Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y22F5A_4
(705 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|7509477|pir||T26553 hypothetical protein Y22F5A.3 - Caenorhab... 472 e-132
gi|39593308|emb|CAE64778.1| Hypothetical protein CBG09569 [Caeno... 461 e-129
gi|32567202|ref|NP_505641.2| SNAP-25 (23.1 kD) (5K742) [Caenorha... 379 e-104
gi|20336352|gb|AAM18191.1| SNAP25 fusion protein [Loligo pealei] 257 1e-67
gi|1923252|gb|AAC47499.1| SNAP-25 homolog [Hirudo medicinalis] 250 2e-65
gi|29378329|gb|AAO83846.1| synaptosomal-associated 25 protein is... 240 2e-62
gi|548941|sp|P36975|SN25_DROME Synaptosomal-associated protein 2... 236 3e-61
gi|3822409|gb|AAC69874.1| synaptosome-associated protein SNAP-25... 236 4e-61
gi|31242623|ref|XP_321742.1| ENSANGP00000016880 [Anopheles gambi... 233 4e-60
gi|31242625|ref|XP_321743.1| ENSANGP00000024103 [Anopheles gambi... 232 6e-60
gi|27263173|dbj|BAC45226.1| synaptosome-associated protein of 25... 231 1e-59
gi|17737875|ref|NP_524298.1| CG9474-PA [Drosophila melanogaster]... 230 2e-59
gi|47551151|ref|NP_999754.1| ovarian synaptosome-associated prot... 226 3e-58
gi|2707818|gb|AAC35867.1| synaptosomal-associated protein 25 [St... 224 2e-57
gi|27263171|dbj|BAC45225.1| synaptosome-associated protein of 25... 224 2e-57
gi|48096033|ref|XP_394588.1| similar to ENSANGP00000016880 [Apis... 220 2e-56
gi|6755588|ref|NP_035558.1| synaptosomal-associated protein 25; ... 212 7e-54
gi|18765733|ref|NP_003072.2| synaptosomal-associated protein 25 ... 212 7e-54
gi|40555928|emb|CAF04071.1| synaptosomal-associated protein 25 [... 208 1e-52
gi|548943|sp|P36977|SN2A_CARAU Synaptosomal-associated protein 2... 206 5e-52
gi|27448107|gb|AAO13788.1| SNAP25a [Xenopus laevis] 203 3e-51
gi|41281621|ref|NP_571510.1| synaptosome-associated protein 25a;... 203 3e-51
gi|27448109|gb|AAO13789.1| SNAP25b [Xenopus laevis] >gnl|BL_ORD_... 202 4e-51
gi|22035899|dbj|BAC06591.1| SNAP-23 [Xenopus laevis] 202 4e-51
gi|548942|sp|P36976|SN25_TORMA Synaptosomal-associated protein 2... 202 7e-51
gi|37589647|gb|AAH59439.1| Snap25a protein [Danio rerio] 202 7e-51
gi|548945|sp|P36978|SN2B_CARAU Synaptosomal-associated protein 2... 201 2e-50
gi|37589801|gb|AAH59469.1| Synaptosome-associated protein 25 b [... 200 3e-50
gi|18859395|ref|NP_571509.1| synaptosome-associated protein 25 b... 197 1e-49
gi|50748211|ref|XP_421159.1| PREDICTED: similar to syndet [Gallu... 197 2e-49
gi|481202|pir||S38308 SNAP-25 protein - chicken 193 3e-48
gi|481203|pir||S38309 SNAP-25 protein - chicken 193 3e-48
gi|41055690|ref|NP_956484.1| similar to synaptosomal-associated ... 193 3e-48
gi|1314854|gb|AAA99825.1| SNAP-25a 192 7e-48
gi|1314856|gb|AAA99826.1| SNAP-25b 191 2e-47
gi|12083641|ref|NP_073180.1| synaptosomal-associated protein, 23... 189 4e-47
gi|6678049|ref|NP_033248.1| synaptosomal-associated protein 23; ... 189 5e-47
gi|2253401|gb|AAB62932.1| 23kDa synaptosomal associated protein ... 187 2e-46
gi|3822411|gb|AAC69875.1| synaptosome-associated protein SNAP-25... 181 2e-44
gi|12856489|dbj|BAB30686.1| unnamed protein product [Mus musculus] 181 2e-44
gi|18765729|ref|NP_003816.2| synaptosomal-associated protein 23 ... 177 1e-43
gi|1374813|gb|AAC50537.1| SNAP-23 177 1e-43
gi|30584081|gb|AAP36289.1| Homo sapiens synaptosomal-associated ... 177 1e-43
gi|47222711|emb|CAG00145.1| unnamed protein product [Tetraodon n... 174 2e-42
gi|42602167|gb|AAS21684.1| SNAP-25b [Taeniopygia guttata] 171 1e-41
gi|3822413|gb|AAC69876.1| synaptosome-associated protein SNAP-25... 170 3e-41
gi|40557620|gb|AAR88103.1| synaptosomal-associated protein [Taen... 168 1e-40
gi|47221200|emb|CAG13136.1| unnamed protein product [Tetraodon n... 163 3e-39
gi|29841236|gb|AAP06268.1| similar to GenBank Accession Number U... 149 4e-35
gi|10801642|dbj|BAB16738.1| hypothetical protein [Macaca fascicu... 146 5e-34
gi|18765731|ref|NP_570710.1| synaptosomal-associated protein 23 ... 144 2e-33
gi|3822415|gb|AAC69877.1| synaptosome-associated protein SNAP-25... 127 2e-28
gi|23193172|gb|AAN14409.1| SNAP-23 isoform A [Oryctolagus cunicu... 124 2e-27
gi|3822417|gb|AAC69878.1| synaptosome-associated protein SNAP-25... 122 9e-27
gi|47220910|emb|CAG03117.1| unnamed protein product [Tetraodon n... 120 3e-26
gi|3703098|gb|AAC64289.1| synaptosome-associated protein 25.1 [D... 120 3e-26
gi|22219198|pdb|1L4A|D Chain D, X-Ray Structure Of The Neuronal ... 115 9e-25
gi|24740601|emb|CAD56158.1| dJ1068F16.2.5 (Synaptosomal-associat... 108 1e-22
gi|13375134|emb|CAC34535.1| dJ1068F16.2.2 (Synaptosomal-associat... 99 8e-20
gi|6729812|pdb|1SFC|D Chain D, Neuronal Synaptic Fusion Complex ... 99 8e-20
gi|22219197|pdb|1L4A|C Chain C, X-Ray Structure Of The Neuronal ... 97 2e-19
gi|47220909|emb|CAG03116.1| unnamed protein product [Tetraodon n... 96 9e-19
gi|6729811|pdb|1SFC|C Chain C, Neuronal Synaptic Fusion Complex ... 93 5e-18
gi|17942821|pdb|1JTH|A Chain A, Crystal Structure And Biophysica... 92 1e-17
gi|47216449|emb|CAG02100.1| unnamed protein product [Tetraodon n... 91 2e-17
gi|27574129|pdb|1N7S|C Chain C, High Resolution Structure Of A T... 89 7e-17
gi|20150811|pdb|1KIL|C Chain C, Three-Dimensional Structure Of T... 85 2e-15
gi|34850011|gb|AAA82433.2| Hypothetical protein T14G12.2 [Caenor... 84 4e-15
gi|20150812|pdb|1KIL|D Chain D, Three-Dimensional Structure Of T... 83 6e-15
gi|27574130|pdb|1N7S|D Chain D, High Resolution Structure Of A T... 83 6e-15
gi|34866241|ref|XP_345692.1| similar to synaptosomal-associated ... 80 5e-14
gi|17569831|ref|NP_508641.1| predicted CDS, synaptosomal-associa... 75 1e-12
gi|15222976|ref|NP_172842.1| SNAP25 homologous protein, putative... 74 3e-12
gi|50756211|ref|XP_415061.1| PREDICTED: similar to synaptosomal-... 72 1e-11
gi|15240163|ref|NP_200929.1| SNAP25 homologous protein SNAP33 (S... 72 1e-11
gi|21553460|gb|AAM62553.1| snap25a [Arabidopsis thaliana] 72 1e-11
gi|39585097|emb|CAE62748.1| Hypothetical protein CBG06912 [Caeno... 71 2e-11
gi|15241436|ref|NP_196405.1| SNAP25 homologous protein, putative... 70 4e-11
gi|17554000|ref|NP_498940.1| synaptosomal-associated protein 2 (... 67 3e-10
gi|630670|pir||S44837 K02D10.1 protein - Caenorhabditis elegans 67 3e-10
gi|45360631|ref|NP_988988.1| hypothetical protein MGC75781 [Xeno... 66 6e-10
gi|49388321|dbj|BAD25433.1| putative SNAP25 [Oryza sativa (japon... 66 6e-10
gi|50254745|gb|EAL17491.1| hypothetical protein CNBM1830 [Crypto... 66 6e-10
gi|27371251|gb|AAH41208.1| Snap29-prov protein [Xenopus laevis] 64 2e-09
gi|30584569|gb|AAP36537.1| Homo sapiens synaptosomal-associated ... 62 1e-08
gi|3703102|gb|AAC64291.1| synaptosome-associated protein 25.2 [D... 61 3e-08
gi|4759154|ref|NP_004773.1| synaptosomal-associated protein 29; ... 61 3e-08
gi|49072430|ref|XP_400504.1| hypothetical protein UM02889.1 [Ust... 60 4e-08
gi|46435881|gb|EAK95254.1| hypothetical protein CaO19.117 [Candi... 60 6e-08
gi|46435575|gb|EAK94954.1| hypothetical protein CaO19.7764 [Cand... 60 6e-08
gi|32308074|gb|AAP79417.1| SNAP-34 [Hordeum vulgare subsp. vulgare] 58 2e-07
gi|17737503|ref|NP_523831.1| CG11173-PA [Drosophila melanogaster... 57 3e-07
gi|30749614|pdb|1NHL|A Chain A, Snap-23n Structure 57 4e-07
gi|7769720|gb|AAF69517.1| SNAP-29 protein [Rattus norvegicus] 55 1e-06
gi|31543752|ref|NP_075837.2| GS32 protein [Mus musculus] >gnl|BL... 55 1e-06
gi|46397022|sp|Q9ERB0|SN29_MOUSE Synaptosomal-associated protein... 55 2e-06
gi|31543750|ref|NP_446262.2| synaptosomal-associated protein, 29... 54 2e-06
gi|32308076|gb|AAP79418.1| SNAP-28 [Hordeum vulgare subsp. vulgare] 54 2e-06
gi|47226679|emb|CAG07838.1| unnamed protein product [Tetraodon n... 54 3e-06
gi|50553382|ref|XP_504102.1| hypothetical protein [Yarrowia lipo... 54 3e-06
gi|6321446|ref|NP_011523.1| Putative t-SNARE of the plasma membr... 53 5e-06
gi|19113435|ref|NP_596643.1| putative vesicular protein transpor... 53 5e-06
gi|23619154|ref|NP_705116.1| hypothetical protein [Plasmodium fa... 52 1e-05
gi|50425173|ref|XP_461178.1| unnamed protein product [Debaryomyc... 50 3e-05
gi|3860236|gb|AAC73007.1| synaptosome associated protein 25,2 [D... 45 0.001
gi|39597785|emb|CAE68477.1| Hypothetical protein CBG14277 [Caeno... 44 0.004
gi|33860106|sp||P55820_1 [Segment 1 of 4] Synaptosomal-associate... 42 0.016
gi|49089962|ref|XP_406556.1| hypothetical protein AN2419.2 [Aspe... 40 0.035
gi|18309260|ref|NP_561194.1| conserved hypothetical protein [Clo... 40 0.046
gi|46108952|ref|XP_381534.1| hypothetical protein FG01358.1 [Gib... 40 0.060
gi|3860235|gb|AAC73006.1| synaptosome-associated protein 25.2 [D... 38 0.18
gi|32308078|gb|AAP79419.1| SNAP25-like protein C [Hordeum vulgar... 38 0.23
gi|6644143|gb|AAF20922.1| culmination specific protein 37D [Dict... 37 0.30
gi|49471731|gb|AAT66145.1| MlpD precursor [Mycoplasma arthritidis] 37 0.30
gi|50407033|ref|XP_456681.1| unnamed protein product [Debaryomyc... 37 0.30
gi|49471747|gb|AAT66150.1| MlpD precursor [Mycoplasma arthritidis] 37 0.30
gi|1174752|sp|P42636|TPM1_BIOGL Tropomyosin 1 (TMI) (Bg 39) >gnl... 37 0.39
gi|47717352|gb|AAR97566.1| frizzled-8 associated multidomain pro... 37 0.51
gi|33595812|ref|NP_883455.1| magnesium and cobalt efflux protein... 36 0.67
gi|33592181|ref|NP_879825.1| magnesium and cobalt efflux protein... 36 0.67
gi|5790208|dbj|BAA83536.1| NADH dehydrogenase subunit 2 [Taenia ... 36 0.87
gi|19114097|ref|NP_593185.1| putative protein transport protein ... 36 0.87
gi|46228494|gb|EAK89364.1| coiled coil protein [Cryptosporidium ... 35 1.1
gi|46131660|ref|ZP_00170018.2| COG0840: Methyl-accepting chemota... 35 1.5
gi|46402107|ref|YP_006601.1| Gp21 [Bacteriophage phiKO2] >gnl|BL... 35 1.5
gi|46433832|gb|EAK93260.1| hypothetical protein CaO19.8773 [Cand... 35 1.5
gi|46433677|gb|EAK93109.1| hypothetical protein CaO19.1182 [Cand... 35 1.5
gi|7271034|emb|CAB77652.1| hypothetical protein [Candida albicans] 35 1.5
gi|50302975|ref|XP_451425.1| unnamed protein product [Kluyveromy... 35 1.9
gi|4468222|emb|CAB38043.1| pseudo-hemocyanin [Homarus americanus] 35 1.9
gi|4468220|emb|CAB38042.1| pseudo-hemocyanin [Homarus americanus] 35 1.9
gi|50732309|ref|XP_418574.1| PREDICTED: similar to Kinesin heavy... 35 1.9
gi|19114943|ref|NP_594031.1| aconitate hydratase [Schizosaccharo... 34 2.5
gi|15669512|ref|NP_248322.1| purine NTPase [Methanocaldococcus j... 34 2.5
gi|48716646|dbj|BAD23314.1| syntaxin 71 (SYP71)-like protein [Or... 34 2.5
gi|28829248|gb|AAM08764.2| similar to Plasmodium falciparum (iso... 34 2.5
gi|15217810|ref|NP_176681.1| expressed protein [Arabidopsis thal... 34 3.3
gi|25404512|pir||F96673 hypothetical protein F13O11.30 [imported... 34 3.3
gi|11466494|ref|NP_038197.1| ATP synthase F0 subunit 6 [Chrysodi... 34 3.3
gi|730976|sp|Q07068|TPM1_CIOIN Tropomyosin, smooth muscle/fibrob... 33 4.3
gi|50732499|ref|XP_418664.1| PREDICTED: similar to BET1 homolog ... 33 4.3
gi|46322750|ref|ZP_00223118.1| COG0840: Methyl-accepting chemota... 33 4.3
gi|24582370|ref|NP_609083.1| CG18304-PA [Drosophila melanogaster... 33 4.3
gi|46310707|ref|ZP_00211333.1| COG0840: Methyl-accepting chemota... 33 4.3
gi|23125868|ref|ZP_00107785.1| COG0367: Asparagine synthase (glu... 33 4.3
gi|42559691|sp|Q9GZ69|TPM_MIMNO Tropomyosin >gnl|BL_ORD_ID|92364... 33 5.6
gi|9626608|ref|NP_040898.1| putative E1 ORF [Human papillomaviru... 33 5.6
gi|17566400|ref|NP_507294.1| putative protein family member, wit... 33 5.6
gi|50878427|gb|AAT85201.1| unknown protein [Oryza sativa (japoni... 33 5.6
gi|31207717|ref|XP_312825.1| ENSANGP00000021496 [Anopheles gambi... 33 5.6
gi|50344904|ref|NP_001002124.1| zgc:86785 [Danio rerio] >gnl|BL_... 33 5.6
gi|49328025|gb|AAT58726.1| putative syntaxin 71 (SYP71) [Oryza s... 33 5.6
gi|9631254|ref|NP_048035.1| large tegument protein [Ateline herp... 33 5.6
gi|17556811|ref|NP_498105.1| syntaxin 16 (38.1 kD) (3G298) [Caen... 33 7.4
gi|15616217|ref|NP_244522.1| BH3655~unknown conserved protein in... 33 7.4
gi|25395740|pir||H88451 protein ZC155.3 [imported] - Caenorhabdi... 33 7.4
gi|423281|pir||S32362 SNAP receptor - bovine 33 7.4
gi|11267135|pir||T46719 probable vacuolar ATPase (EC 3.6.1.-) pr... 33 7.4
gi|6752405|gb|AAF27713.1| PspA [Streptococcus pneumoniae] 33 7.4
gi|29250661|gb|EAA42151.1| GLP_480_43569_42100 [Giardia lamblia ... 33 7.4
gi|46907304|ref|YP_013693.1| N-acetylmuramoyl-L-alanine amidase,... 33 7.4
gi|23957777|ref|NP_473326.2| hypothetical protein [Plasmodium fa... 33 7.4
gi|34896946|ref|NP_909819.1| putative vesicle soluble NSF attach... 33 7.4
gi|23484032|gb|EAA19506.1| hypothetical protein [Plasmodium yoel... 32 9.6
gi|18398623|ref|NP_566354.1| syntaxin 71 (SYP71) [Arabidopsis th... 32 9.6
gi|15644384|ref|NP_229436.1| conserved hypothetical protein [The... 32 9.6
gi|39588346|emb|CAE72697.1| Hypothetical protein CBG19921 [Caeno... 32 9.6
gi|47091875|ref|ZP_00229669.1| N-acetylmuramoyl-L-alanine amidas... 32 9.6
gi|47219637|emb|CAG02682.1| unnamed protein product [Tetraodon n... 32 9.6
gi|18308026|gb|AAL67804.1| pneumococcal surface protein A [Strep... 32 9.6
gi|27804872|gb|AAO22907.1| adventurous gliding motility protein ... 32 9.6
gi|39588347|emb|CAE72698.1| Hypothetical protein CBG19922 [Caeno... 32 9.6
gi|25453232|sp|O61308|PUMA_PARUN 227 kDa spindle- and centromere... 32 9.6
gi|4235504|gb|AAD13233.1| NADH dehydrogenase subunit 2 [Cyprinel... 32 9.6
>gi|7509477|pir||T26553 hypothetical protein Y22F5A.3 -
Caenorhabditis elegans
Length = 234
Score = 472 bits (1215), Expect = e-132
Identities = 234/234 (100%), Positives = 234/234 (100%)
Frame = -1
Query: 705 MSARRGAPGGQRHPRPYAVEPTVDINGLVLPADMSDELKGLNVGIDEKTIESLESTRRML 526
MSARRGAPGGQRHPRPYAVEPTVDINGLVLPADMSDELKGLNVGIDEKTIESLESTRRML
Sbjct: 1 MSARRGAPGGQRHPRPYAVEPTVDINGLVLPADMSDELKGLNVGIDEKTIESLESTRRML 60
Query: 525 ALCEESKEAGIKTLVMLDDQGEQLERCEGALDTINQDMKEAEDHLKGMEKCCGLCVLPWN 346
ALCEESKEAGIKTLVMLDDQGEQLERCEGALDTINQDMKEAEDHLKGMEKCCGLCVLPWN
Sbjct: 61 ALCEESKEAGIKTLVMLDDQGEQLERCEGALDTINQDMKEAEDHLKGMEKCCGLCVLPWN 120
Query: 345 KTDDFEKTEFAKAWKKDDDGGVISDQPRITVGDSSMGPQGGYITKITNDAREDEMDENVQ 166
KTDDFEKTEFAKAWKKDDDGGVISDQPRITVGDSSMGPQGGYITKITNDAREDEMDENVQ
Sbjct: 121 KTDDFEKTEFAKAWKKDDDGGVISDQPRITVGDSSMGPQGGYITKITNDAREDEMDENVQ 180
Query: 165 QVSTMVGNLRNMAIDMSTEVSNQNRQLDRIHDKAQSNEVRVESANKRAKNLITK 4
QVSTMVGNLRNMAIDMSTEVSNQNRQLDRIHDKAQSNEVRVESANKRAKNLITK
Sbjct: 181 QVSTMVGNLRNMAIDMSTEVSNQNRQLDRIHDKAQSNEVRVESANKRAKNLITK 234