
gi|4505895|ref|NP_002660.1| pleiotropic regulator 1 (PRL1homolog... 60 9e-08
gi|50757510|ref|XP_415544.1| PREDICTED: similar to U4/U6 small n... 60 9e-08
gi|34853150|ref|XP_342398.1| similar to hypothetical protein [Ra... 60 9e-08
gi|50260567|gb|EAL23222.1| hypothetical protein CNBA5660 [Crypto... 60 9e-08
gi|18088489|gb|AAH20786.1| PLRG1 protein [Homo sapiens] 60 9e-08
gi|47218051|emb|CAG11456.1| unnamed protein product [Tetraodon n... 60 9e-08
gi|50416375|gb|AAH77313.1| Unknown (protein for MGC:80243) [Xeno... 60 9e-08
gi|19922822|ref|NP_611804.1| CG3957-PA [Drosophila melanogaster]... 60 9e-08
gi|47214494|emb|CAG12499.1| unnamed protein product [Tetraodon n... 60 9e-08
gi|27696242|gb|AAH43755.1| Sec13l1-prov protein [Xenopus laevis] 60 9e-08
gi|39850146|gb|AAH64237.1| LOC394977 protein [Xenopus tropicalis] 60 9e-08
gi|23503100|sp|O60907|TBLX_HUMAN F-box-like/WD-repeat protein TB... 60 9e-08
gi|15226538|ref|NP_179734.1| coatomer protein complex, subunit a... 60 9e-08
gi|34855811|ref|XP_218509.2| hypothetical protein XP_218509 [Rat... 60 9e-08
gi|5032159|ref|NP_005638.1| transducin beta-like 1X; transducin ... 60 9e-08
gi|6714707|emb|CAB66159.1| hypothetical protein [Homo sapiens] 60 9e-08
gi|16554627|ref|NP_060058.1| WD repeat domain 5 protein; WD-repe... 60 9e-08
gi|30353827|gb|AAH52124.1| Zgc:76895 protein [Danio rerio] >gnl|... 60 9e-08
gi|50757207|ref|XP_415427.1| PREDICTED: similar to Zgc:56591 pro... 60 9e-08
gi|47209012|emb|CAF91370.1| unnamed protein product [Tetraodon n... 60 9e-08
gi|39582726|emb|CAE65932.1| Hypothetical protein CBG11105 [Caeno... 60 9e-08
gi|46134449|ref|ZP_00157910.2| COG2319: FOG: WD40 repeat [Anabae... 59 1e-07
gi|50731422|ref|XP_417265.1| PREDICTED: similar to F-box-WD40 re... 59 1e-07
gi|6324322|ref|NP_014392.1| Required for amino acid permease tra... 59 1e-07
gi|27666788|ref|XP_221406.1| similar to WD repeat domain 5B [Rat... 59 1e-07
gi|31980791|ref|NP_058064.2| pleiotropic regulator 1 [Mus muscul... 59 1e-07
gi|2832298|gb|AAC04388.1| pleiotropic regulator 1 [Mus musculus] 59 1e-07
gi|50305243|ref|XP_452581.1| unnamed protein product [Kluyveromy... 59 1e-07
gi|27804457|gb|AAO22525.1| leunig [Brassica rapa subsp. pekinensis] 59 1e-07
gi|39589726|emb|CAE66961.1| Hypothetical protein CBG12355 [Caeno... 59 1e-07
gi|7512710|pir||T14773 hypothetical protein DKFZp564B0482.1 - hu... 59 1e-07
gi|22760676|dbj|BAC11291.1| unnamed protein product [Homo sapiens] 59 1e-07
gi|50254788|gb|EAL17533.1| hypothetical protein CNBM1000 [Crypto... 59 1e-07
gi|20143912|ref|NP_599027.1| WD SOCS-box protein 1 isoform 2; SO... 59 1e-07
gi|50545651|ref|XP_500364.1| hypothetical protein [Yarrowia lipo... 59 1e-07
gi|18677720|ref|NP_056441.6| WD SOCS-box protein 1 isoform 1; SO... 59 1e-07
gi|50736549|ref|XP_419127.1| PREDICTED: similar to Nucleoporin S... 59 1e-07
gi|49078624|ref|XP_403047.1| hypothetical protein UM05432.1 [Ust... 59 1e-07
gi|50582979|ref|NP_998605.1| pleiotropic regulator 1 [Danio reri... 59 1e-07
gi|50416345|gb|AAH77844.1| Unknown (protein for MGC:80538) [Xeno... 59 1e-07
gi|26326543|dbj|BAC27015.1| unnamed protein product [Mus musculus] 59 2e-07
gi|33468969|ref|NP_065626.1| transducin (beta)-like 1 X-linked; ... 59 2e-07
gi|39594799|emb|CAE70667.1| Hypothetical protein CBG17375 [Caeno... 59 2e-07
gi|34878399|ref|XP_341230.1| similar to WD-repeat protein 1 (Act... 59 2e-07
gi|45508210|ref|ZP_00160550.1| COG2319: FOG: WD40 repeat [Anabae... 59 2e-07
gi|32405482|ref|XP_323354.1| hypothetical protein [Neurospora cr... 59 2e-07
gi|17232369|ref|NP_488917.1| WD-repeat protein [Nostoc sp. PCC 7... 59 2e-07
gi|38344202|emb|CAE05767.2| OSJNBa0064G10.18 [Oryza sativa (japo... 59 2e-07
gi|17228254|ref|NP_484802.1| WD-repeat containing protein [Nosto... 59 2e-07
gi|31236603|ref|XP_319442.1| ENSANGP00000002872 [Anopheles gambi... 59 2e-07
gi|6323251|ref|NP_013323.1| Nucleolar protein, component of the ... 59 2e-07
gi|23479901|gb|EAA16609.1| hypothetical protein [Plasmodium yoel... 59 2e-07
gi|38102041|gb|EAA48932.1| hypothetical protein MG00590.4 [Magna... 59 2e-07
>gi|17509729|ref|NP_493247.1| transducin WD-40 repeat protein family
like (1N446) [Caenorhabditis elegans]
gi|7509468|pir||T26531 hypothetical protein Y18D10A.9 -
Caenorhabditis elegans
Length = 314
Score = 659 bits (1699), Expect = 0.0
Identities = 314/314 (100%), Positives = 314/314 (100%)
Frame = -1
Query: 945 MLRQIGEFYHQGEKDDTSRVWMTCWHHGGRILASCGDDKAVRVWSLVGEPDSKMRLECRT 766
MLRQIGEFYHQGEKDDTSRVWMTCWHHGGRILASCGDDKAVRVWSLVGEPDSKMRLECRT
Sbjct: 1 MLRQIGEFYHQGEKDDTSRVWMTCWHHGGRILASCGDDKAVRVWSLVGEPDSKMRLECRT 60
Query: 765 TLDDSHTRAVRSVAFSNDGKCLVSASFDASVVVYQQEDGEFAEVNKLEGHESEVKCAVFS 586
TLDDSHTRAVRSVAFSNDGKCLVSASFDASVVVYQQEDGEFAEVNKLEGHESEVKCAVFS
Sbjct: 61 TLDDSHTRAVRSVAFSNDGKCLVSASFDASVVVYQQEDGEFAEVNKLEGHESEVKCAVFS 120
Query: 585 KSDEFLATCSRDKSVWFWQQDEDEDFSVSSILQPHTQDVKQVAWHPTEDLLVSCSYDSSI 406
KSDEFLATCSRDKSVWFWQQDEDEDFSVSSILQPHTQDVKQVAWHPTEDLLVSCSYDSSI
Sbjct: 121 KSDEFLATCSRDKSVWFWQQDEDEDFSVSSILQPHTQDVKQVAWHPTEDLLVSCSYDSSI 180
Query: 405 RFYRFDGEDWVTQQKIDGCHVGTLFVRENIGSKSADQDTWKSVARYDVENTRWPLYSVAW 226
RFYRFDGEDWVTQQKIDGCHVGTLFVRENIGSKSADQDTWKSVARYDVENTRWPLYSVAW
Sbjct: 181 RFYRFDGEDWVTQQKIDGCHVGTLFVRENIGSKSADQDTWKSVARYDVENTRWPLYSVAW 240
Query: 225 NSTNDVIATGGGDCKIRLFKISSTPESPVIEHLGVVGRHELDVNHVAWNPNPKFSNLLTS 46
NSTNDVIATGGGDCKIRLFKISSTPESPVIEHLGVVGRHELDVNHVAWNPNPKFSNLLTS
Sbjct: 241 NSTNDVIATGGGDCKIRLFKISSTPESPVIEHLGVVGRHELDVNHVAWNPNPKFSNLLTS 300
Query: 45 ASDDGTIRLWELEI 4
ASDDGTIRLWELEI
Sbjct: 301 ASDDGTIRLWELEI 314
>gi|32698449|emb|CAA22322.2| Hypothetical protein Y18D10A.9
[Caenorhabditis elegans]
Length = 337
Score = 645 bits (1665), Expect = 0.0
Identities = 314/337 (93%), Positives = 314/337 (93%), Gaps = 23/337 (6%)
Frame = -1
Query: 945 MLRQIGEFYHQGEKDDTSRVWMTCWHHGGRILASCGDDKAVRVWSLVGEPDSKMRLECRT 766
MLRQIGEFYHQGEKDDTSRVWMTCWHHGGRILASCGDDKAVRVWSLVGEPDSKMRLECRT
Sbjct: 1 MLRQIGEFYHQGEKDDTSRVWMTCWHHGGRILASCGDDKAVRVWSLVGEPDSKMRLECRT 60
Query: 765 TLDDSHTRAVRSVAFSNDGKCLVSASFDASVVVYQQEDGEFAEVNKLEGHESEVKCAVFS 586
TLDDSHTRAVRSVAFSNDGKCLVSASFDASVVVYQQEDGEFAEVNKLEGHESEVKCAVFS
Sbjct: 61 TLDDSHTRAVRSVAFSNDGKCLVSASFDASVVVYQQEDGEFAEVNKLEGHESEVKCAVFS 120
Query: 585 KSDEFLATCSRDKSVWFWQQDEDEDFSVSSILQPHTQDVKQVAWHPTEDLLVSCSYDSSI 406
KSDEFLATCSRDKSVWFWQQDEDEDFSVSSILQPHTQDVKQVAWHPTEDLLVSCSYDSSI
Sbjct: 121 KSDEFLATCSRDKSVWFWQQDEDEDFSVSSILQPHTQDVKQVAWHPTEDLLVSCSYDSSI 180
Query: 405 RFYRFDGEDWVTQQKIDGCHVGT-----------------------LFVRENIGSKSADQ 295
RFYRFDGEDWVTQQKIDGCHVGT LFVRENIGSKSADQ
Sbjct: 181 RFYRFDGEDWVTQQKIDGCHVGTVWSIAFDTEGHRLVTVGEDHCIQLFVRENIGSKSADQ 240
Query: 294 DTWKSVARYDVENTRWPLYSVAWNSTNDVIATGGGDCKIRLFKISSTPESPVIEHLGVVG 115
DTWKSVARYDVENTRWPLYSVAWNSTNDVIATGGGDCKIRLFKISSTPESPVIEHLGVVG
Sbjct: 241 DTWKSVARYDVENTRWPLYSVAWNSTNDVIATGGGDCKIRLFKISSTPESPVIEHLGVVG 300
Query: 114 RHELDVNHVAWNPNPKFSNLLTSASDDGTIRLWELEI 4
RHELDVNHVAWNPNPKFSNLLTSASDDGTIRLWELEI
Sbjct: 301 RHELDVNHVAWNPNPKFSNLLTSASDDGTIRLWELEI 337