Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y1H11_2
(756 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|32564842|ref|NP_741061.2| glutathione S-Transferase (gst-35) ... 387 e-106
gi|32565758|ref|NP_741060.2| predicted CDS, glutathione S-Transf... 318 1e-85
gi|17560032|ref|NP_507095.1| glutathione S-Transferase (gst-22) ... 267 2e-70
gi|39591187|emb|CAE73240.1| Hypothetical protein CBG20649 [Caeno... 249 4e-65
gi|17566902|ref|NP_503492.1| glutathione S-Transferase (gst-21) ... 218 8e-56
gi|17533781|ref|NP_496860.1| glutathione S-Transferase (gst-15) ... 209 5e-53
gi|17537493|ref|NP_497119.1| glutathione S-transferase family me... 191 2e-47
gi|17537491|ref|NP_497118.1| glutathione S-Transferase (gst-29) ... 189 4e-47
gi|39591200|emb|CAE73253.1| Hypothetical protein CBG20669 [Caeno... 188 1e-46
gi|39591186|emb|CAE73239.1| Hypothetical protein CBG20648 [Caeno... 187 2e-46
gi|39592704|emb|CAE62318.1| Hypothetical protein CBG06384 [Caeno... 183 3e-45
gi|39591199|emb|CAE73252.1| Hypothetical protein CBG20668 [Caeno... 183 4e-45
gi|17533777|ref|NP_496862.1| glutathione S-Transferase (gst-12) ... 182 5e-45
gi|32565684|ref|NP_497123.2| predicted CDS, glutathione S-Transf... 181 1e-44
gi|39591201|emb|CAE73254.1| Hypothetical protein CBG20670 [Caeno... 177 3e-43
gi|17533779|ref|NP_496861.1| glutathione S-Transferase (gst-14) ... 171 1e-41
gi|17537485|ref|NP_497115.1| glutathione S-Transferase (gst-26) ... 171 2e-41
gi|17540934|ref|NP_501846.1| glutathione S-Transferase (23.7 kD)... 169 6e-41
gi|17537487|ref|NP_497116.1| glutathione S-Transferase (gst-27) ... 168 1e-40
gi|17537489|ref|NP_497117.1| glutathione S-Transferase (gst-28) ... 167 2e-40
gi|17537497|ref|NP_497121.1| glutathione S-Transferase (gst-31) ... 166 4e-40
gi|39585760|emb|CAE59962.1| Hypothetical protein CBG03452 [Caeno... 165 8e-40
gi|17533783|ref|NP_496863.1| glutathione S-Transferase (gst-16) ... 164 1e-39
gi|17533775|ref|NP_496859.1| glutathione S-Transferase (gst-24) ... 164 2e-39
gi|17565374|ref|NP_503532.1| predicted CDS, glutathione S-Transf... 162 5e-39
gi|17533789|ref|NP_496864.1| glutathione S-Transferase (gst-19) ... 161 1e-38
gi|7505567|pir||T23485 hypothetical protein K08F4.11 - Caenorhab... 153 3e-36
gi|39585723|emb|CAE59925.1| Hypothetical protein CBG03411 [Caeno... 152 7e-36
gi|17541378|ref|NP_501848.1| glutathione S-Transferase (23.9 kD)... 151 1e-35
gi|39585761|emb|CAE59963.1| Hypothetical protein CBG03453 [Caeno... 146 4e-34
gi|39585759|emb|CAE59961.1| Hypothetical protein CBG03451 [Caeno... 141 2e-32
gi|1170109|sp|P46436|GTS1_ASCSU Glutathione S-transferase 1 (GST... 140 4e-32
gi|39589143|emb|CAE57876.1| Hypothetical protein CBG00918 [Caeno... 134 2e-30
gi|17533787|ref|NP_496866.1| glutathione S-Transferase (gst-18) ... 134 3e-30
gi|17536525|ref|NP_495967.1| glutathione S-Transferase (gst-13) ... 130 3e-29
gi|39592701|emb|CAE62315.1| Hypothetical protein CBG06381 [Caeno... 129 5e-29
gi|17540932|ref|NP_501847.1| glutathione S-Transferase (21.8 kD)... 127 2e-28
gi|17560538|ref|NP_506983.1| glutathione S-Transferase (gst-38) ... 126 4e-28
gi|39596768|emb|CAE58995.1| Hypothetical protein CBG02268 [Caeno... 125 1e-27
gi|39579272|emb|CAE56959.1| Hypothetical protein CBG24809 [Caeno... 125 1e-27
gi|47717441|gb|AAT37718.1| glutathione S-transferase [Ancylostom... 124 3e-27
gi|17534681|ref|NP_496357.1| glutathione S-Transferase (gst-5) [... 122 8e-27
gi|17535437|ref|NP_494887.1| glutathione S-Transferase (gst-9) [... 121 2e-26
gi|17537261|ref|NP_496858.1| glutathione S-Transferase (gst-20) ... 120 3e-26
gi|7505572|pir||T23484 hypothetical protein K08F4.6 - Caenorhabd... 119 7e-26
gi|8917596|gb|AAF81283.1| glutathione S-transferase [Haemonchus ... 118 1e-25
gi|17534685|ref|NP_494883.1| glutathione S-Transferase (23.0 kD)... 117 3e-25
gi|39587305|emb|CAE74959.1| Hypothetical protein CBG22850 [Caeno... 117 3e-25
gi|39591173|emb|CAE73226.1| Hypothetical protein CBG20632 [Caeno... 116 4e-25
gi|39591202|emb|CAE73255.1| Hypothetical protein CBG20671 [Caeno... 116 6e-25
gi|32564637|ref|NP_494882.2| glutathione S-Transferase (23.6 kD)... 115 1e-24
gi|7498934|pir||T29984 hypothetical protein F11G11.3 - Caenorhab... 115 1e-24
gi|39579271|emb|CAE56958.1| Hypothetical protein CBG24808 [Caeno... 114 2e-24
gi|17535439|ref|NP_494889.1| glutathione S-Transferase (gst-9) [... 114 3e-24
gi|39596775|emb|CAE59002.1| Hypothetical protein CBG02278 [Caeno... 112 8e-24
gi|17534687|ref|NP_494884.1| glutathione S-Transferase (gst-8) [... 111 2e-23
gi|7108568|gb|AAF36480.1| glutathione S-transferase 2 [Nematospi... 110 4e-23
gi|17557472|ref|NP_503968.1| glutathione S-Transferase (gst-33) ... 105 1e-21
gi|17533785|ref|NP_496865.1| glutathione S-Transferase (gst-17) ... 104 2e-21
gi|17537895|ref|NP_494902.1| glutathione S-Transferase (gst-30) ... 103 5e-21
gi|17569381|ref|NP_508625.1| glutathione S-Transferase (gst-11) ... 101 2e-20
gi|39597765|emb|CAE68457.1| Hypothetical protein CBG14247 [Caeno... 96 8e-19
gi|39584542|emb|CAE74620.1| Hypothetical protein CBG22411 [Caeno... 95 2e-18
gi|45384344|ref|NP_990342.1| prostaglandin-D synthase [Gallus ga... 87 4e-16
gi|6225491|sp|O18598|GTS1_BLAGE Glutathione S-transferase (GST c... 83 5e-15
gi|49532926|dbj|BAD26698.1| Glutathione S transferase 2-like pro... 81 3e-14
gi|1170107|sp|P46429|GTS2_MANSE GLUTATHIONE S-TRANSFERASE 2 (GST... 80 4e-14
gi|3514020|gb|AAC34097.1| glutathione transferase; PiGSTII [Plat... 80 6e-14
gi|2326190|gb|AAB72147.1| allergen Bla g 5 [Blattella germanica] 79 1e-13
gi|40362717|gb|AAR84628.1| glutathione S-transferase [Gryllotalp... 79 1e-13
gi|32330663|gb|AAP79878.1| glutathione S-transferase [Solenopsis... 78 2e-13
gi|39590943|emb|CAE58723.1| Hypothetical protein CBG01908 [Caeno... 78 2e-13
gi|31205193|ref|XP_311545.1| ENSANGP00000010247 [Anopheles gambi... 78 2e-13
gi|1170110|sp|P46437|GTS_MUSDO GLUTATHIONE S-TRANSFERASE (GST CL... 77 4e-13
gi|7657457|ref|NP_055300.1| prostaglandin-D synthase; hematopoie... 77 4e-13
gi|12005980|gb|AAG44696.1| glutathione S-transferase Ib [Onchoce... 76 7e-13
gi|481923|pir||S40165 glutathione transferase (EC 2.5.1.18) - ne... 76 9e-13
gi|1170077|sp|P46434|GT1_ONCVO GLUTATHIONE S-TRANSFERASE 1 >gnl|... 76 9e-13
gi|12005978|gb|AAG44695.1| glutathione S-transferase Ia [Onchoce... 76 9e-13
gi|31205195|ref|XP_311546.1| ENSANGP00000023017 [Anopheles gambi... 74 3e-12
gi|23509408|ref|NP_702075.1| glutathione s-transferase, putative... 74 3e-12
gi|48095724|ref|XP_394518.1| similar to glutathione S-transferas... 74 3e-12
gi|16518972|gb|AAL25087.1| glutathione s-transferase [Plasmodium... 74 3e-12
gi|24654347|ref|NP_725653.1| CG8938-PA [Drosophila melanogaster]... 73 6e-12
gi|38051840|gb|AAH60462.1| MGC68589 protein [Xenopus laevis] 72 1e-11
gi|30749298|pdb|1IYH|A Chain A, Crystal Structure Of Hematopoiet... 72 1e-11
gi|1170108|sp|P46428|GTS_ANOGA GLUTATHIONE S-TRANSFERASE (GST CL... 71 2e-11
gi|25152187|ref|NP_509652.2| glutathione S-Transferase (23.9 kD)... 71 3e-11
gi|1170101|sp|P46426|GTP_DIRIM Glutathione S-transferase (GST cl... 71 3e-11
gi|31559115|gb|AAP50848.1| glutathione S-transferase 2 [Bombyx m... 69 8e-11
gi|49900017|gb|AAH77016.1| Unknown (protein for MGC:89746) [Xeno... 69 1e-10
gi|32450087|gb|AAH53774.1| MGC64301 protein [Xenopus laevis] 67 4e-10
gi|21952442|gb|AAM82563.1| glutathione s-transferase [Xenopus la... 67 4e-10
gi|21435011|gb|AAM53611.1| glutathione S-transferase S1-2 [Anoph... 67 5e-10
gi|7387485|gb|AAB33637.2| glutathione S-transferase; GST [Nemato... 66 7e-10
gi|477414|pir||A48982 glutathione transferase (EC 2.5.1.18) 2 - ... 66 7e-10
gi|20139191|sp|Q9JHF7|PGD2_MOUSE Glutathione-requiring prostagla... 65 2e-09
gi|31980908|ref|NP_062328.2| prostaglandin D2 synthase 2, hemato... 65 2e-09
gi|17563170|ref|NP_504894.1| glutathione S-Transferase (25.0 kD)... 63 8e-09
gi|951352|gb|AAA74634.1| glutathione S-transferase A3 62 1e-08
gi|11258625|pir||A49365 glutathione transferase (EC 2.5.1.18) al... 62 1e-08
gi|13928888|ref|NP_113832.1| prostaglandin D2 synthase 2; prosta... 62 1e-08
gi|1654009|emb|CAA70303.1| glutathione S-transferase [Mesocricet... 62 1e-08
gi|1170111|sp|P46088|GTS_OMMSL Glutathione S-transferase (GST cl... 62 1e-08
gi|1065021|pdb|1GSQ| Glutathione S-Transferase (Gst) (E.C.2.5.1... 62 1e-08
gi|975211|emb|CAA58767.1| glutathione transferase [Onchocerca vo... 62 1e-08
gi|7188365|gb|AAF37739.1| glutathione S-transferase alpha [Rattu... 62 2e-08
gi|18089048|gb|AAH20619.1| Glutathione S-transferase A3 [Homo sa... 62 2e-08
gi|24430144|ref|NP_000838.3| glutathione S-transferase A3; gluta... 62 2e-08
gi|1170102|sp|P46427|GTP_ONCVO Glutathione S-transferase 2 (GST ... 62 2e-08
gi|12832492|dbj|BAB22131.1| unnamed protein product [Mus musculus] 62 2e-08
gi|13928688|ref|NP_113697.1| glutathione S-transferase, alpha 1;... 62 2e-08
gi|31981724|ref|NP_034486.2| glutathione S-transferase, alpha 3 ... 62 2e-08
gi|23428564|gb|AAL23713.1| glutathione S-transferase [Opisthorch... 62 2e-08
gi|625079|gb|AAA97540.1| S-crystallin 61 3e-08
gi|193703|gb|AAA37751.1| glutathione transferase 61 3e-08
gi|39588670|emb|CAE58194.1| Hypothetical protein CBG01288 [Caeno... 60 4e-08
gi|7506384|pir||T23994 hypothetical protein R07B1.4 - Caenorhabd... 60 5e-08
gi|1170085|sp|P46418|GTC2_RAT Glutathione S-transferase Yc-2 (Ch... 60 5e-08
gi|159838|gb|AAA29403.1| S-crystallin 60 6e-08
gi|1170086|sp|Q08862|GTC_RABIT GLUTATHIONE S-TRANSFERASE YC (ALP... 59 8e-08
gi|134283|sp|P27012|SC4_OCTDO S-CRYSTALLIN 4 (OL4) >gnl|BL_ORD_I... 59 8e-08
gi|23480514|gb|EAA17054.1| glutathione s-transferase [Plasmodium... 59 1e-07
gi|2058287|emb|CAA73325.1| glutathione transferase [Brugia malayi] 59 1e-07
gi|41387382|gb|AAS01601.1| Pi-class glutathione S-trasferase [An... 59 1e-07
gi|17565768|ref|NP_503701.1| glutathione S-Transferase (24.8 kD)... 59 1e-07
gi|28630830|gb|AAO45827.1| glutathione S-transferase [Wuchereria... 59 1e-07
gi|6137390|pdb|1B48|A Chain A, Crystal Structure Of Mgsta4-4 In ... 58 2e-07
gi|5360517|dbj|BAA82038.1| glutathione s-transferase [Cavia porc... 58 2e-07
gi|8928140|sp|P81706|GTA1_CAVPO Glutathione S-transferase A (GST... 58 2e-07
gi|20141353|sp|P24472|GTA4_MOUSE Glutathione S-transferase 5.7 (... 58 2e-07
gi|12848219|dbj|BAB27873.1| unnamed protein product [Mus musculus] 58 2e-07
gi|6754082|ref|NP_034487.1| glutathione S-transferase, alpha 4 [... 58 2e-07
gi|50400547|sp|Q8JFZ2|GTP1_XENLA Glutathione S-transferase P 1 (... 58 2e-07
gi|442977|pdb|1GUH|A Chain A, Glutathione S-Transferase A1-1 (E.... 58 2e-07
gi|1127144|pdb|1GSE|A Chain A, Glutathione Transferase A1-1 Comp... 58 2e-07
gi|134261|sp|P18426|SC11_OMMSL S-CRYSTALLIN SL11 (MAJOR LENS POL... 58 2e-07
gi|50513281|pdb|1PKW|A Chain A, Crystal Structure Of Human Gluta... 58 2e-07
gi|8218078|emb|CAB92770.1| dJ152L7.3 (glutathione S-transferase ... 58 2e-07
gi|257476|gb|AAB23672.1| glutathione S-transferase A2 subunit [H... 58 2e-07
gi|22091454|ref|NP_665683.1| glutathione S-transferase A1; GST, ... 58 2e-07
gi|12859396|dbj|BAB31640.1| unnamed protein product [Mus musculus] 58 2e-07
gi|121699|sp|P26624|GT28_SCHJA Glutathione S-transferase 28 kDa ... 57 3e-07
gi|2829287|gb|AAC00518.1| glutathione S-transferase [Schistosoma... 57 3e-07
gi|1389744|gb|AAB03573.1| glutathione-S-transferase 57 3e-07
gi|20149504|ref|NP_000837.2| glutathione S-transferase A2; gluta... 57 3e-07
gi|50513287|pdb|1PL2|A Chain A, Crystal Structure Of Human Gluta... 57 3e-07
gi|24308514|ref|NP_714543.1| glutathione transferase A5 [Homo sa... 57 4e-07
gi|4959550|gb|AAD34393.1| glutathione S-transferase class-alpha ... 57 4e-07
gi|1065322|pdb|1AGS|A Chain A, Alpha Glutathione S-Transferase (... 57 5e-07
gi|134271|sp|P27009|SC1_OCTDO S-CRYSTALLIN 1 (OL1) >gnl|BL_ORD_I... 56 7e-07
gi|17540724|ref|NP_499981.1| glutathione S-Transferase (24.9 kD)... 56 7e-07
gi|48106995|ref|XP_393084.1| similar to Glutathione-requiring pr... 56 9e-07
gi|134279|sp|P27010|SC2_OCTDO S-CRYSTALLIN 2 (OL2) >gnl|BL_ORD_I... 55 1e-06
gi|7434039|pir||S24330 glutathione transferase (EC 2.5.1.18) alp... 55 1e-06
gi|8393499|ref|NP_058709.1| glutathione-S-transferase, alpha typ... 55 1e-06
gi|66611|pir||XURTG glutathione transferase (EC 2.5.1.18) class ... 55 1e-06
gi|38511981|gb|AAH60914.1| Zgc:73173 protein [Danio rerio] 55 2e-06
gi|345859|pir||S29658 glutathione transferase (EC 2.5.1.18) omeg... 55 2e-06
gi|134268|sp|P27016|SC18_OMMSL S-CRYSTALLIN SL18 >gnl|BL_ORD_ID|... 55 2e-06
gi|187132|gb|AAA36174.1| gluthione S-transferase subunit 1 (GST,... 55 2e-06
gi|13096120|pdb|1EV4|A Chain A, Rat Glutathione S-Transferase A1... 55 2e-06
gi|13096123|pdb|1EV9|A Chain A, Rat Glutathione S-Transferase A1... 55 2e-06
gi|1170081|sp|Q08863|GTA1_RABIT Glutathione S-transferase alpha ... 55 2e-06
gi|2738935|gb|AAD04712.1| glutathione transferase [Homo sapiens] 55 2e-06
gi|49522440|gb|AAH75475.1| Unknown (protein for MGC:89299) [Xeno... 55 2e-06
gi|50744868|ref|XP_444657.1| PREDICTED: glutathione transferase ... 55 2e-06
gi|47228778|emb|CAG07510.1| unnamed protein product [Tetraodon n... 54 3e-06
gi|6680121|ref|NP_032209.1| glutathione S-transferase, mu 2; glu... 54 3e-06
gi|345858|pir||S29657 glutathione transferase (EC 2.5.1.18) omeg... 54 4e-06
gi|28828694|gb|AAO51292.1| similar to Xenopus laevis (African cl... 54 4e-06
gi|32965121|gb|AAP91748.1| glutathione-requiring prostaglandin D... 54 4e-06
gi|47086689|ref|NP_997841.1| Unknown (protein for MGC:66370); gl... 54 4e-06
gi|134281|sp|P27011|SC3_OCTDO S-CRYSTALLIN 3 (OL3) >gnl|BL_ORD_I... 54 4e-06
gi|11514502|pdb|1F3B|A Chain A, Crystal Structure Of Mgsta1-1 In... 54 5e-06
gi|47604962|ref|NP_990743.1| glutathione transferase [Gallus gal... 54 5e-06
gi|30749486|pdb|1ML6|A Chain A, Crystal Structure Of Mgsta2-2 In... 53 6e-06
gi|47523158|ref|NP_999015.1| glutathione S-transferase [Sus scro... 53 6e-06
gi|38173961|gb|AAH61134.1| Unknown (protein for MGC:74264) [Mus ... 53 6e-06
gi|7110611|ref|NP_032207.1| glutathione S-transferase, alpha 1 (... 53 6e-06
gi|121712|sp|P13745|GTA1_MOUSE Glutathione S-transferase Ya chai... 53 6e-06
gi|624328|gb|AAB01055.1| S-crystallin 53 6e-06
gi|134280|sp|P27014|SC2_OCTVU S-crystallin 2 >gnl|BL_ORD_ID|1015... 53 6e-06
gi|2495111|sp|Q25626|SC3_OCTVU S-CRYSTALLIN 3 >gnl|BL_ORD_ID|170... 53 6e-06
gi|11514499|pdb|1F3A|A Chain A, Crystal Structure Of Mgsta1-1 In... 53 6e-06
gi|121710|sp|P10648|GTA2_MOUSE Glutathione S-transferase GT41A (... 53 6e-06
gi|121713|sp|P04903|GTA2_RAT Glutathione S-transferase Ya-2 (Lig... 53 6e-06
gi|39585029|emb|CAE62680.1| Hypothetical protein CBG06825 [Caeno... 53 6e-06
gi|16332351|emb|CAD01094.1| glutathione S-transferase [Xenopus l... 53 8e-06
gi|39583549|emb|CAE65653.1| Hypothetical protein CBG10717 [Caeno... 53 8e-06
gi|47523832|ref|NP_999554.1| glutathione S-transferase [Sus scro... 53 8e-06
gi|27720723|ref|XP_217195.1| similar to GLUTATHIONE S-TRANSFERAS... 53 8e-06
gi|20988789|gb|AAH30173.1| Gsta2 protein [Mus musculus] 53 8e-06
gi|121700|sp|P09792|GT28_SCHMA Glutathione S-transferase 28 kDa ... 52 1e-05
gi|50263046|ref|NP_032208.2| glutathione S-transferase, alpha 2 ... 52 1e-05
gi|32484222|gb|AAH54171.1| Gstm2-prov protein [Xenopus laevis] 52 1e-05
gi|7687909|gb|AAD42800.2| microsomal glutathione-S-transferase [... 52 1e-05
gi|5524944|emb|CAB50870.1| glutathione S-transferase [Ovis aries] 52 1e-05
gi|1170098|sp|P46409|GTMU_RABIT Glutathione S-transferase Mu 1 (... 51 2e-05
gi|2495106|sp|Q28035|GTA1_BOVIN Glutathione S-transferase alpha ... 51 2e-05
gi|1170095|sp|P46419|GTM1_DERPT Glutathione S-transferase (GST c... 51 3e-05
gi|38049405|ref|XP_136557.2| similar to class-alpha glutathione ... 51 3e-05
gi|28933457|ref|NP_803175.1| glutathione S-transferase, mu 2; gl... 51 3e-05
gi|3915723|sp|P31670|GT27_FASHE Glutathione S-transferase 26 kDa... 51 3e-05
gi|3402001|pdb|1FHE| Glutathione Transferase (Fh47) From Fascio... 50 4e-05
gi|232199|sp|P30114|GT28_SCHHA Glutathione S-transferase 28 kDa ... 50 4e-05
gi|47076115|emb|CAD90167.1| mu class glutathione S-transferase [... 50 4e-05
gi|4335859|gb|AAD17488.1| 28 kDa glutathione S-transferase; 28GS... 50 4e-05
gi|39588669|emb|CAE58193.1| Hypothetical protein CBG01287 [Caeno... 50 4e-05
gi|49169816|ref|NP_001001777.1| glutathione S-transferase [Gallu... 50 5e-05
gi|50744870|ref|XP_419913.1| PREDICTED: glutathione S-transferas... 50 5e-05
gi|33356830|pdb|1B4P|A Chain A, Crystal Structures Of Class Mu C... 50 5e-05
gi|34859224|ref|XP_234810.2| similar to GLUTATHIONE S-TRANSFERAS... 50 5e-05
gi|265545|gb|AAB25369.1| alpha-class glutathione S-transferase o... 50 5e-05
gi|39588668|emb|CAE58192.1| Hypothetical protein CBG01286 [Caeno... 50 5e-05
gi|17564840|ref|NP_503889.1| glutathione S-Transferase (gst-23) ... 50 5e-05
gi|2495107|sp|P80894|GTA1_ANTST Glutathione S-transferase (GST c... 49 9e-05
gi|10443248|emb|CAC10391.1| dJ214M20.3 (glutathione S-transferas... 49 9e-05
gi|4504173|ref|NP_001503.1| glutathione S-transferase A4; glutat... 49 9e-05
gi|34539115|gb|AAQ74441.1| glutathione S-transferase [Haemaphysa... 49 1e-04
gi|265539|gb|AAB25364.1| alpha-class glutathione S-transferase o... 49 1e-04
gi|384152|prf||1905266C glutathione S transferase:ISOTYPE=GST47 49 1e-04
gi|6671050|gb|AAF23078.1| glutathione S-transferase [Choristoneu... 49 1e-04
gi|232197|sp|P30112|GT26_FASHE GLUTATHIONE S-TRANSFERASE 26 KD 5... 49 1e-04
gi|159060|gb|AAA29140.1| mu-glutathione transferase [Fasciola he... 49 1e-04
gi|22671705|gb|AAN04481.1| glutathione S-transferase GSTP2-2 [Bu... 48 2e-04
gi|631017|pir||S43432 glutathione transferase (EC 2.5.1.18) alph... 48 2e-04
gi|49169814|ref|NP_001001776.1| glutathione S-transferase class-... 48 2e-04
gi|28076911|ref|NP_081040.1| glutathione S-transferase, mu 4; gl... 48 2e-04
gi|4322274|gb|AAD15991.1| glutathione S-transferase [Boophilus m... 48 3e-04
gi|34859803|ref|XP_215682.2| similar to glutathione transferase ... 48 3e-04
gi|423912|pir||A46143 mu-class glutathione S-transferase hGSTYBX... 48 3e-04
gi|232206|sp|P30116|GTMU_MESAU GLUTATHIONE S-TRANSFERASE (GST CL... 48 3e-04
gi|34874562|ref|XP_343546.1| similar to class-alpha glutathione ... 48 3e-04
gi|17553834|ref|NP_499006.1| glutathione S-Transferase, P subuni... 48 3e-04
gi|207692|gb|AAA42351.1| glutathione S-transferase Yb2 subunit 47 3e-04
gi|204499|gb|AAA41285.1| glutathione S-transferase Y-b subunit (... 47 3e-04
gi|21263652|sp|P83325|GTP2_BUFBU Glutathione S-transferase P 2 (... 47 3e-04
gi|624320|gb|AAA97550.1| S-crystallin 47 4e-04
gi|2147980|pir||S61363 prostaglandin-H E-isomerase chain H - Asc... 47 4e-04
gi|45382235|ref|NP_990149.1| glutathione S-transferase class-alp... 47 6e-04
gi|1943431|pdb|6GSU|A Chain A, First-Sphere And Second-Sphere El... 47 6e-04
gi|3915724|sp|P31671|GT28_FASHE GLUTATHIONE S-TRANSFERASE 26 KD ... 47 6e-04
gi|32346216|gb|AAN85429.1| glutathione-S-transferase [Pyrocystis... 47 6e-04
gi|624336|gb|AAB01059.1| S-crystallin 47 6e-04
gi|46329897|gb|AAH68854.1| Unknown (protein for IMAGE:3399306) [... 46 7e-04
gi|624312|gb|AAA97546.1| S-crystallin 46 7e-04
gi|34539117|gb|AAQ74442.1| glutathione S-transferase [Rhipicepha... 46 0.001
gi|384151|prf||1905266B glutathione S transferase:ISOTYPE=GST7 46 0.001
gi|3023918|sp|Q52828|GSTA_RHILE GSTA PROTEIN >gnl|BL_ORD_ID|1716... 46 0.001
gi|1254920|gb|AAB35901.1| prostaglandin-H E-isome=sigma-class gl... 46 0.001
gi|28461273|ref|NP_787019.1| glutathione S-transferase M1 [Bos t... 46 0.001
gi|159058|gb|AAA29139.1| mu-glutathione transferase [Fasciola he... 46 0.001
gi|1943433|pdb|6GSV|A Chain A, First-Sphere And Second-Sphere El... 45 0.001
gi|624324|gb|AAB01053.1| S-crystallin 45 0.001
gi|16264154|ref|NP_436946.1| putative glutathione S-transferase ... 45 0.001
gi|1943435|pdb|6GSW|A Chain A, First-Sphere And Second-Sphere El... 45 0.002
gi|29726512|pdb|1MTC|A Chain A, Glutathione Transferase Mutant Y... 45 0.002
gi|442967|pdb|1GSB|A Chain A, Glutathione S-Transferase (Isoenzy... 45 0.002
gi|204501|gb|AAA41286.1| glutathione S-transferase (EC 2.5.1.18) 45 0.002
gi|8393502|ref|NP_058710.1| glutathione S-transferase, mu 1; glu... 45 0.002
gi|477190|pir||A48388 glutathione S-transferase - liver fluke (f... 45 0.002
gi|13592152|ref|NP_112416.1| glutathione S-transferase, mu type ... 45 0.002
gi|8489487|gb|AAF75678.1| class mu glutathione S-transferase [Ca... 44 0.003
gi|121722|sp|P16413|GTMU_CAVPO Glutathione S-transferase B (GST ... 44 0.003
gi|46315840|ref|ZP_00216421.1| COG0625: Glutathione S-transferas... 44 0.003
gi|6980588|pdb|4GTU|A Chain A, Ligand-Free Homodimeric Human Glu... 44 0.004
gi|624322|gb|AAA97551.1| S-crystallin 44 0.004
gi|47205768|emb|CAF91521.1| unnamed protein product [Tetraodon n... 44 0.004
gi|4504179|ref|NP_000841.1| glutathione S-transferase M4 isoform... 44 0.004
gi|306817|gb|AAA57346.1| glutathione transferase M4 44 0.004
gi|6754084|ref|NP_034488.1| glutathione S-transferase, mu 1; glu... 44 0.004
gi|49532912|dbj|BAD26691.1| Glutathione S-transferase [Plutella ... 44 0.004
gi|1943397|pdb|6GSX|A Chain A, First-Sphere And Second-Sphere El... 44 0.005
gi|4115420|dbj|BAA36351.1| 24 kDa female-specific fat body prote... 44 0.005
gi|624310|gb|AAA97545.1| S-crystallin 44 0.005
gi|50400685|sp|Q9TSM5|GTM1_MACFA Glutathione S-transferase Mu 1 ... 44 0.005
gi|4574306|gb|AAD23997.1| glutathione S-transferase [Fasciola gi... 44 0.005
gi|47228894|emb|CAG09409.1| unnamed protein product [Tetraodon n... 44 0.005
gi|624330|gb|AAB01056.1| S-crystallin 43 0.006
gi|13936373|dbj|BAB47185.1| glutathione S-transferase subunit gY... 43 0.006
gi|31208169|ref|XP_313051.1| ENSANGP00000025279 [Anopheles gambi... 43 0.008
gi|4388948|pdb|5FWG|A Chain A, Tetra-(5-Fluorotryptophanyl)-Glut... 43 0.008
gi|624306|gb|AAA97543.1| S-crystallin 43 0.008
gi|204503|gb|AAA41287.1| glutathione S-transferase Yb-1 subunit ... 43 0.008
gi|306812|gb|AAA59203.1| glutathione transferase M1 >gnl|BL_ORD_... 43 0.008
gi|23504743|emb|CAD29477.1| glutathione transferase F4 [Triticum... 43 0.008
gi|31208167|ref|XP_313050.1| ENSANGP00000024808 [Anopheles gambi... 43 0.008
gi|50400626|sp|Q9BEA9|GTM3_MACFU Glutathione S-transferase Mu 3 ... 42 0.011
gi|624316|gb|AAA97548.1| S-crystallin 42 0.011
gi|39592078|emb|CAE75298.1| Hypothetical protein CBG23268 [Caeno... 42 0.011
gi|18858197|ref|NP_571809.1| glutathione S-transferase pi [Danio... 42 0.011
gi|23065552|ref|NP_000840.2| glutathione S-transferase M3; gluta... 42 0.014
gi|14250650|gb|AAH08790.1| Glutathione S-transferase M3 [Homo sa... 42 0.014
gi|106129|pir||A35295 glutathione transferase (EC 2.5.1.18) clas... 42 0.014
gi|4388890|pdb|1GTU|A Chain A, Ligand-Free Human Glutathione S-T... 42 0.014
gi|46129770|ref|ZP_00164357.2| COG0625: Glutathione S-transferas... 42 0.014
gi|5822511|pdb|3GTU|B Chain B, Ligand-Free Heterodimeric Human G... 42 0.014
gi|624332|gb|AAB01057.1| S-crystallin 42 0.014
gi|624326|gb|AAB01054.1| S-crystallin 42 0.014
gi|23065544|ref|NP_000552.2| glutathione S-transferase M1 isofor... 42 0.014
gi|21618868|gb|AAH31818.1| Gstm6 protein [Mus musculus] 42 0.014
gi|28828765|gb|AAO51360.1| hypothetical protein [Dictyostelium d... 42 0.018
gi|10120486|ref|NP_065415.1| glutathione S-transferase Yb4 gene ... 42 0.018
gi|422842|pir||S32425 glutathione transferase (EC 2.5.1.18) clas... 42 0.018
gi|11385459|gb|AAG34812.1| glutathione S-transferase GST 22 [Gly... 42 0.018
gi|41223420|gb|AAR99711.1| glutathione S-transferase [Mayetiola ... 41 0.024
gi|56330|emb|CAA25203.1| unnamed protein product [Rattus norvegi... 41 0.024
gi|22671702|gb|AAN04480.1| glutathione S-transferase GSTP1-1 [Bu... 41 0.024
gi|1353751|gb|AAB01781.1| glutathione S-transferase III homolog 41 0.024
gi|21263651|sp|P81942|GTP1_BUFBU Glutathione S-transferase P 1 (... 41 0.024
gi|6754086|ref|NP_034490.1| glutathione S-transferase, mu 5; glu... 41 0.031
gi|20138154|sp|O35660|GTM6_MOUSE Glutathione S-transferase Mu 6 ... 41 0.031
gi|34536838|gb|AAQ73932.1| GST-like hemolymph protein [Corcyra c... 41 0.031
gi|7110613|ref|NP_032210.1| glutathione S-transferase, mu 6; glu... 41 0.031
gi|15237931|ref|NP_197224.1| glutathione S-transferase, putative... 41 0.031
gi|38636658|dbj|BAD02978.1| glutathione S-transferase [Blepharis... 41 0.031
gi|3913799|sp|P56598|GT29_FASHE Glutathione S-transferase 26 kDa... 40 0.040
gi|1495235|emb|CAA96105.1| GSTD2 protein [Anopheles gambiae] 40 0.040
gi|4115418|dbj|BAA36350.1| 24 kDa female-specific fat body prote... 40 0.040
gi|28494710|ref|XP_289885.1| RIKEN cDNA 0610005A07 [Mus musculus... 40 0.040
gi|25282395|ref|NP_742035.1| glutathione-S-transferase, mu 5 [Ra... 40 0.053
gi|34914740|ref|NP_918717.1| putative glutathione S-transferase ... 40 0.053
gi|37361852|gb|AAQ91039.1| LRRGT00083 [Rattus norvegicus] 40 0.053
gi|14517793|gb|AAK64362.1| glutathione-S-transferase-like protei... 40 0.053
gi|11177841|gb|AAG32475.1| putative glutathione S-transferase Os... 40 0.053
gi|13516447|dbj|BAB40442.1| glutathione transferase M2 [Macaca f... 40 0.069
gi|20982640|ref|XP_159712.1| similar to glutathione transferase ... 40 0.069
gi|29250319|gb|EAA41815.1| GLP_111_55104_53896 [Giardia lamblia ... 40 0.069
gi|36959131|gb|AAQ87556.1| Glutathione S-transferase [Rhizobium ... 39 0.090
gi|15224582|ref|NP_180644.1| glutathione S-transferase, putative... 39 0.090
gi|33468899|ref|NP_034489.1| glutathione S-transferase, mu 3; gl... 39 0.090
gi|50400684|sp|Q9TSM4|GTM2_MACFA Glutathione S-transferase Mu 2 ... 39 0.090
gi|45548360|ref|ZP_00188393.1| COG0625: Glutathione S-transferas... 39 0.090
gi|193690|gb|AAA37748.1| glutathione transferase (EC 2.5.1.18) 39 0.090
gi|37525519|ref|NP_928863.1| hypothetical protein [Photorhabdus ... 39 0.12
gi|45518067|ref|ZP_00169618.1| COG0625: Glutathione S-transferas... 39 0.12
gi|46163851|ref|ZP_00204885.1| COG0625: Glutathione S-transferas... 39 0.12
gi|21956654|gb|AAL02369.3| class gamma glutathione S-transferase... 39 0.12
gi|2264324|gb|AAB63382.1| 28 kDa glutathione-S transferase 39 0.12
gi|28828399|gb|AAO51029.1| similar to Rattus norvegicus (Rat). G... 39 0.15
gi|23065557|ref|NP_671489.1| glutathione S-transferase M4 isofor... 39 0.15
gi|23065563|ref|NP_000842.2| glutathione S-transferase M5; gluta... 39 0.15
gi|1170097|sp|P46439|GTM5_HUMAN Glutathione S-transferase Mu 5 (... 39 0.15
gi|26987897|ref|NP_743322.1| glutathione S-transferase family pr... 39 0.15
gi|23016069|ref|ZP_00055829.1| COG0625: Glutathione S-transferas... 39 0.15
gi|22094809|gb|AAM91994.1| glutathione S-transferase GSTpi1 [Myt... 38 0.20
gi|20386063|gb|AAM21563.1| glutathione S-transferase [Nilaparvat... 38 0.20
gi|399829|sp|Q00285|GTMU_CRILO GLUTATHIONE S-TRANSFERASE Y1 (CHA... 38 0.20
gi|24215323|ref|NP_712804.1| glutathione transferase [Leptospira... 38 0.20
gi|2842717|sp|Q93112|GTT5_ANOGA GLUTATHIONE S-TRANSFERASE 1-5 (G... 38 0.20
gi|31208165|ref|XP_313049.1| ENSANGP00000011661 [Anopheles gambi... 38 0.20
gi|34865663|ref|XP_345686.1| similar to GLUTATHIONE S-TRANSFERAS... 38 0.20
gi|21450105|ref|NP_659118.1| cDNA sequence BC021614 [Mus musculu... 38 0.20
gi|46204955|ref|ZP_00049243.2| COG0625: Glutathione S-transferas... 38 0.20
gi|15598009|ref|NP_251503.1| probable glutathione S-transferase ... 38 0.26
gi|17944983|gb|AAL48554.1| RE03226p [Drosophila melanogaster] 38 0.26
gi|49079308|gb|AAT49878.1| PA2813 [synthetic construct] 38 0.26
gi|6625558|gb|AAF19264.1| glutathione S-transferase [Psoroptes o... 38 0.26
gi|15888177|ref|NP_353858.1| AGR_C_1530p [Agrobacterium tumefaci... 38 0.26
gi|37748321|gb|AAH58881.1| Glutathione S-transferase M5 [Homo sa... 38 0.26
gi|19114975|ref|NP_594063.1| putative glutathione S transferase ... 38 0.26
gi|38081896|ref|XP_124621.2| similar to Glutathione S-transferas... 38 0.26
gi|7511419|pir||T28102 hypothetical protein ZK930.3 - Caenorhabd... 38 0.26
gi|22218855|pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutat... 38 0.26
gi|46322289|ref|ZP_00222660.1| COG0625: Glutathione S-transferas... 38 0.26
gi|12853535|dbj|BAB29771.1| unnamed protein product [Mus musculus] 38 0.26
gi|46310731|ref|ZP_00211355.1| COG0625: Glutathione S-transferas... 38 0.26
gi|14334818|gb|AAK59587.1| putative elongation factor 1B gamma [... 38 0.26
gi|48105132|ref|XP_392997.1| similar to glutathione-S-transferas... 37 0.34
gi|10120620|pdb|1C72|A Chain A, Tyr115, Gln165 And Trp209 Contri... 37 0.34
gi|2981970|pdb|1GSU|A Chain A, An Avian Class-Mu Glutathione S-T... 37 0.34
gi|104677|pir||S18464 glutathione transferase (EC 2.5.1.18) mu2 ... 37 0.34
gi|46048786|ref|NP_990421.1| glutathione S-transferases CL2 [Gal... 37 0.34
gi|16126882|ref|NP_421446.1| glutathione S-transferase family pr... 37 0.34
gi|38047983|gb|AAR09894.1| similar to Drosophila melanogaster CG... 37 0.34
gi|15223649|ref|NP_176084.1| elongation factor 1B-gamma, putativ... 37 0.34
gi|18958499|gb|AAL82617.1| elongation factor 1-gamma [Glycine max] 37 0.34
gi|21537338|gb|AAM61679.1| In2-1 protein [Arabidopsis thaliana] 37 0.45
gi|15241956|ref|NP_195899.1| In2-1 protein, putative [Arabidopsi... 37 0.45
gi|24643530|ref|NP_728347.1| CG1702-PA [Drosophila melanogaster]... 37 0.45
gi|38049401|ref|XP_357096.1| similar to Glutathione S-transferas... 37 0.45
gi|46126843|ref|XP_387975.1| hypothetical protein FG07799.1 [Gib... 37 0.45
gi|24654975|ref|NP_611325.2| CG17524-PA [Drosophila melanogaster... 37 0.45
gi|34534082|dbj|BAC86900.1| unnamed protein product [Homo sapiens] 37 0.45
gi|1786091|gb|AAB41104.1| glutathione S-transferase I [Anopheles... 37 0.45
gi|46316963|ref|ZP_00217541.1| COG0625: Glutathione S-transferas... 37 0.58
gi|46164106|ref|ZP_00136569.2| COG0625: Glutathione S-transferas... 37 0.58
gi|27366941|ref|NP_762468.1| Glutathione S-transferase [Vibrio v... 37 0.58
gi|38174001|gb|AAH61226.1| Unknown (protein for MGC:74375) [Mus ... 37 0.58
gi|10443883|gb|AAG17625.1| glutathione transferase [Anopheles di... 37 0.58
gi|31194853|ref|XP_306374.1| ENSANGP00000014687 [Anopheles gambi... 37 0.58
gi|15965307|ref|NP_385660.1| PUTATIVE GLUTATHIONE S-TRANSFERASE ... 37 0.58
gi|1524316|emb|CAA68993.1| glutathione S-transferase [Petunia x ... 37 0.58
gi|45387463|gb|AAS60226.1| glutathione S-transferase pi [Mytilus... 36 0.76
gi|5107744|pdb|3FYG|A Chain A, Crystal Structure Of Tetradeca-(3... 36 0.76
gi|4557966|pdb|2GTU|A Chain A, Ligand-Free Human Glutathione S-T... 36 0.76
gi|494185|pdb|1HNA| Glutathione S-Transferase (Human, Class Mu)... 36 0.76
gi|37676718|ref|NP_937114.1| glutathione S-transferase [Vibrio v... 36 0.76
gi|11385467|gb|AAG34816.1| glutathione S-transferase GST 8 [Zea ... 36 0.76
gi|84594|pir||S14892 crystallin (clone pSl12) - Sloane's squid (... 36 0.76
gi|4504175|ref|NP_000839.1| glutathione S-transferase M2; glutat... 36 0.76
gi|25395983|pir||F88633 protein F56B3.10 [imported] - Caenorhabd... 36 0.76
gi|13470356|ref|NP_101922.1| glutathione S-transferase III [Meso... 36 0.76
gi|23619320|ref|NP_705282.1| elongation factor 1-gamma, putative... 36 0.99
gi|31937|emb|CAA40167.1| glutathione transferase [Homo sapiens] 36 0.99
gi|33090154|gb|AAP93882.1| glutathione S-transferase [Ixodes ric... 36 0.99
gi|46319524|ref|ZP_00219928.1| COG0625: Glutathione S-transferas... 35 1.3
gi|23065547|ref|NP_666533.1| glutathione S-transferase M1 isofor... 35 1.3
gi|7025464|gb|AAF35893.1| glutathione S-transferase GST-pi [Myti... 35 1.3
gi|39937374|ref|NP_949650.1| possible glutathione S-transferase ... 35 1.3
gi|13447444|gb|AAK26667.1| lens-specific S-crystallin [Eledone a... 35 1.3
gi|15601256|ref|NP_232887.1| glutathione S-transferase, putative... 35 1.3
gi|18280276|gb|AAL02368.1| class gamma glutathione S-transferase... 35 1.3
gi|26990448|ref|NP_745873.1| glutathione S-transferase family pr... 35 1.3
gi|46321474|ref|ZP_00221851.1| COG0625: Glutathione S-transferas... 35 1.7
gi|11385463|gb|AAG34814.1| glutathione S-transferase GST 24 [Gly... 35 1.7
gi|1170093|sp|P42769|GTH5_ARATH Glutathione S-transferase PM239X... 35 1.7
gi|31933|emb|CAA48636.1| glutathione S-transferase [Homo sapiens] 35 1.7
gi|2465439|gb|AAB72099.1| glutathione-dependent prostaglandin D ... 35 1.7
gi|18150415|gb|AAL61612.1| glutathione S-transferase [Allium cepa] 35 1.7
gi|34914786|ref|NP_918740.1| putative glutathione S-transferase ... 35 2.2
gi|11385457|gb|AAG34811.1| glutathione S-transferase GST 21 [Gly... 35 2.2
gi|20130115|ref|NP_611329.1| CG17531-PA [Drosophila melanogaster... 35 2.2
gi|25518742|pir||H86159 hypothetical protein F22D16.6 - Arabidop... 35 2.2
gi|34861384|ref|XP_215189.2| similar to hypothetical protein MGC... 35 2.2
gi|2738075|gb|AAB94639.1| glutathione S transferase-1 [Culicoide... 35 2.2
gi|50260616|gb|EAL23269.1| hypothetical protein CNBA3850 [Crypto... 35 2.2
gi|15218641|ref|NP_171793.1| glutathione S-transferase, putative... 35 2.2
gi|23504745|emb|CAD29478.1| glutathione transferase F5 [Triticum... 35 2.2
gi|15594494|ref|NP_212283.1| flagellar hook-associated protein 2... 35 2.2
gi|21483372|gb|AAM52661.1| LD04004p [Drosophila melanogaster] 35 2.2
gi|3201479|emb|CAA07071.1| glutathione S-transferase [Bombyx mori] 35 2.2
gi|461995|sp|P34715|EF1G_TRYCR Elongation factor 1-gamma (EF-1-g... 35 2.2
gi|31208161|ref|XP_313047.1| ENSANGP00000023440 [Anopheles gambi... 35 2.2
gi|46120432|ref|XP_385039.1| hypothetical protein FG04863.1 [Gib... 35 2.2
gi|16126324|ref|NP_420888.1| glutathione S-transferase [Caulobac... 35 2.2
gi|27820029|gb|AAL68213.2| GM08326p [Drosophila melanogaster] 34 2.9
gi|46518247|emb|CAD89618.1| omega class glutathione S-transferas... 34 2.9
gi|28901272|ref|NP_800927.1| putative glutathione S-transferase ... 34 2.9
gi|29654147|ref|NP_819839.1| glutathione S-transferase family pr... 34 2.9
gi|34495649|ref|NP_899864.1| probable glutathione transferase [C... 34 2.9
gi|48730584|ref|ZP_00264331.1| COG0625: Glutathione S-transferas... 34 2.9
gi|46322850|ref|ZP_00223217.1| COG0625: Glutathione S-transferas... 34 2.9
gi|46317869|ref|ZP_00218447.1| COG0625: Glutathione S-transferas... 34 2.9
gi|46315625|ref|ZP_00216207.1| COG0625: Glutathione S-transferas... 34 2.9
gi|17864592|ref|NP_524912.1| CG4181-PA [Drosophila melanogaster]... 34 2.9
gi|15967018|ref|NP_387371.1| PUTATIVE GLUTATHIONE S-TRANSFERASE ... 34 2.9
gi|21217741|gb|AAM34480.1| putative glutathione S-transferase [P... 34 2.9
gi|15224581|ref|NP_180643.1| glutathione S-transferase, putative... 34 2.9
gi|2462929|emb|CAA72973.1| glutathione transferase [Arabidopsis ... 34 2.9
gi|24654992|ref|NP_611330.2| CG17533-PA [Drosophila melanogaster... 34 2.9
gi|19335973|emb|CAD26834.1| putative glutathione S-transferase [... 34 2.9
gi|4581947|gb|AAB46369.3| putative glutathione transferase [Clon... 34 2.9
gi|478067|pir||D46681 glutathione transferase (EC 2.5.1.18) D21 ... 34 2.9
gi|47573146|ref|ZP_00243186.1| COG0625: Glutathione S-transferas... 34 3.8
gi|996128|pdb|1PCL| Pectate Lyase E (Pele) (E.C.4.2.2.2) 34 3.8
gi|15966690|ref|NP_387043.1| MALEYLACETOACETATE ISOMERASE (GLUTA... 34 3.8
gi|129759|sp|P04960|PELE_ERWCH Pectate lyase E precursor >gnl|BL... 34 3.8
gi|28871893|ref|NP_794512.1| glutathione S-transferase family pr... 34 3.8
gi|11133647|sp|Q9X4F7|MAAI_RHIME Maleylacetoacetate isomerase (M... 34 3.8
gi|121709|sp|P20137|GTS5_CHICK Glutathione S-transferase 5 (GST-... 34 3.8
gi|477946|pir||C46681 glutathione transferase (EC 2.5.1.18) D24 ... 34 3.8
gi|45549270|ref|NP_524914.3| CG12242-PA [Drosophila melanogaster... 34 3.8
gi|5880851|gb|AAD54938.1| glutathione s-transferase 6B [Musca do... 34 3.8
gi|24646251|ref|NP_650181.1| CG10091-PA [Drosophila melanogaster... 34 3.8
gi|4140283|emb|CAA10570.1| pectate lyase [Erwinia chrysanthemi] 34 3.8
gi|481821|pir||S39541 probable glutathione transferase (EC 2.5.1... 34 3.8
gi|15218640|ref|NP_171792.1| glutathione S-transferase, putative... 34 3.8
gi|129758|sp|P18209|PELD_ERWCH Pectate lyase D precursor >gnl|BL... 33 4.9
gi|48767403|ref|ZP_00271759.1| COG0625: Glutathione S-transferas... 33 4.9
gi|1335093|emb|CAA40168.1| glutathione transferase [Homo sapiens] 33 4.9
gi|2275021|emb|CAA04060.1| glutathione-S-transferase class M5 [M... 33 4.9
gi|34914756|ref|NP_918725.1| putative glutathione S-transferase ... 33 4.9
gi|15228853|ref|NP_191835.1| glutathione S-transferase, putative... 33 4.9
gi|3582502|gb|AAC35245.1| glutathione S-transferase isozyme 3 [P... 33 4.9
gi|41055963|ref|NP_956815.1| hypothetical protein MGC66350 [Dani... 33 4.9
gi|45507948|ref|ZP_00160289.1| COG0625: Glutathione S-transferas... 33 4.9
gi|46317080|ref|ZP_00217658.1| COG0625: Glutathione S-transferas... 33 6.4
gi|18158596|gb|AAL59658.1| glutathione S-transferase E1 [Anophel... 33 6.4
gi|31239111|ref|XP_319969.1| ENSANGP00000025069 [Anopheles gambi... 33 6.4
gi|17232062|ref|NP_488610.1| glutathione S-transferase [Nostoc s... 33 6.4
gi|16263606|ref|NP_436399.1| Gst13 glutathione S-transferase [Si... 33 6.4
gi|16767517|ref|NP_463132.1| putative glutathione S-transferase ... 33 6.4
gi|23504741|emb|CAD29476.1| glutathione transferase F3 [Triticum... 33 6.4
gi|34914744|ref|NP_918719.1| putative glutathione transferase [O... 33 6.4
gi|21464458|gb|AAM52032.1| RH47312p [Drosophila melanogaster] 33 6.4
gi|27752553|gb|AAO19738.1| glutathione S-transferase [Bactrocera... 33 6.4
gi|17737923|ref|NP_524326.1| CG10045-PA [Drosophila melanogaster... 33 6.4
gi|385883|gb|AAB26519.1| glutathione S-transferase D1, DmGST1 {E... 33 6.4
gi|19922528|ref|NP_611324.1| CG17523-PA [Drosophila melanogaster... 33 8.4
gi|23504739|emb|CAD29475.1| glutathione transferase F2 [Triticum... 33 8.4
gi|16263756|ref|NP_436548.1| putative glutathione S-transferase ... 33 8.4
gi|729399|sp|P40921|EF1G_SCHPO Elongation factor 1-gamma (EF-1-g... 33 8.4
gi|19115792|ref|NP_594880.1| elongation factor 1-gamma [Schizosa... 33 8.4
gi|16762948|ref|NP_458565.1| putative glutathione S transferase ... 33 8.4
gi|48766236|ref|ZP_00270786.1| COG0625: Glutathione S-transferas... 33 8.4
gi|23002405|ref|ZP_00046082.1| COG1804: Predicted acyl-CoA trans... 33 8.4
>gi|32564842|ref|NP_741061.2| glutathione S-Transferase (gst-35)
[Caenorhabditis elegans]
gi|26251563|gb|AAM19064.2| Hypothetical protein Y1H11.2
[Caenorhabditis elegans]
Length = 218
Score = 387 bits (993), Expect = e-106
Identities = 203/251 (80%), Positives = 203/251 (80%)
Frame = -1
Query: 756 MPSYKLTYFDIRAFAEPARMLFHLGGVPFEDARMPTDDIVPGIQSDQFLALKEKFAGKAA 577
MPSYKLTYFDIRAFAEPARMLFHLGGVPFEDARMPTDDIVPGIQSDQFLALKEK
Sbjct: 1 MPSYKLTYFDIRAFAEPARMLFHLGGVPFEDARMPTDDIVPGIQSDQFLALKEK------ 54
Query: 576 SCRKLLNFNFKWQTCTHPINVPTSLKKTPFGRFPILEFDGFKIAQSAAIQRYLARKFGFA 397
TPFGRFPILEFDGFKIAQSAAIQRYLARKFGFA
Sbjct: 55 ---------------------------TPFGRFPILEFDGFKIAQSAAIQRYLARKFGFA 87
Query: 396 GKTPEEEAYADSIVDQMKEYIESFRPVLYAQKSGKPEEEVKKIHDDVYIPAXXXXXXXXX 217
GKTPEEEAYADSIVDQMKEYIESFRPVLYAQKSGKPEEEVKKIHDDVYIPA
Sbjct: 88 GKTPEEEAYADSIVDQMKEYIESFRPVLYAQKSGKPEEEVKKIHDDVYIPAKNNLIKILN 147
Query: 216 XXXXXXKSGFLVGNGLTYADLVVADHMFTLSNIKELDSEDPTHKILKDFQEKIYGLPELK 37
KSGFLVGNGLTYADLVVADHMFTLSNIKELDSEDPTHKILKDFQEKIYGLPELK
Sbjct: 148 RLLKDNKSGFLVGNGLTYADLVVADHMFTLSNIKELDSEDPTHKILKDFQEKIYGLPELK 207
Query: 36 DYIKNRPERDM 4
DYIKNRPERDM
Sbjct: 208 DYIKNRPERDM 218