Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y24D9A_4
(798 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|32565827|ref|NP_741371.2| ribosomal protein L7Ae/L30e/S12e/Ga... 446 e-124
gi|32565833|ref|NP_741372.2| ribosomal protein L7Ae/L30e/S12e/Ga... 439 e-122
gi|39587585|emb|CAE58523.1| Hypothetical protein CBG01675 [Caeno... 426 e-118
gi|22758896|gb|AAN05607.1| ribosomal protein L7a [Argopecten irr... 298 9e-80
gi|47219849|emb|CAF97119.1| unnamed protein product [Tetraodon n... 288 7e-77
gi|50368683|gb|AAH76693.1| Unknown (protein for IMAGE:6983424) [... 288 7e-77
gi|6094094|sp|O57592|RL7A_FUGRU 60S RIBOSOMAL PROTEIN L7A (SURFE... 287 2e-76
gi|41152461|ref|NP_956341.1| Unknown (protein for MGC:73183); wu... 286 4e-76
gi|48105889|ref|XP_393034.1| similar to 60S ribosomal protein L7... 285 6e-76
gi|49255981|gb|AAH72834.1| Unknown (protein for MGC:80199) [Xeno... 285 1e-75
gi|22001918|sp|Q90YW2|RL7A_ICTPU 60S ribosomal protein L7a >gnl|... 283 4e-75
gi|417673|sp|P32429|RL7A_CHICK 60S RIBOSOMAL PROTEIN L7A >gnl|BL... 281 1e-74
gi|4506661|ref|NP_000963.1| ribosomal protein L7a; 60S ribosomal... 281 1e-74
gi|38076243|ref|XP_194077.2| similar to Rpl7a protein [Mus muscu... 281 1e-74
gi|34853132|ref|XP_216024.2| similar to 60S ribosomal protein L7... 281 1e-74
gi|7305443|ref|NP_038749.1| ribosomal protein L7a; surfeit 3 [Mu... 280 2e-74
gi|30410942|gb|AAH52339.1| Rpl7a protein [Mus musculus] 280 2e-74
gi|38077045|ref|XP_193790.3| similar to Rpl7a protein [Mus muscu... 280 3e-74
gi|50757237|ref|XP_415441.1| PREDICTED: similar to ribosomal pro... 280 3e-74
gi|40796182|gb|AAH65176.1| Ribosomal protein L7a [Mus musculus] 278 7e-74
gi|38074412|ref|XP_193712.2| similar to Rpl7a protein [Mus muscu... 276 3e-73
gi|42661404|ref|XP_371115.2| similar to 60S ribosomal protein L7... 274 2e-72
gi|1173062|sp|P46223|RL7A_DROME 60S RIBOSOMAL PROTEIN L7A >gnl|B... 273 2e-72
gi|38074125|ref|XP_129602.2| similar to Rpl7a protein [Mus muscu... 273 2e-72
gi|17530825|ref|NP_511063.1| CG3314-PD [Drosophila melanogaster]... 273 3e-72
gi|28630269|gb|AAN73362.1| ribosomal protein L7A [Petromyzon mar... 271 2e-71
gi|38090038|ref|XP_194479.2| similar to Rpl7a protein [Mus muscu... 271 2e-71
gi|28630267|gb|AAN73361.1| ribosomal protein L7A [Myxine glutinosa] 270 2e-71
gi|44969357|gb|AAS49604.1| ribosomal protein L7a [Xenopus laevis] 270 2e-71
gi|38086011|ref|XP_145422.3| similar to Rpl7a protein [Mus muscu... 270 3e-71
gi|38077734|ref|XP_193786.2| similar to Rpl7a protein [Mus muscu... 270 3e-71
gi|38090471|ref|XP_193559.2| similar to Rpl7a protein [Mus muscu... 269 4e-71
gi|31215306|ref|XP_316000.1| ENSANGP00000025329 [Anopheles gambi... 268 8e-71
gi|34932126|ref|XP_225910.2| similar to Rpl7a protein [Rattus no... 266 3e-70
gi|38081084|ref|XP_194250.2| similar to Rpl7a protein [Mus muscu... 266 3e-70
gi|38081729|ref|XP_123009.2| similar to Rpl7a protein [Mus muscu... 266 4e-70
gi|38075104|ref|XP_193745.2| similar to Rpl7a protein [Mus muscu... 266 4e-70
gi|21070334|gb|AAM34260.1| ribosomal protein L7a [Equus caballus] 264 1e-69
gi|38083884|ref|XP_193900.2| similar to Rpl7a protein [Mus muscu... 263 3e-69
gi|2119113|pir||A57416 ribosomal protein L7a, cytosolic - fruit ... 263 4e-69
gi|6094093|sp|O76732|RL7A_ANOGA 60S RIBOSOMAL PROTEIN L7A >gnl|B... 262 7e-69
gi|38084000|ref|XP_195874.2| similar to Rpl7a protein [Mus muscu... 261 1e-68
gi|38090205|ref|XP_146939.2| similar to Rpl7a protein [Mus muscu... 254 2e-66
gi|34876404|ref|XP_225356.2| similar to 60S ribosomal protein L7... 253 4e-66
gi|20916537|ref|XP_145287.1| similar to Rpl7a protein [Mus muscu... 253 4e-66
gi|38074344|ref|XP_122526.2| similar to Rpl7a protein [Mus muscu... 252 6e-66
gi|34877120|ref|XP_237243.2| similar to 60S ribosomal protein L7... 250 3e-65
gi|38079846|ref|XP_283336.2| similar to 60S ribosomal protein L7... 249 4e-65
gi|34876134|ref|XP_224540.2| similar to Rpl7a protein [Rattus no... 249 5e-65
gi|46435436|gb|EAK94817.1| hypothetical protein CaO19.2311 [Cand... 248 8e-65
gi|49096394|ref|XP_409657.1| hypothetical protein AN5520.2 [Aspe... 248 8e-65
gi|46445079|gb|EAL04350.1| hypothetical protein CaO19.13423 [Can... 248 1e-64
gi|28529810|ref|XP_142235.2| similar to Rpl7a protein [Mus muscu... 247 2e-64
gi|46128201|ref|XP_388654.1| conserved hypothetical protein [Gib... 246 4e-64
gi|34881233|ref|XP_223048.2| similar to 60S ribosomal protein L7... 243 3e-63
gi|34881204|ref|XP_223019.2| similar to Rpl7a protein [Rattus no... 243 3e-63
gi|34857833|ref|XP_218912.2| similar to Rpl7a protein [Rattus no... 243 3e-63
gi|37550862|ref|XP_291698.2| similar to Rpl7a protein [Homo sapi... 241 1e-62
gi|27668685|ref|XP_220286.1| similar to 60S ribosomal protein L7... 241 1e-62
gi|34854408|ref|XP_226847.2| similar to Rpl7a protein [Rattus no... 241 2e-62
gi|38088142|ref|XP_357823.1| similar to Rpl7a protein [Mus muscu... 241 2e-62
gi|38104259|gb|EAA50853.1| hypothetical protein MG04612.4 [Magna... 240 2e-62
gi|32407074|ref|XP_324136.1| hypothetical protein [Neurospora cr... 240 3e-62
gi|34859492|ref|XP_230768.2| similar to 60S ribosomal protein L7... 239 4e-62
gi|2274801|dbj|BAA21551.1| ribosomal protein L4 [Schizosaccharom... 239 5e-62
gi|50286857|ref|XP_445858.1| unnamed protein product [Candida gl... 239 5e-62
gi|19112624|ref|NP_595832.1| 60s ribosomal protein L7a (L8) [Sch... 239 5e-62
gi|50420897|ref|XP_458989.1| unnamed protein product [Debaryomyc... 239 6e-62
gi|172444|gb|AAA20990.1| ribosomal protein L4 238 8e-62
gi|34860892|ref|XP_230930.2| similar to 60S ribosomal protein L7... 238 1e-61
gi|45185618|ref|NP_983334.1| ACL070Cp [Eremothecium gossypii] >g... 237 2e-61
gi|50416984|ref|XP_457609.1| unnamed protein product [Debaryomyc... 237 2e-61
gi|50556862|ref|XP_505839.1| hypothetical protein [Yarrowia lipo... 237 2e-61
gi|50254948|gb|EAL17688.1| hypothetical protein CNBL2030 [Crypto... 236 4e-61
gi|34859668|ref|XP_235784.2| similar to Rpl7a protein [Rattus no... 236 5e-61
gi|6322984|ref|NP_013055.1| Ribosomal protein L4 of the large (6... 234 1e-60
gi|38083252|ref|XP_140151.2| similar to Rpl7a protein [Mus muscu... 232 8e-60
gi|15229338|ref|NP_191846.1| 60S ribosomal protein L7A (RPL7aB) ... 231 1e-59
gi|6321754|ref|NP_011830.1| Ribosomal protein L4 of the large (6... 231 1e-59
gi|15226635|ref|NP_182283.1| 60S ribosomal protein L7A (RPL7aA) ... 231 2e-59
gi|4396|emb|CAA35073.1| unnamed protein product [Saccharomyces c... 231 2e-59
gi|38076669|ref|XP_356759.1| similar to Rpl7a protein [Mus muscu... 229 5e-59
gi|34863354|ref|XP_233984.2| similar to Rpl7a protein [Rattus no... 229 7e-59
gi|50307947|ref|XP_453972.1| unnamed protein product [Kluyveromy... 229 7e-59
gi|548774|sp|P35685|RL7A_ORYSA 60S RIBOSOMAL PROTEIN L7A >gnl|BL... 228 9e-59
gi|38091561|ref|XP_112465.3| similar to Rpl7a protein [Mus muscu... 228 9e-59
gi|34854616|ref|XP_214802.2| similar to E2F transcription factor... 228 1e-58
gi|34883044|ref|XP_235176.2| similar to 60S ribosomal protein L7... 228 1e-58
gi|49067458|ref|XP_398019.1| hypothetical protein UM00404.1 [Ust... 227 2e-58
gi|34857405|ref|XP_227173.2| similar to 60S ribosomal protein L7... 227 3e-58
gi|34875496|ref|XP_225292.2| similar to 60S ribosomal protein L7... 226 3e-58
gi|38085967|ref|XP_145374.2| similar to 60S ribosomal protein L7... 223 4e-57
gi|34882040|ref|XP_223867.2| similar to 60S ribosomal protein L7... 222 8e-57
gi|38081992|ref|XP_285880.2| similar to 60S ribosomal protein L7... 221 2e-56
gi|38086366|ref|XP_141785.2| similar to 60S ribosomal protein L7... 219 4e-56
gi|34858109|ref|XP_227325.2| similar to Cleavage and polyadenyla... 219 7e-56
gi|38084887|ref|XP_204932.3| similar to 60S ribosomal protein L7... 217 3e-55
gi|34852789|ref|XP_229392.2| similar to 60S ribosomal protein L7... 213 5e-54
gi|34853719|ref|XP_231272.2| similar to 60S ribosomal protein L7... 212 8e-54
gi|38077286|ref|XP_143590.3| similar to 60S ribosomal protein L7... 212 8e-54
gi|34851674|ref|XP_226363.2| similar to 60S ribosomal protein L7... 211 2e-53
gi|38077290|ref|XP_131256.2| similar to RIKEN cDNA 2410002F23 [M... 210 2e-53
gi|26326179|dbj|BAC26833.1| unnamed protein product [Mus musculus] 210 3e-53
gi|20161741|dbj|BAB90657.1| putative 60S ribosomal protein [Oryz... 208 9e-53
gi|38074050|ref|XP_138368.2| similar to Rpl7a protein [Mus muscu... 208 9e-53
gi|34868324|ref|XP_220134.2| similar to Rpl7a protein [Rattus no... 201 1e-50
gi|38076533|ref|XP_143236.3| similar to Rpl7a protein [Mus muscu... 197 2e-49
gi|34880975|ref|XP_221689.2| similar to 60S ribosomal protein L7... 196 5e-49
gi|28828264|gb|AAO50940.1| similar to Gallus gallus (Chicken). 6... 194 2e-48
gi|38089396|ref|XP_357897.1| similar to 60S ribosomal protein L7... 194 2e-48
gi|46226515|gb|EAK87509.1| 60S ribosomal protein L7A, transcript... 192 5e-48
gi|34882850|ref|XP_346219.1| similar to 60S ribosomal protein L7... 191 2e-47
gi|38050547|ref|XP_138138.2| similar to Rpl7a protein [Mus muscu... 190 3e-47
gi|41146791|ref|XP_087499.7| similar to 60S ribosomal protein L7... 187 2e-46
gi|23509453|ref|NP_702120.1| ribosomal protein L7a, putative [Pl... 187 2e-46
gi|34856309|ref|XP_219703.2| similar to C15orf16 protein [Rattus... 187 2e-46
gi|34881781|ref|XP_229194.2| similar to 60S ribosomal protein L7... 186 7e-46
gi|12407956|gb|AAG53670.1| ribosomal protein L7a-like protein [T... 185 1e-45
gi|25150820|ref|NP_741699.1| putative protein of eukaryotic orig... 184 2e-45
gi|34882287|ref|XP_221603.2| similar to 60S ribosomal protein L7... 183 4e-45
gi|34853379|ref|XP_217716.2| similar to 60S ribosomal protein L7... 182 6e-45
gi|34869696|ref|XP_224007.2| similar to 60S ribosomal protein L7... 179 8e-44
gi|42658485|ref|XP_374483.2| similar to 60S ribosomal protein L7... 178 1e-43
gi|42658033|ref|XP_114560.4| similar to hypothetical protein MGC... 178 1e-43
gi|34882954|ref|XP_346232.1| similar to 60S ribosomal protein L7... 177 3e-43
gi|34853093|ref|XP_226645.2| similar to 60S ribosomal protein L7... 173 4e-42
gi|23482808|gb|EAA18682.1| 60S ribosomal protein L7a [Plasmodium... 168 1e-40
gi|13366090|dbj|BAB39381.1| ribosomal protein L7a [Homo sapiens] 165 1e-39
gi|34877019|ref|XP_237174.2| similar to aldehyde oxidase structu... 164 2e-39
gi|25149011|ref|NP_741373.1| putative protein of eukaryotic orig... 156 4e-37
gi|34880697|ref|XP_346320.1| similar to 60S ribosomal protein L7... 155 7e-37
gi|25150823|ref|NP_741700.1| putative protein of eukaryotic orig... 154 2e-36
gi|34861913|ref|XP_344997.1| similar to Rpl7a protein [Rattus no... 153 5e-36
gi|34864315|ref|XP_343421.1| similar to RIKEN cDNA B230380D07 [R... 143 4e-33
gi|38091459|ref|XP_354622.1| similar to 60S ribosomal protein L7... 142 8e-33
gi|8572157|gb|AAF77030.1| ribosomal protein L7a [Caenorhabditis ... 142 1e-32
gi|38076198|ref|XP_357280.1| similar to 60S ribosomal protein L7... 140 2e-32
gi|34871197|ref|XP_220311.2| similar to 60S ribosomal protein L7... 135 8e-31
gi|6174957|sp|Q29375|RL7A_PIG 60S RIBOSOMAL PROTEIN L7A (SURFEIT... 130 2e-29
gi|50795221|ref|XP_423756.1| PREDICTED: similar to ribosomal pro... 129 6e-29
gi|41195079|ref|XP_371702.1| similar to Ribosomal protein L7A CG... 125 2e-28
gi|8572165|gb|AAF77034.1| ribosomal protein L7a [Caenorhabditis ... 127 3e-28
gi|5441549|emb|CAB46829.1| Ribosomal protein [Canis familiaris] 125 1e-27
gi|34869322|ref|XP_221473.2| similar to 6-phosphogluconate dehyd... 117 3e-25
gi|34880511|ref|XP_344149.1| similar to 60S ribosomal protein L7... 117 3e-25
gi|34878858|ref|XP_344663.1| similar to Pro-neuregulin-2 precurs... 116 6e-25
gi|19073995|ref|NP_584601.1| 60S RIBOSOMAL PROTEIN L7A /yeast L8... 116 6e-25
gi|34880685|ref|XP_242396.2| similar to DNA polymerase alpha cat... 114 2e-24
gi|42656928|ref|XP_376327.1| hypothetical protein XP_376327 [Hom... 111 2e-23
gi|38084250|ref|XP_355779.1| similar to immunoglobulin light cha... 110 3e-23
gi|49258845|pdb|1S1I|G Chain G, Structure Of The Ribosomal 80s-E... 109 6e-23
gi|34860380|ref|XP_345463.1| similar to Rpl7a protein [Rattus no... 105 9e-22
gi|34869768|ref|XP_223996.2| similar to T-cell receptor alpha ch... 102 7e-21
gi|34868238|ref|XP_220152.2| similar to Ac1158 [Rattus norvegicu... 102 1e-20
gi|34871193|ref|XP_220300.2| similar to Rpl7a protein [Rattus no... 102 1e-20
gi|34861539|ref|XP_345314.1| similar to 60S ribosomal protein L7... 101 2e-20
gi|16741312|gb|AAH16489.1| Rpl7a protein [Mus musculus] 99 1e-19
gi|29250153|gb|EAA41652.1| GLP_291_83490_83948 [Giardia lamblia ... 96 7e-19
gi|34853504|ref|XP_341749.1| similar to 60S ribosomal protein L7... 95 2e-18
gi|13812168|ref|NP_113296.1| 60s ribosomal protein L7A [Guillard... 95 2e-18
gi|34853604|ref|XP_216037.2| similar to 60S ribosomal protein L7... 94 3e-18
gi|34864806|ref|XP_342072.1| similar to Rpl7a protein [Rattus no... 93 7e-18
gi|34869618|ref|XP_341303.1| similar to 60S ribosomal protein L7... 92 1e-17
gi|34872901|ref|XP_340859.1| similar to 60S ribosomal protein L7... 92 1e-17
gi|34857229|ref|XP_341872.1| similar to 60S ribosomal protein L7... 92 1e-17
gi|34855195|ref|XP_342448.1| similar to 60S ribosomal protein L7... 92 2e-17
gi|34867490|ref|XP_340966.1| similar to 60S ribosomal protein L7... 91 4e-17
gi|34862445|ref|XP_345768.1| similar to 60S ribosomal protein L7... 91 4e-17
gi|34852839|ref|XP_342151.1| similar to 60S ribosomal protein L7... 90 6e-17
gi|34866532|ref|XP_343253.1| similar to 60S ribosomal protein L7... 89 1e-16
gi|34874014|ref|XP_341503.1| similar to 60S ribosomal protein L7... 89 1e-16
gi|34869516|ref|XP_341295.1| similar to 60S ribosomal protein L7... 89 1e-16
gi|34853204|ref|XP_342160.1| similar to 60S ribosomal protein L7... 88 2e-16
gi|34853077|ref|XP_236540.2| similar to 60S ribosomal protein L7... 87 3e-16
gi|34876176|ref|XP_214484.2| similar to 60S ribosomal protein L7... 87 4e-16
gi|34854895|ref|XP_342204.1| similar to 60S ribosomal protein L7... 87 4e-16
gi|34853005|ref|XP_342382.1| similar to 60S ribosomal protein L7... 87 5e-16
gi|34870745|ref|XP_340802.1| similar to 60S ribosomal protein L7... 86 9e-16
gi|34874367|ref|XP_341345.1| similar to 60S ribosomal protein L7... 86 9e-16
gi|34866102|ref|XP_343233.1| similar to 60S ribosomal protein L7... 86 9e-16
gi|34868026|ref|XP_340982.1| similar to 60S ribosomal protein L7... 86 1e-15
gi|34858643|ref|XP_342512.1| similar to 60S ribosomal protein L7... 85 2e-15
gi|38049621|ref|XP_357105.1| similar to 60S ribosomal protein L7... 82 1e-14
gi|34858095|ref|XP_345227.1| similar to 60S ribosomal protein L7... 82 2e-14
gi|34861080|ref|XP_342605.1| similar to 60S ribosomal protein L7... 79 1e-13
gi|38086329|ref|XP_356331.1| similar to 60S ribosomal protein L7... 75 2e-12
gi|34855926|ref|XP_342697.1| similar to 60S ribosomal protein L7... 74 5e-12
gi|48852098|ref|ZP_00306289.1| COG1358: Ribosomal protein HS6-ty... 70 4e-11
gi|41615108|ref|NP_963606.1| NEQ319 [Nanoarchaeum equitans Kin4-... 70 5e-11
gi|34881509|ref|XP_346344.1| similar to 60S ribosomal protein L7... 70 5e-11
gi|48478352|ref|YP_024058.1| small subunit ribosomal protein L7A... 70 7e-11
gi|11498370|ref|NP_069598.1| LSU ribosomal protein L7AE (rpl7AE)... 68 3e-10
gi|16082138|ref|NP_394575.1| probable 50S ribosomal protein L7 [... 67 3e-10
gi|18314009|ref|NP_560676.1| ribosomal protein L7 [Pyrobaculum a... 67 4e-10
gi|2129247|pir||B64450 ribosomal protein HS6-type - Methanococcu... 67 4e-10
gi|13541280|ref|NP_110968.1| 50S ribosomal protein L7A [Thermopl... 67 4e-10
gi|15669389|ref|NP_248198.1| LSU ribosomal protein L7AE [Methano... 67 4e-10
gi|46228394|gb|EAK89293.1| HMG-like nuclear protein, Nhp2p, pelo... 66 8e-10
gi|29250155|gb|EAA41654.1| GLP_291_83965_84276 [Giardia lamblia ... 66 8e-10
gi|13432097|sp|P55858|RL7A_SULSO 50S ribosomal protein L7Ae 66 1e-09
gi|15897054|ref|NP_341659.1| LSU ribosomal protein L7AE (rpl7AE)... 66 1e-09
gi|34881182|ref|XP_343812.1| similar to 60S ribosomal protein L7... 66 1e-09
gi|15921713|ref|NP_377382.1| 126aa long hypothetical 30S ribosom... 66 1e-09
gi|17484447|ref|XP_066102.1| ribosomal protein L7a-like 2 [Homo ... 65 2e-09
gi|34856859|ref|XP_342237.1| similar to 60S ribosomal protein L7... 65 2e-09
gi|20095034|ref|NP_614881.1| Ribosomal protein HS6-type (S12/L30... 65 2e-09
gi|18977739|ref|NP_579096.1| LSU ribosomal protein L7AE [Pyrococ... 62 1e-08
gi|14591282|ref|NP_143360.1| 50S ribosomal protein L7 [Pyrococcu... 62 1e-08
gi|48429095|sp|P62008|RL7A_PYRAB 50S ribosomal protein L7Ae >gnl... 62 1e-08
gi|14520882|ref|NP_126357.1| LSU ribosomal protein L7AE [Pyrococ... 62 1e-08
gi|39597398|emb|CAE59628.1| Hypothetical protein CBG03041 [Caeno... 62 2e-08
gi|14601646|ref|NP_148187.1| 30S ribosomal protein HS6 [Aeropyru... 61 3e-08
gi|17535189|ref|NP_496300.1| ribosomal protein L7Ae/L30e/S12e/Ga... 61 3e-08
gi|15678283|ref|NP_275398.1| ribosomal protein L7a [Methanotherm... 60 7e-08
gi|13432215|sp|O26355|RL7A_METTH 50S ribosomal protein L7Ae 60 7e-08
gi|17864298|ref|NP_524714.1| CG3949-PA [Drosophila melanogaster]... 59 1e-07
gi|10799008|gb|AAG23161.1| NHP2/RS6-like protein [Trypanosoma br... 59 2e-07
gi|11602717|emb|CAC18545.1| putative high mobility group-like nu... 58 2e-07
gi|50291389|ref|XP_448127.1| unnamed protein product [Candida gl... 58 2e-07
gi|33151018|gb|AAP49574.1| putative NHP2/RS6 protein [Trypanosom... 58 2e-07
gi|31223360|ref|XP_317299.1| ENSANGP00000010500 [Anopheles gambi... 58 2e-07
gi|45360641|ref|NP_988994.1| hypothetical protein MGC75724 [Xeno... 58 2e-07
gi|46137577|ref|XP_390480.1| hypothetical protein FG10304.1 [Gib... 58 3e-07
gi|32398962|emb|CAD98427.1| ribosomal protein L7A [Cryptosporidi... 58 3e-07
gi|50556540|ref|XP_505678.1| hypothetical protein [Yarrowia lipo... 57 3e-07
gi|45358204|ref|NP_987761.1| Ribosomal protein L7AE:Ribosomal pr... 57 3e-07
gi|6319993|ref|NP_010073.1| HMG-like nuclear protein; Nhp2p [Sac... 57 3e-07
gi|31239827|ref|XP_320327.1| ENSANGP00000009119 [Anopheles gambi... 57 5e-07
gi|32412688|ref|XP_326824.1| probable 13 kD U4/U6.U5 snRNP assoc... 57 5e-07
gi|13386120|ref|NP_080907.1| nucleolar protein family A, member ... 57 6e-07
gi|47226061|emb|CAG04435.1| unnamed protein product [Tetraodon n... 56 8e-07
gi|27670553|ref|XP_213293.1| similar to nucleolar protein family... 56 8e-07
gi|50728662|ref|XP_416225.1| PREDICTED: similar to NHP2-like pro... 56 8e-07
gi|50256982|gb|EAL19700.1| hypothetical protein CNBG3280 [Crypto... 56 1e-06
gi|2131737|pir||S64796 hypothetical protein YLL044w - yeast (Sac... 56 1e-06
gi|8923444|ref|NP_060308.1| nucleolar protein family A, member 2... 56 1e-06
gi|34881726|ref|XP_343838.1| similar to NHP2-like protein 1 (Hig... 56 1e-06
gi|37590365|gb|AAH59569.1| Zgc:73227 protein [Danio rerio] 56 1e-06
gi|12835698|dbj|BAB23329.1| unnamed protein product [Mus musculus] 56 1e-06
gi|4826860|ref|NP_004999.1| NHP2 non-histone chromosome protein ... 56 1e-06
gi|48138564|ref|XP_396907.1| similar to Hoip-prov protein [Apis ... 55 1e-06
gi|28511194|ref|XP_196564.2| similar to NHP2-like protein 1 (Hig... 55 1e-06
gi|29249711|gb|EAA41217.1| GLP_28_32750_32382 [Giardia lamblia A... 55 2e-06
gi|41054738|ref|NP_955829.1| NHP2 non-histone chromosome protein... 55 2e-06
gi|41053459|ref|NP_956606.1| similar to NHP2 non-histone chromos... 55 2e-06
gi|28302201|gb|AAH46579.1| Hoip-prov protein [Xenopus laevis] 55 2e-06
gi|38106581|gb|EAA52871.1| hypothetical protein MG05999.4 [Magna... 55 2e-06
gi|32421799|ref|XP_331343.1| hypothetical protein [Neurospora cr... 55 2e-06
gi|49086894|ref|XP_405456.1| hypothetical protein AN1319.2 [Aspe... 55 2e-06
gi|49081050|ref|XP_403975.1| conserved hypothetical protein [Ust... 55 2e-06
gi|19114504|ref|NP_593592.1| putative splicing factor; rs6/l7a r... 54 3e-06
gi|46142352|ref|ZP_00149022.2| COG1358: Ribosomal protein HS6-ty... 54 4e-06
gi|13812346|ref|NP_113464.1| SNU13 snRNP subunit homolog [Guilla... 54 4e-06
gi|46444962|gb|EAL04233.1| hypothetical protein CaO19.13306 [Can... 54 4e-06
gi|46250224|gb|AAH68845.1| MGC81502 protein [Xenopus laevis] 54 5e-06
gi|45360633|ref|NP_988989.1| hypothetical protein MGC75777 [Xeno... 54 5e-06
gi|45185115|ref|NP_982832.1| ABL115Wp [Eremothecium gossypii] >g... 53 7e-06
gi|50513475|pdb|1S72|F Chain F, Refined Crystal Structure Of The... 53 9e-06
gi|10120924|pdb|1FFK|E Chain E, Crystal Structure Of The Large R... 53 9e-06
gi|18266814|sp|P12743|RL7A_HALMA 50S ribosomal protein L7Ae (Hs6) 53 9e-06
gi|45190537|ref|NP_984791.1| AEL070Wp [Eremothecium gossypii] >g... 53 9e-06
gi|50309915|ref|XP_454971.1| unnamed protein product [Kluyveromy... 53 9e-06
gi|50289915|ref|XP_447389.1| unnamed protein product [Candida gl... 53 9e-06
gi|49085416|ref|XP_404832.1| hypothetical protein AN0695.2 [Aspe... 53 9e-06
gi|46136971|ref|XP_390177.1| conserved hypothetical protein [Gib... 52 1e-05
gi|27362930|gb|AAN86977.1| nucleolar protein family A member 2 [... 52 1e-05
gi|48838183|ref|ZP_00295130.1| COG1358: Ribosomal protein HS6-ty... 52 1e-05
gi|42820767|emb|CAF32080.1| HMG-like protein, putative [Aspergil... 52 1e-05
gi|6320809|ref|NP_010888.1| part of small (ribosomal) subunit (S... 52 1e-05
gi|15636687|gb|AAL02139.1| nucleolar protein family A member 2 [... 52 1e-05
gi|50424559|ref|XP_460868.1| unnamed protein product [Debaryomyc... 52 1e-05
gi|38047819|gb|AAR09812.1| similar to Drosophila melanogaster NH... 52 1e-05
gi|20090380|ref|NP_616455.1| ribosomal protein L7ae [Methanosarc... 52 1e-05
gi|29249297|gb|EAA40812.1| GLP_29_43913_44281 [Giardia lamblia A... 52 1e-05
gi|71119|pir||R5HSS6 ribosomal protein HS6 [validated] - Haloarc... 52 1e-05
gi|21228569|ref|NP_634491.1| LSU ribosomal protein L7AE [Methano... 52 2e-05
gi|29251480|gb|EAA42961.1| GLP_170_82204_82719 [Giardia lamblia ... 52 2e-05
gi|50556848|ref|XP_505832.1| hypothetical protein [Yarrowia lipo... 52 2e-05
gi|19115629|ref|NP_594717.1| Nucleolar protein, possibly involve... 52 2e-05
gi|49073478|ref|XP_400955.1| hypothetical protein UM03340.1 [Ust... 51 3e-05
gi|34898652|ref|NP_910672.1| contains EST AU031225(E61165)~nhp2-... 51 3e-05
gi|50754921|ref|XP_414541.1| PREDICTED: similar to nucleolar pro... 51 3e-05
gi|21356151|ref|NP_651965.1| CG5258-PA [Drosophila melanogaster]... 50 4e-05
gi|38078329|ref|XP_285796.2| similar to malate dehydrogenase (EC... 50 4e-05
gi|50305855|ref|XP_452888.1| unnamed protein product [Kluyveromy... 50 4e-05
gi|39591753|emb|CAE71331.1| Hypothetical protein CBG18231 [Caeno... 50 6e-05
gi|46390838|dbj|BAD16342.1| putative high mobility group-like nu... 50 6e-05
gi|37530712|ref|NP_919658.1| putative ribosomal protein L7Ae-lik... 50 6e-05
gi|11276719|pir||T43644 nhp2 homolog - fission yeast (Schizosacc... 50 7e-05
gi|34861669|ref|XP_345322.1| similar to NHP2-like protein 1 (Hig... 50 7e-05
gi|15790233|ref|NP_280057.1| 30S ribosomal protein S14P; Rphs6 [... 49 1e-04
gi|15235416|ref|NP_192997.1| ribosomal protein L7Ae/L30e/S12e/Ga... 49 1e-04
gi|15241276|ref|NP_197516.1| ribosomal protein L7Ae/L30e/S12e/Ga... 49 1e-04
gi|15236127|ref|NP_193969.1| ribosomal protein L7Ae/L30e/S12e/Ga... 49 1e-04
gi|38108472|gb|EAA54482.1| hypothetical protein MG02467.4 [Magna... 49 1e-04
gi|25295061|pir||C85256 Ribosomal protein L7Ae-like (partial) [i... 49 1e-04
gi|21592866|gb|AAM64816.1| Ribosomal protein L7Ae-like [Arabidop... 49 1e-04
gi|46439098|gb|EAK98420.1| hypothetical protein CaO19.526 [Candi... 49 1e-04
gi|50425177|ref|XP_461180.1| unnamed protein product [Debaryomyc... 49 2e-04
gi|23508441|ref|NP_701110.1| high mobility group-like protein NH... 48 2e-04
gi|2500346|sp|P55770|NHPX_RAT NHP2-like protein 1 (High mobility... 48 2e-04
gi|15241537|ref|NP_196435.1| ribosomal protein L7Ae/L30e/S12e/Ga... 48 2e-04
gi|32455963|ref|NP_862421.1| putative hydroxyproline-rich protei... 48 3e-04
gi|34869608|ref|XP_233180.2| similar to NHP2-like protein 1 (Hig... 48 3e-04
gi|17555988|ref|NP_499415.1| nucleolar protein family A member 2... 47 4e-04
gi|6841222|gb|AAF28964.1| HSPC286 [Homo sapiens] 47 5e-04
gi|14150001|ref|NP_115642.1| chromosome 2 open reading frame 16 ... 47 6e-04
gi|21740062|emb|CAD39047.1| hypothetical protein [Homo sapiens] 47 6e-04
gi|11071684|dbj|BAB17305.1| LSU ribosomal protein L7AE [Halobact... 46 0.001
gi|23510182|ref|NP_702848.1| ribosomal protein L7Ae-related prot... 46 0.001
gi|30687670|ref|NP_850856.1| ribosomal protein L7Ae/L30e/S12e/Ga... 45 0.002
gi|23119268|ref|ZP_00102424.1| COG3706: Response regulator conta... 44 0.003
gi|20984761|ref|XP_142002.1| similar to 60S ribosomal protein L7... 44 0.003
gi|38085033|ref|XP_355808.1| similar to NHP2-like protein 1 (Hig... 44 0.004
gi|32412982|ref|XP_326971.1| hypothetical protein [Neurospora cr... 44 0.004
gi|34871221|ref|XP_233529.2| similar to zinc finger protein 262;... 43 0.007
gi|47077475|dbj|BAD18625.1| unnamed protein product [Homo sapiens] 43 0.007
gi|38050539|ref|XP_356590.1| similar to Ac1158 [Mus musculus] 43 0.007
gi|46432074|gb|EAK91579.1| hypothetical protein CaO19.10995 [Can... 43 0.009
gi|50762067|ref|XP_424924.1| PREDICTED: similar to COBW domain c... 42 0.012
gi|17864576|ref|NP_524900.1| CG3496-PA [Drosophila melanogaster]... 42 0.012
gi|7582294|gb|AAF64267.1| BM-011 [Homo sapiens] 42 0.015
gi|38488727|ref|NP_057709.2| BM-011 protein [Homo sapiens] >gnl|... 42 0.015
gi|19115337|ref|NP_594425.1| carboxypeptidase y [Schizosaccharom... 42 0.015
gi|134874|sp|P16230|SRCH_RABIT Sarcoplasmic reticulum histidine-... 42 0.020
gi|47087423|ref|NP_998607.1| zgc:63802 [Danio rerio] >gnl|BL_ORD... 42 0.020
gi|26347067|dbj|BAC37182.1| unnamed protein product [Mus musculus] 41 0.026
gi|25027859|ref|NP_737913.1| putative transcription termination ... 41 0.026
gi|34860213|ref|XP_345286.1| similar to 60S ribosomal protein L7... 41 0.034
gi|31201821|ref|XP_309858.1| ENSANGP00000018997 [Anopheles gambi... 41 0.034
gi|7949115|ref|NP_058079.1| Ser/Arg-related nuclear matrix prote... 41 0.034
gi|31197913|ref|XP_307904.1| ENSANGP00000021819 [Anopheles gambi... 40 0.044
gi|38079966|ref|XP_156244.2| similar to NHP2-like protein 1 (Hig... 40 0.044
gi|47219559|emb|CAG09913.1| unnamed protein product [Tetraodon n... 40 0.044
gi|23274133|gb|AAH36187.1| Serine/arginine repetitive matrix 1 [... 40 0.058
gi|11362193|pir||T45134 hypothetical protein [imported] - Microb... 40 0.058
gi|9843651|emb|CAC03679.1| SRM102 [Arabidopsis thaliana] 40 0.058
gi|30684163|ref|NP_180484.2| splicing factor PWI domain-containi... 40 0.058
gi|9910564|ref|NP_064477.1| serine-arginine-rich splicing regula... 40 0.058
gi|25408026|pir||G84693 probable proline-rich protein [imported]... 40 0.058
gi|47223752|emb|CAF98522.1| unnamed protein product [Tetraodon n... 40 0.075
gi|47183100|emb|CAG14266.1| unnamed protein product [Tetraodon n... 40 0.075
gi|42542379|ref|NP_005830.2| serine/arginine repetitive matrix 1... 40 0.075
gi|38105997|gb|EAA52358.1| hypothetical protein MG05050.4 [Magna... 40 0.075
gi|38103658|gb|EAA50334.1| hypothetical protein MG04093.4 [Magna... 40 0.075
gi|17484618|ref|XP_066139.1| ribosomal protein L7a-like 3 [Homo ... 40 0.075
gi|10947052|ref|NP_001139.2| ankyrin 2 isoform 1; ankyrin, noner... 39 0.098
gi|25151613|ref|NP_741698.1| putative protein (80.3 kD) (5T676) ... 39 0.098
gi|4803663|emb|CAB42644.1| ankyrin B (440 kDa) [Homo sapiens] 39 0.098
gi|29489|emb|CAA40278.1| ankyrin (brank-1) [Homo sapiens] 39 0.098
gi|1703310|sp|Q01484|ANK2_HUMAN Ankyrin 2 (Brain ankyrin) (Ankyr... 39 0.098
gi|3005587|gb|AAC09321.1| Ser/Arg-related nuclear matrix protein... 39 0.13
gi|19074894|ref|NP_586400.1| HIGH MOBILITY GROUP-LIKE NUCLEAR PR... 39 0.13
gi|46105392|ref|XP_380500.1| hypothetical protein FG00324.1 [Gib... 39 0.13
gi|41149264|ref|XP_372303.1| similar to proline-rich proteoglyca... 39 0.13
gi|30424862|ref|NP_780438.1| serine/arginine repetitive matrix 2... 39 0.13
gi|15598172|ref|NP_251666.1| ribonuclease E [Pseudomonas aerugin... 39 0.17
gi|38100245|gb|EAA47401.1| hypothetical protein MG02644.4 [Magna... 39 0.17
gi|50740149|ref|XP_419377.1| PREDICTED: similar to Secretogranin... 39 0.17
gi|32038047|ref|ZP_00136319.1| COG1530: Ribonucleases G and E [P... 39 0.17
gi|50754187|ref|XP_414278.1| PREDICTED: similar to PHD finger pr... 39 0.17
gi|25143299|ref|NP_492875.2| pre-mRNA splicing SR protein relate... 38 0.22
gi|47575780|ref|NP_001001234.1| hypothetical protein MGC69461 [X... 38 0.22
gi|29788822|gb|AAP03368.1| hypothetical protein [Oryza sativa (j... 38 0.22
gi|31044166|gb|AAP42878.1| NanG6 [Streptomyces nanchangensis] 38 0.22
gi|47086673|ref|NP_997849.1| Unknown (protein for MGC:66471); wu... 38 0.29
gi|48475113|gb|AAT44182.1| unknown protein [Oryza sativa (japoni... 38 0.29
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 38 0.29
gi|47209102|emb|CAF93127.1| unnamed protein product [Tetraodon n... 38 0.29
gi|32413379|ref|XP_327169.1| hypothetical protein [Neurospora cr... 38 0.29
gi|26988635|ref|NP_744060.1| ribonuclease E [Pseudomonas putida ... 38 0.29
gi|39598251|emb|CAE68943.1| Hypothetical protein CBG14923 [Caeno... 37 0.37
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi... 37 0.37
gi|17548032|ref|NP_521434.1| PUTATIVE PROLIN-RICH TRANSMEMBRANE ... 37 0.37
gi|23099052|ref|NP_692518.1| 50S ribosomal protein [Oceanobacill... 37 0.37
gi|17544094|ref|NP_500965.1| putative nuclear protein (65.1 kD) ... 37 0.37
gi|30585347|gb|AAP36946.1| Homo sapiens splicing factor, arginin... 37 0.37
gi|17862948|gb|AAL39951.1| SD04681p [Drosophila melanogaster] 37 0.37
gi|24668137|ref|NP_649325.2| CG7597-PA [Drosophila melanogaster]... 37 0.37
gi|32564551|ref|NP_871988.1| putative nuclear protein (2D362) [C... 37 0.37
gi|39584708|emb|CAE72461.1| Hypothetical protein CBG19634 [Caeno... 37 0.37
gi|47086145|ref|NP_998112.1| hypothetical protein zgc:85700 [Dan... 37 0.37
gi|21361282|ref|NP_005617.2| splicing factor, arginine/serine-ri... 37 0.37
gi|17536975|ref|NP_494440.1| zinc finger protein 265 (2D362) [Ca... 37 0.37
gi|47218036|emb|CAG11441.1| unnamed protein product [Tetraodon n... 37 0.49
gi|20259449|gb|AAM13845.1| unknown protein [Arabidopsis thaliana... 37 0.49
gi|47575808|ref|NP_001001248.1| hypothetical protein MGC76055 [X... 37 0.49
gi|22329097|ref|NP_194968.2| peptidyl-prolyl cis-trans isomerase... 37 0.49
gi|47213048|emb|CAF93801.1| unnamed protein product [Tetraodon n... 37 0.49
gi|32455928|ref|NP_862386.1| MC8 [Micrococcus sp. 28] >gnl|BL_OR... 37 0.49
gi|20807841|ref|NP_623012.1| Ribosomal protein HS6-type (S12/L30... 37 0.49
gi|46136181|ref|XP_389782.1| hypothetical protein FG09606.1 [Gib... 37 0.49
gi|26342486|dbj|BAC34905.1| unnamed protein product [Mus musculus] 37 0.49
gi|50414757|gb|AAH77771.1| Unknown (protein for IMAGE:4885186) [... 37 0.49
gi|31210607|ref|XP_314270.1| ENSANGP00000018675 [Anopheles gambi... 37 0.49
gi|49071576|ref|XP_400077.1| hypothetical protein UM02462.1 [Ust... 37 0.49
gi|7486628|pir||T05352 hypothetical protein F8B4.120 - Arabidops... 37 0.49
gi|26331958|dbj|BAC29709.1| unnamed protein product [Mus musculus] 37 0.49
gi|39645085|gb|AAH63761.1| Unknown (protein for IMAGE:30142365) ... 37 0.49
gi|26336164|dbj|BAC31767.1| unnamed protein product [Mus musculus] 37 0.49
gi|26333193|dbj|BAC30314.1| unnamed protein product [Mus musculus] 37 0.49
gi|39592411|emb|CAE63488.1| Hypothetical protein CBG07956 [Caeno... 37 0.49
gi|27369842|ref|NP_766180.1| expressed sequence AI450757 [Mus mu... 37 0.49
gi|33146719|dbj|BAC79524.1| RNaseP-associated protein-like [Oryz... 37 0.49
gi|1082713|pir||A48133 pre-mRNA splicing SRp75 - human >gnl|BL_O... 37 0.49
gi|31194331|ref|XP_306113.1| ENSANGP00000015546 [Anopheles gambi... 37 0.64
gi|40068059|ref|NP_004873.3| CBF1 interacting corepressor isofor... 37 0.64
gi|50754165|ref|XP_414267.1| PREDICTED: similar to ring finger p... 37 0.64
gi|31207967|ref|XP_312950.1| ENSANGP00000014727 [Anopheles gambi... 37 0.64
gi|46135807|ref|XP_389595.1| hypothetical protein FG09419.1 [Gib... 37 0.64
gi|15430638|gb|AAK98522.1| protamine 2 [Mesocricetus auratus] >g... 37 0.64
gi|34872845|ref|XP_346921.1| hypothetical protein XP_346920 [Rat... 37 0.64
gi|23103184|ref|ZP_00089671.1| COG1530: Ribonucleases G and E [A... 37 0.64
gi|50754531|ref|XP_425155.1| PREDICTED: similar to PHD finger pr... 37 0.64
gi|7484376|pir||T08176 glucose-1-phosphate adenylyltransferase (... 37 0.64
gi|12383113|gb|AAG24941.2| unknown [Frankia sp. Ar15] 36 0.83
gi|42563113|ref|NP_177219.2| cyclin-related [Arabidopsis thaliana] 36 0.83
gi|29789008|ref|NP_036404.1| Huntingtin interacting protein C [H... 36 0.83
gi|4160443|gb|AAD05243.1| CBF1 interacting corepressor CIR [Homo... 36 0.83
gi|31197589|ref|XP_307742.1| ENSANGP00000012948 [Anopheles gambi... 36 0.83
gi|987979|emb|CAA62630.1| high mobility group-like protein [Zinn... 36 0.83
gi|45861431|gb|AAS78587.1| ATX-2 [Caenorhabditis elegans] 36 0.83
gi|13385292|ref|NP_080098.1| RIKEN cDNA 1200013F24 [Mus musculus... 36 0.83
gi|45501015|gb|AAH67364.1| HYPC protein [Homo sapiens] 36 0.83
gi|38086086|ref|XP_285437.2| similar to Sid393p [Mus musculus] 36 0.83
gi|41203898|ref|XP_372522.1| similar to Plasmodium falciparum tr... 36 0.83
gi|27695305|gb|AAH43045.1| 1200013F24Rik protein [Mus musculus] 36 0.83
gi|26375907|dbj|BAB28031.2| unnamed protein product [Mus musculus] 36 0.83
gi|50554465|ref|XP_504641.1| hypothetical protein [Yarrowia lipo... 36 0.83
gi|27807135|ref|NP_777057.1| calcium channel, voltage-dependent,... 36 0.83
gi|28972153|dbj|BAC65530.1| mKIAA0324 protein [Mus musculus] 36 0.83
gi|26342516|dbj|BAC25107.1| unnamed protein product [Mus musculus] 36 0.83
gi|15889177|ref|NP_354858.1| AGR_C_3445p [Agrobacterium tumefaci... 36 0.83
gi|50759930|ref|XP_425775.1| PREDICTED: similar to Ser/Arg-relat... 36 0.83
gi|34868816|ref|XP_220207.2| similar to splicing coactivator sub... 36 1.1
gi|47223170|emb|CAG11305.1| unnamed protein product [Tetraodon n... 36 1.1
gi|11360040|pir||T46402 hypothetical protein DKFZp434H2121.1 - h... 36 1.1
gi|15234319|ref|NP_192088.1| ribosomal protein L7Ae/L30e/S12e/Ga... 36 1.1
gi|41704912|sp|Q9H9J4|UB42_HUMAN Ubiquitin carboxyl-terminal hyd... 36 1.1
gi|38173812|gb|AAH60846.1| USP42 protein [Homo sapiens] 36 1.1
gi|7487025|pir||T01997 hypothetical protein T15B16.7 - Arabidops... 36 1.1
gi|39587538|emb|CAE58476.1| Hypothetical protein CBG01616 [Caeno... 36 1.1
gi|14714462|gb|AAH10357.1| MGC12197 protein [Homo sapiens] 36 1.1
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD... 36 1.1
gi|7486768|pir||T08588 hypothetical protein L23H3.30 - Arabidops... 36 1.1
gi|20129977|ref|NP_610928.1| CG8241-PA [Drosophila melanogaster]... 36 1.1
gi|21428730|gb|AAM50025.1| SD07467p [Drosophila melanogaster] 36 1.1
gi|34192866|gb|AAH50398.1| HYPC protein [Homo sapiens] 36 1.1
gi|41147710|ref|XP_374396.1| similar to ubiquitin specific prote... 36 1.1
gi|23102653|ref|ZP_00089155.1| COG2710: Nitrogenase molybdenum-i... 36 1.1
gi|50751656|ref|XP_422499.1| PREDICTED: similar to Ubiquitin car... 36 1.1
gi|10440161|dbj|BAB15662.1| unnamed protein product [Homo sapiens] 36 1.1
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens] 36 1.1
gi|18418034|ref|NP_567896.1| WD-40 repeat family protein (LEUNIG... 36 1.1
gi|11141605|gb|AAG32022.1| LEUNIG [Arabidopsis thaliana] 36 1.1
gi|27374232|gb|AAO00994.1| CG32170-PA [Drosophila erecta] 36 1.1
gi|23612504|ref|NP_704065.1| erythrocyte membrane protein 1 (PfE... 36 1.1
gi|21311753|gb|AAM46838.1| potassium channel alpha subunit Kv1.4... 35 1.4
gi|50551105|ref|XP_503026.1| hypothetical protein [Yarrowia lipo... 35 1.4
gi|6649242|gb|AAF21439.1| splicing coactivator subunit SRm300 [H... 35 1.4
gi|15218373|ref|NP_173045.1| 40S ribosomal protein S12 (RPS12A) ... 35 1.4
gi|5821145|dbj|BAA83714.1| RNA binding protein [Homo sapiens] 35 1.4
gi|12833943|dbj|BAB22724.1| unnamed protein product [Mus musculus] 35 1.4
gi|8648986|emb|CAB94846.1| Kv1.4 voltage-gated potassium channel... 35 1.4
gi|50259690|gb|EAL22360.1| hypothetical protein CNBB5330 [Crypto... 35 1.4
gi|34859979|ref|XP_227735.2| similar to ankyrin 2 isoform 1; ank... 35 1.4
gi|5821143|dbj|BAA83713.1| RNA binding protein [Homo sapiens] 35 1.4
gi|19923466|ref|NP_057417.2| splicing coactivator subunit SRm300... 35 1.4
gi|47124032|gb|AAH70050.1| SRRM2 protein [Homo sapiens] 35 1.4
gi|46391139|gb|AAS90666.1| putative polyprotein [Oryza sativa (j... 35 1.4
gi|24641127|ref|NP_572660.1| CG2186-PA [Drosophila melanogaster]... 35 1.4
gi|45548671|ref|ZP_00188701.1| hypothetical protein Rxyl005301 [... 35 1.4
gi|34913830|ref|NP_918262.1| OSJNBa0042P21.22 [Oryza sativa (jap... 35 1.9
gi|49080850|ref|XP_403898.1| hypothetical protein UM06283.1 [Ust... 35 1.9
gi|23102168|ref|ZP_00088691.1| COG0532: Translation initiation f... 35 1.9
gi|34873013|ref|XP_222251.2| similar to Domino [Rattus norvegicus] 35 1.9
gi|34896616|ref|NP_909652.1| hypothetical protein [Oryza sativa]... 35 1.9
gi|25030960|ref|XP_205276.1| similar to Sid393p [Mus musculus] 35 1.9
gi|46108602|ref|XP_381359.1| hypothetical protein FG01183.1 [Gib... 35 1.9
gi|39581822|emb|CAE60715.1| Hypothetical protein CBG04386 [Caeno... 35 1.9
gi|31240541|ref|XP_320684.1| ENSANGP00000020265 [Anopheles gambi... 35 1.9
gi|39597356|emb|CAE59584.1| Hypothetical protein CBG02984 [Caeno... 35 1.9
gi|47228314|emb|CAG07709.1| unnamed protein product [Tetraodon n... 35 1.9
gi|5821151|dbj|BAA83717.1| RNA binding protein [Homo sapiens] 35 2.4
gi|48096457|ref|XP_392461.1| similar to ENSANGP00000010736 [Apis... 35 2.4
gi|15225180|ref|NP_180766.1| 40S ribosomal protein S12 (RPS12C) ... 35 2.4
gi|38105139|gb|EAA51601.1| hypothetical protein MG03196.4 [Magna... 35 2.4
gi|34864638|ref|XP_236266.2| similar to RIKEN cDNA C230081A13 [R... 35 2.4
gi|42733708|gb|AAS38648.1| similar to Homo sapiens (Human). Piwi... 35 2.4
gi|47214915|emb|CAG04109.1| unnamed protein product [Tetraodon n... 35 2.4
gi|12314266|emb|CAC13171.1| dJ14N1.1.2 (profilaggrin 3' end) [Ho... 35 2.4
gi|50548805|ref|XP_501872.1| hypothetical protein [Yarrowia lipo... 35 2.4
gi|32563629|ref|NP_491994.2| chromo domain and SNF2 related doma... 35 2.4
gi|6634015|dbj|BAA20782.2| KIAA0324 protein [Homo sapiens] 35 2.4
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc... 35 2.4
gi|47226305|emb|CAG09273.1| unnamed protein product [Tetraodon n... 35 2.4
gi|7512967|pir||T02345 hypothetical protein KIAA0324 - human (fr... 35 2.4
gi|27375270|ref|NP_766799.1| ATP-dependent helicase [Bradyrhizob... 35 2.4
gi|47125173|gb|AAH70694.1| MGC83165 protein [Xenopus laevis] 35 2.4
gi|46227721|gb|EAK88641.1| eIF4G eukaryotic initiation factor 4,... 35 2.4
>gi|32565827|ref|NP_741371.2| ribosomal protein
L7Ae/L30e/S12e/Gadd45 (30.2 kD) (4F154) [Caenorhabditis
elegans]
gi|15145440|gb|AAK84600.1| Ribosomal protein, large subunit protein
8, isoform a [Caenorhabditis elegans]
Length = 265
Score = 446 bits (1147), Expect = e-124
Identities = 233/265 (87%), Positives = 233/265 (87%)
Frame = -1
Query: 798 MPSXXXXXXXXXXXXAHIRAQTQVQKEVKNPLFEKRARNFNIGQDIQPKKDVTRFVKWPK 619
MPS AHIRAQTQVQKEVKNPLFEKRARNFNIGQDIQPKKDVTRFVKWPK
Sbjct: 1 MPSKKVIKKKVAAVPAHIRAQTQVQKEVKNPLFEKRARNFNIGQDIQPKKDVTRFVKWPK 60
Query: 618 YIRLQRQSAILQKRLKVPPTINQFRTALDSQSARQAFKLLDKYRPESTXXXXXXXXXXXX 439
YIRLQRQSAILQKRLKVPPTINQFRTALDSQSARQAFKLLDKYRPEST
Sbjct: 61 YIRLQRQSAILQKRLKVPPTINQFRTALDSQSARQAFKLLDKYRPESTEAKKNRLRARAE 120
Query: 438 XXXXXXXXEVTKRPNTVRHGVNTITRLVETRRAQLVLIAHDVNPLEIVLHLPALCRKYNV 259
EVTKRPNTVRHGVNTITRLVETRRAQLVLIAHDVNPLEIVLHLPALCRKYNV
Sbjct: 121 ARAAGKKEEVTKRPNTVRHGVNTITRLVETRRAQLVLIAHDVNPLEIVLHLPALCRKYNV 180
Query: 258 PYAIIKGKASLGTVVRRKTTAAVALVDVNPEDKSALNKLVETVNNNFSERHEEIRKHWGG 79
PYAIIKGKASLGTVVRRKTTAAVALVDVNPEDKSALNKLVETVNNNFSERHEEIRKHWGG
Sbjct: 181 PYAIIKGKASLGTVVRRKTTAAVALVDVNPEDKSALNKLVETVNNNFSERHEEIRKHWGG 240
Query: 78 GVMSAKSDAKKLKIERARARDLGKL 4
GVMSAKSDAKKLKIERARARDLGKL
Sbjct: 241 GVMSAKSDAKKLKIERARARDLGKL 265