Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y34D9A_6
(318 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17509845|ref|NP_490812.1| glutaredoxin (11.3 kD) (1B523) [Cae... 159 2e-38
gi|39589296|emb|CAE74325.1| Hypothetical protein CBG22036 [Caeno... 148 2e-35
gi|33519160|gb|AAQ20895.1| glutaredoxin [Aphelenchus avenae] 100 7e-21
gi|13568613|gb|AAK30668.1| glutaredoxin-like protein [Theileria ... 82 3e-15
gi|47523548|ref|NP_999398.1| thioltransferase [Sus scrofa] >gnl|... 79 2e-14
gi|1827634|pdb|1KTE| Crystal Structure Of Thioltransferase At 2... 77 9e-14
gi|643695|dbj|BAA04769.1| glutaredoxin [Homo sapiens] 77 1e-13
gi|4504025|ref|NP_002055.1| glutaredoxin (thioltransferase) [Hom... 77 1e-13
gi|30584863|gb|AAP36684.1| Homo sapiens glutaredoxin (thioltrans... 77 1e-13
gi|19922712|ref|NP_611609.1| CG7975-PA [Drosophila melanogaster]... 76 1e-13
gi|11560105|ref|NP_071614.1| glutaredoxin 1 (thioltransferase) [... 75 4e-13
gi|12746263|gb|AAK07419.1| glutaredoxin [Rattus norvegicus] 75 4e-13
gi|24666486|ref|NP_649065.1| CG6852-PA [Drosophila melanogaster]... 74 6e-13
gi|121443|sp|P12864|GLRX_RABIT Glutaredoxin (Thioltransferase) (... 74 7e-13
gi|65813|pir||GDRB glutaredoxin - rabbit 74 7e-13
gi|121440|sp|P10575|GLRX_BOVIN Glutaredoxin (Thioltransferase) (... 74 7e-13
gi|31981458|ref|NP_444338.2| glutaredoxin 1 (thioltransferase); ... 73 1e-12
gi|6730102|pdb|1B4Q|A Chain A, Solution Structure Of Human Thiol... 72 3e-12
gi|12851196|dbj|BAB28971.1| unnamed protein product [Mus musculus] 72 4e-12
gi|21536938|gb|AAM61279.1| glutaredoxin [Arabidopsis thaliana] 71 6e-12
gi|19548658|gb|AAL90750.1| glutaredoxin [Populus tremula x Popul... 71 6e-12
gi|31201183|ref|XP_309539.1| ENSANGP00000012664 [Anopheles gambi... 70 1e-11
gi|15241374|ref|NP_197550.1| glutaredoxin, putative [Arabidopsis... 70 1e-11
gi|34869107|ref|XP_223806.2| similar to glutaredoxin 1 (thioltra... 69 3e-11
gi|46227987|gb|EAK88907.1| glutaredoxin related protein [Cryptos... 67 7e-11
gi|48109905|ref|XP_396253.1| similar to ENSANGP00000012664 [Apis... 67 9e-11
gi|7484615|pir||T12219 glutaredoxin I - common ice plant >gnl|BL... 67 1e-10
gi|15223928|ref|NP_177861.1| glutaredoxin, putative [Arabidopsis... 65 3e-10
gi|50539868|ref|NP_001002404.1| zgc:92698 [Danio rerio] >gnl|BL_... 65 3e-10
gi|6630968|gb|AAF19628.1| thioltransferase [Schizosaccharomyces ... 65 4e-10
gi|50258432|gb|EAL21121.1| hypothetical protein CNBD4970 [Crypto... 65 4e-10
gi|34882866|ref|XP_223903.2| similar to glutaredoxin 1 (thioltra... 64 8e-10
gi|50233795|ref|NP_898895.1| thioredoxin reductase 1 [Danio reri... 63 2e-09
gi|19115675|ref|NP_594763.1| thioltransferase [Schizosaccharomyc... 63 2e-09
gi|46110431|ref|XP_382273.1| hypothetical protein FG02097.1 [Gib... 62 3e-09
gi|15192742|gb|AAK91590.1| putative glutaredoxin; thioltransfera... 62 4e-09
gi|38108672|gb|EAA54655.1| hypothetical protein MG05447.4 [Magna... 61 5e-09
gi|30519443|emb|CAD90618.1| R2L protein [Cowpox virus] 61 5e-09
gi|18640301|ref|NP_570457.1| putative glutaredoxin protein; CMLV... 61 5e-09
gi|9790991|ref|NP_063718.1| glutaredoxin [Vaccinia virus] >gnl|B... 61 5e-09
gi|17974974|ref|NP_536488.1| Q2L [Monkeypox virus] >gnl|BL_ORD_I... 61 5e-09
gi|32412464|ref|XP_326712.1| probable glutaredoxin 8D4.220 [simi... 61 6e-09
gi|50304595|ref|XP_452253.1| unnamed protein product [Kluyveromy... 60 8e-09
gi|46442724|gb|EAL02011.1| hypothetical protein CaO19.13862 [Can... 60 8e-09
gi|45268989|gb|AAS55907.1| glutaredoxin [Sus scrofa] 60 1e-08
gi|20178445|ref|NP_619866.1| CPXV079 protein [Cowpox virus] >gnl... 60 1e-08
gi|22164658|ref|NP_671571.1| EVM053 [Ectromelia virus] >gnl|BL_O... 60 1e-08
gi|50750950|ref|XP_422200.1| PREDICTED: similar to glutaredoxin ... 60 1e-08
gi|45384038|ref|NP_990491.1| glutaredoxin [Gallus gallus] >gnl|B... 59 2e-08
gi|47217740|emb|CAG03692.1| unnamed protein product [Tetraodon n... 59 2e-08
gi|1707981|sp|P55143|GLRX_RICCO Glutaredoxin >gnl|BL_ORD_ID|1345... 59 2e-08
gi|9627575|ref|NP_042098.1| Q2L [Variola virus] >gnl|BL_ORD_ID|4... 59 2e-08
gi|49387625|dbj|BAD25821.1| putative glutaredoxin I [Oryza sativ... 59 3e-08
gi|38104963|gb|EAA51454.1| hypothetical protein MG10371.4 [Magna... 59 3e-08
gi|32401362|gb|AAP80853.1| glutaredoxin [Triticum aestivum] 59 3e-08
gi|15242674|ref|NP_198853.1| glutaredoxin, putative [Arabidopsis... 59 3e-08
gi|23480858|gb|EAA17306.1| thioltransferase [Plasmodium yoelii y... 58 4e-08
gi|1732424|emb|CAA89699.1| glutaredoxin [Ricinus communis] 58 4e-08
gi|49077398|ref|XP_402563.1| hypothetical protein UM04948.1 [Ust... 58 4e-08
gi|50426699|ref|XP_461947.1| unnamed protein product [Debaryomyc... 58 5e-08
gi|50420167|ref|XP_458616.1| unnamed protein product [Debaryomyc... 58 5e-08
gi|15637350|gb|AAL04507.1| glutaredoxin [Tilia platyphyllos] 57 7e-08
gi|47227392|emb|CAF96941.1| unnamed protein product [Tetraodon n... 57 9e-08
gi|23957733|ref|NP_705851.1| glutaredoxin, putative [Plasmodium ... 57 1e-07
gi|7430859|pir||JC5445 glutaredoxin - rice >gnl|BL_ORD_ID|128734... 57 1e-07
gi|37550535|ref|XP_051264.5| thioredoxin reductase 3 [Homo sapiens] 56 2e-07
gi|29476880|gb|AAH50032.1| TXNRD3 protein [Homo sapiens] 56 2e-07
gi|34190642|gb|AAH30028.1| TXNRD3 protein [Homo sapiens] 56 2e-07
gi|46440712|gb|EAL00015.1| hypothetical protein CaO19.13480 [Can... 56 2e-07
gi|13878502|sp|O81187|GLRX_VERFO Glutaredoxin >gnl|BL_ORD_ID|143... 56 2e-07
gi|5442102|gb|AAD43253.1| peptide methionine sulfoxide reductase... 55 4e-07
gi|417072|sp|P17695|GLRX_YEAST Glutaredoxin (Thioltransferase) >... 55 4e-07
gi|2708324|gb|AAB92419.1| glutaredoxin type 1 [Fritillaria agres... 55 4e-07
gi|50309483|ref|XP_454750.1| unnamed protein product [Kluyveromy... 55 4e-07
gi|6320720|ref|NP_010801.1| Glutaredoxin (thioltransferase) (glu... 55 4e-07
gi|46108576|ref|XP_381346.1| hypothetical protein FG01170.1 [Gib... 55 5e-07
gi|20141083|gb|AAK53442.2| glutaredoxin [Deschampsia antarctica] 55 5e-07
gi|13878523|sp|Q9ZR41|GLRX_LYCES Glutaredoxin >gnl|BL_ORD_ID|852... 55 5e-07
gi|38512094|gb|AAH61647.1| MGC68461 protein [Xenopus laevis] 54 6e-07
gi|1707980|sp|P55142|GLRX_ORYSA Glutaredoxin >gnl|BL_ORD_ID|6491... 54 8e-07
gi|47847544|dbj|BAD21596.1| putative glutaredoxin [Oryza sativa ... 54 8e-07
gi|49093782|ref|XP_408352.1| hypothetical protein AN4215.2 [Aspe... 54 1e-06
gi|15150144|gb|AAK85319.1| glutaredoxin 2 [Mus musculus] 54 1e-06
gi|41107595|gb|AAH65387.1| Unknown (protein for IMAGE:5146214) [... 54 1e-06
gi|13122603|ref|NP_075994.1| glutaredoxin 2 [Mus musculus] >gnl|... 54 1e-06
gi|12838646|dbj|BAB24276.1| unnamed protein product [Mus musculus] 54 1e-06
gi|45199229|ref|NP_986258.1| AFR710Wp [Eremothecium gossypii] >g... 53 1e-06
gi|50548009|ref|XP_501474.1| hypothetical protein [Yarrowia lipo... 52 3e-06
gi|6319814|ref|NP_009895.1| Hydroperoxide and superoxide-radical... 51 5e-06
gi|21618084|gb|AAM67134.1| glutaredoxin-like protein [Arabidopsi... 51 7e-06
gi|18424656|ref|NP_568962.1| glutaredoxin, putative [Arabidopsis... 51 7e-06
gi|37537704|ref|NP_932066.1| glutaredoxin 2 isoform 2; CGI-133 p... 51 7e-06
gi|9758303|dbj|BAB08846.1| glutaredoxin-like protein [Arabidopsi... 51 7e-06
gi|12314146|emb|CAC17588.1| bA101E13.1 (GRX2 glutaredoxin (thiol... 51 7e-06
gi|4929735|gb|AAD34128.1| CGI-133 protein [Homo sapiens] 51 7e-06
gi|21361507|ref|NP_057150.2| glutaredoxin 2 isoform 1; CGI-133 p... 51 7e-06
gi|6319488|ref|NP_009570.1| Hypothetical ORF; Ybr014cp [Saccharo... 50 9e-06
gi|49078632|ref|XP_403050.1| hypothetical protein UM05435.1 [Ust... 50 1e-05
gi|5764543|gb|AAD51325.1| thioredoxin reductase TR2 [Homo sapiens] 50 1e-05
gi|19115222|ref|NP_594310.1| putative thioltransferase (glutared... 50 1e-05
gi|5107031|gb|AAD39929.1| thioredoxin reductase 3 [Homo sapiens] 50 1e-05
gi|27712322|ref|XP_213890.1| glutaredoxin 2 (thioltransferase) [... 49 2e-05
gi|50260154|gb|EAL22815.1| hypothetical protein CNBB0360 [Crypto... 48 4e-05
gi|23346613|ref|NP_694802.1| thioredoxin reductase 3; thioredoxi... 48 4e-05
gi|13569629|gb|AAK31172.1| thioredoxin and glutathione reductase... 48 4e-05
gi|32409347|ref|XP_325154.1| hypothetical protein [Neurospora cr... 48 6e-05
gi|34856407|ref|XP_216204.2| similar to thioredoxin reductase 3;... 48 6e-05
gi|25147337|ref|NP_510815.2| glutaredoxin precursor (16.6 kD) (X... 48 6e-05
gi|7498824|pir||T16026 hypothetical protein F10D7.3 - Caenorhabd... 48 6e-05
gi|50290031|ref|XP_447447.1| unnamed protein product [Candida gl... 48 6e-05
gi|29825894|gb|AAN63051.1| thioredoxin glutathione reductase [Ec... 47 1e-04
gi|29825896|gb|AAN63052.1| thioredoxin glutathione reductase [Ec... 47 1e-04
gi|50557140|ref|XP_505978.1| hypothetical protein [Yarrowia lipo... 46 2e-04
gi|33591804|ref|NP_879448.1| glutaredoxin 3 [Bordetella pertussi... 46 2e-04
gi|33595007|ref|NP_882650.1| glutaredoxin 3 [Bordetella parapert... 46 2e-04
gi|46432650|gb|EAK92123.1| hypothetical protein CaO19.4150 [Cand... 45 3e-04
gi|15149312|gb|AAK85233.1| thioredoxin glutathione reductase [Sc... 45 3e-04
gi|47215193|emb|CAG01400.1| unnamed protein product [Tetraodon n... 45 3e-04
gi|46308285|ref|ZP_00210479.1| COG0695: Glutaredoxin and related... 45 5e-04
gi|46442725|gb|EAL02012.1| hypothetical protein CaO19.13863 [Can... 44 0.001
gi|28071321|dbj|BAC56010.1| glutaredoxin protein family-like [Or... 42 0.003
gi|15229356|ref|NP_191855.1| glutaredoxin family protein [Arabid... 42 0.004
gi|6320193|ref|NP_010274.1| Hypothetical ORF; Ydl010wp [Saccharo... 41 0.005
gi|50422637|ref|XP_459892.1| unnamed protein product [Debaryomyc... 41 0.005
gi|15225333|ref|NP_179617.1| glutaredoxin family protein [Arabid... 41 0.007
gi|50086125|ref|YP_047635.1| glutaredoxin [Acinetobacter sp. ADP... 41 0.007
gi|21592635|gb|AAM64584.1| putative glutaredoxin [Arabidopsis th... 40 0.009
gi|26991730|ref|NP_747155.1| glutaredoxin [Pseudomonas putida KT... 40 0.009
gi|13752543|gb|AAK38716.1| glutaredoxin 3 [Pseudomonas fluorescens] 40 0.012
gi|19075805|ref|NP_588305.1| putative glutaredoxin-like protein ... 40 0.015
gi|50422063|ref|XP_459593.1| unnamed protein product [Debaryomyc... 40 0.015
gi|30688093|ref|NP_194602.2| glutaredoxin family protein [Arabid... 40 0.015
gi|6473192|dbj|BAA87107.1| Hypothetical protein [Schizosaccharom... 40 0.015
gi|46911913|emb|CAG18711.1| Putative peroxiredoxin/glutaredoxin ... 39 0.020
gi|15227151|ref|NP_182309.1| glutaredoxin family protein [Arabid... 39 0.020
gi|29654811|ref|NP_820503.1| glutaredoxin 3 [Coxiella burnetii R... 39 0.020
gi|9366691|emb|CAB95453.1| glutaredoxin, possible [Trypanosoma b... 39 0.020
gi|46187762|ref|ZP_00126663.2| COG0695: Glutaredoxin and related... 39 0.026
gi|28872437|ref|NP_795056.1| glutaredoxin [Pseudomonas syringae ... 39 0.026
gi|50754411|ref|XP_414371.1| PREDICTED: similar to TXNRD3 protei... 39 0.026
gi|45190623|ref|NP_984877.1| AER017Cp [Eremothecium gossypii] >g... 39 0.034
gi|15892190|ref|NP_359904.1| glutaredoxin 3 [Rickettsia conorii ... 39 0.034
gi|34580787|ref|ZP_00142267.1| glutaredoxin 3 [Rickettsia sibiri... 39 0.034
gi|32034501|ref|ZP_00134673.1| COG0678: Peroxiredoxin [Actinobac... 39 0.034
gi|28899527|ref|NP_799132.1| peroxiredoxin family protein/glutar... 38 0.045
gi|34496581|ref|NP_900796.1| glutaredoxin 3 [Chromobacterium vio... 38 0.045
gi|15642632|ref|NP_232265.1| peroxiredoxin family protein/glutar... 38 0.045
gi|47574712|ref|ZP_00244748.1| COG0695: Glutaredoxin and related... 38 0.045
gi|42520599|ref|NP_966514.1| glutaredoxin family protein [Wolbac... 37 0.076
gi|34497491|ref|NP_901706.1| probable peroxiredoxin/glutaredoxin... 37 0.076
gi|24114879|ref|NP_709389.1| glutaredoxin 3 [Shigella flexneri 2... 37 0.100
gi|33597584|ref|NP_885227.1| putative glutaredoxin [Bordetella p... 37 0.100
gi|34869088|ref|XP_229506.2| similar to RIKEN cDNA 1700001F09 [R... 37 0.100
gi|16124048|ref|NP_407361.1| putative peroxiredoxin/glutaredoxin... 37 0.100
gi|16120417|ref|NP_403730.1| glutaredoxin [Yersinia pestis] >gnl... 37 0.100
gi|33592799|ref|NP_880443.1| putative glutaredoxin [Bordetella p... 37 0.13
gi|33601987|ref|NP_889547.1| putative glutaredoxin [Bordetella b... 37 0.13
gi|11514277|pdb|1FOV|A Chain A, Glutaredoxin 3 From Escherichia ... 37 0.13
gi|15804154|ref|NP_290193.1| glutaredoxin 3 [Escherichia coli O1... 37 0.13
gi|48771801|ref|ZP_00276143.1| COG0678: Peroxiredoxin [Ralstonia... 36 0.17
gi|15604077|ref|NP_220592.1| GLUTAREDOXIN 3 (grxC1) [Rickettsia ... 36 0.17
gi|37542493|gb|AAL15432.1| thioredoxin reductase 1 [Homo sapiens] 36 0.17
gi|22023966|gb|AAM89272.1| GrxC [Serratia marcescens] 36 0.17
gi|15222209|ref|NP_172168.1| glutaredoxin family protein [Arabid... 36 0.17
gi|39596046|emb|CAE69682.1| Hypothetical protein CBG15935 [Caeno... 36 0.22
gi|45519953|ref|ZP_00171504.1| COG0695: Glutaredoxin and related... 36 0.22
gi|45506309|ref|ZP_00158666.1| COG0678: Peroxiredoxin [Anabaena ... 36 0.22
gi|17229033|ref|NP_485581.1| peroxiredoxin 2 family protein/glut... 36 0.22
gi|23128019|ref|ZP_00109876.1| COG0695: Glutaredoxin and related... 36 0.22
gi|33860739|ref|NP_892300.1| Glutaredoxin [Prochlorococcus marin... 36 0.22
gi|16762608|ref|NP_458225.1| glutaredoxin 3 [Salmonella enterica... 36 0.22
gi|15224519|ref|NP_180612.1| glutaredoxin family protein [Arabid... 35 0.29
gi|46131234|ref|ZP_00202528.1| COG0678: Peroxiredoxin [Ralstonia... 35 0.29
gi|48770352|ref|ZP_00274695.1| COG0695: Glutaredoxin and related... 35 0.29
gi|15603212|ref|NP_246286.1| unknown [Pasteurella multocida Pm70... 35 0.50
gi|34914726|ref|NP_918710.1| P0560B06.28 [Oryza sativa (japonica... 35 0.50
gi|15234046|ref|NP_195030.1| glutaredoxin family protein [Arabid... 35 0.50
gi|21593833|gb|AAM65800.1| glutaredoxin-like protein [Arabidopsi... 35 0.50
gi|33151875|ref|NP_873228.1| putative peroxiredoxin/glutaredoxin... 35 0.50
gi|15966371|ref|NP_386724.1| PROBABLE GLUTAREDOXIN 3 PROTEIN [Si... 34 0.65
gi|27367436|ref|NP_762963.1| Glutaredoxin [Vibrio vulnificus CMC... 34 0.65
gi|24112218|ref|NP_706728.1| glutaredoxin1 redox coenzyme for gl... 34 0.65
gi|45526986|ref|ZP_00178187.1| COG0695: Glutaredoxin and related... 34 0.65
gi|15229353|ref|NP_191852.1| glutaredoxin family protein [Arabid... 34 0.65
gi|16128817|ref|NP_415370.1| glutaredoxin1 redox coenzyme for gl... 34 0.65
gi|1421133|pdb|1EGO| Glutaredoxin (Oxidized) (Nmr, 20 Structure... 34 0.65
gi|21740746|emb|CAD40555.1| OSJNBa0072K14.2 [Oryza sativa (japon... 34 0.85
gi|33520041|ref|NP_878873.1| glutaredoxin 3 [Candidatus Blochman... 34 0.85
gi|15218675|ref|NP_171801.1| glutaredoxin family protein [Arabid... 34 0.85
gi|33239656|ref|NP_874598.1| Glutaredoxin [Prochlorococcus marin... 34 0.85
gi|30250143|ref|NP_842213.1| Glutaredoxin [Nitrosomonas europaea... 34 0.85
gi|15234680|ref|NP_193305.1| glutaredoxin family protein [Arabid... 33 1.1
gi|46320776|ref|ZP_00221160.1| COG0695: Glutaredoxin and related... 33 1.4
gi|15234675|ref|NP_193303.1| glutaredoxin family protein [Arabid... 33 1.4
gi|23007618|ref|ZP_00049409.1| COG0695: Glutaredoxin and related... 33 1.4
gi|12584600|emb|CAC27425.1| glutaredoxin [Platichthys flesus] 33 1.4
gi|28898007|ref|NP_797612.1| glutaredoxin 1 [Vibrio parahaemolyt... 33 1.9
gi|50303875|ref|XP_451885.1| unnamed protein product [Kluyveromy... 33 1.9
gi|27366109|ref|NP_761637.1| Glutaredoxin [Vibrio vulnificus CMC... 33 1.9
gi|38174849|emb|CAD89772.1| hypothetical protein [Melittangium l... 33 1.9
gi|15234677|ref|NP_193304.1| glutaredoxin family protein [Arabid... 33 1.9
gi|15677630|ref|NP_274789.1| glutaredoxin 3 [Neisseria meningiti... 33 1.9
gi|4699621|pdb|3GRX| Nmr Structure Of Escherichia Coli Glutared... 33 1.9
gi|48833861|ref|ZP_00290877.1| COG0695: Glutaredoxin and related... 33 1.9
gi|15793656|ref|NP_283478.1| putative glutaredoxin [Neisseria me... 33 1.9
gi|23023713|ref|ZP_00062945.1| hypothetical protein [Leuconostoc... 33 1.9
gi|48869615|ref|ZP_00322366.1| COG0526: Thiol-disulfide isomeras... 32 2.5
gi|26246872|ref|NP_752912.1| Glutaredoxin 1 [Escherichia coli CF... 32 2.5
gi|42522831|ref|NP_968211.1| glutaredoxin [Bdellovibrio bacterio... 32 2.5
gi|15800601|ref|NP_286615.1| glutaredoxin1 redox coenzyme for gl... 32 2.5
gi|23467482|ref|ZP_00123063.1| COG0678: Peroxiredoxin [Haemophil... 32 2.5
gi|49475200|ref|YP_033241.1| Glutaredoxin [Bartonella henselae s... 32 2.5
gi|48763019|ref|ZP_00267576.1| COG0695: Glutaredoxin and related... 32 3.2
gi|15641159|ref|NP_230791.1| glutaredoxin 1 [Vibrio cholerae O1 ... 32 3.2
gi|23470258|ref|ZP_00125591.1| COG0695: Glutaredoxin and related... 32 3.2
gi|13878515|sp|Q9KSW0|GLRX_VIBCH Glutaredoxin 32 3.2
gi|23015694|ref|ZP_00055463.1| COG0695: Glutaredoxin and related... 32 3.2
gi|15643789|ref|NP_228837.1| glutaredoxin [Thermotoga maritima M... 32 3.2
gi|49082466|gb|AAT50633.1| PA5129 [synthetic construct] 32 3.2
gi|26989677|ref|NP_745102.1| glutaredoxin [Pseudomonas putida KT... 32 3.2
gi|15600322|ref|NP_253816.1| glutaredoxin [Pseudomonas aeruginos... 32 3.2
gi|23103275|ref|ZP_00089760.1| COG0695: Glutaredoxin and related... 32 3.2
gi|15232836|ref|NP_186849.1| glutaredoxin family protein [Arabid... 32 4.2
gi|50259441|gb|EAL22114.1| hypothetical protein CNBC2520 [Crypto... 32 4.2
gi|48732647|ref|ZP_00266390.1| COG1651: Protein-disulfide isomer... 32 4.2
gi|15234673|ref|NP_193302.1| glutaredoxin family protein [Arabid... 32 4.2
gi|16332161|ref|NP_442889.1| glutaredoxin [Synechocystis sp. PCC... 32 4.2
gi|44681328|gb|AAS47604.1| At4g15670 [Arabidopsis thaliana] >gnl... 32 4.2
gi|32398827|emb|CAD98537.1| hypothetical predicted multi-pass tr... 31 5.5
gi|15676839|ref|NP_273984.1| peroxiredoxin 2 family protein/glut... 31 5.5
gi|33146704|dbj|BAC79508.1| glutaredoxin-like protein [Oryza sat... 31 5.5
gi|15234671|ref|NP_193301.1| glutaredoxin family protein [Arabid... 31 5.5
gi|26988202|ref|NP_743627.1| thiol:disulfide interchange protein... 31 5.5
gi|49473950|ref|YP_031992.1| Glutaredoxin [Bartonella quintana] ... 31 5.5
gi|45546882|ref|ZP_00186948.1| COG0695: Glutaredoxin and related... 31 7.2
gi|50083542|ref|YP_045052.1| thiol:disulfide interchange protein... 31 7.2
gi|46311798|ref|ZP_00212400.1| COG1651: Protein-disulfide isomer... 31 7.2
gi|27367012|ref|NP_762539.1| Glutaredoxin [Vibrio vulnificus CMC... 31 7.2
gi|34921299|sp|Q44856|BDB_BACBR Disulfide bond formation protein... 31 7.2
gi|37523252|ref|NP_926629.1| glutaredoxin [Gloeobacter violaceus... 31 7.2
gi|11499131|ref|NP_070365.1| glutaredoxin (grx-1) [Archaeoglobus... 31 7.2
gi|50557326|ref|XP_506071.1| hypothetical protein [Yarrowia lipo... 31 7.2
gi|41409396|ref|NP_962232.1| hypothetical protein MAP3298 [Mycob... 31 7.2
gi|38073415|gb|AAR10829.1| MP81 [Leishmania major] >gnl|BL_ORD_I... 30 9.3
gi|21241809|ref|NP_641391.1| glutaredoxin [Xanthomonas axonopodi... 30 9.3
gi|9294692|dbj|BAB03058.1| glutaredoxin-like protein [Arabidopsi... 30 9.3
gi|494063|pdb|1GRX| Structure Of E. Coli Glutaredoxin >gnl|BL_O... 30 9.3
>gi|17509845|ref|NP_490812.1| glutaredoxin (11.3 kD) (1B523)
[Caenorhabditis elegans]
gi|13559672|gb|AAK29881.1| Hypothetical protein Y34D9A.6
[Caenorhabditis elegans]
Length = 105
Score = 159 bits (401), Expect = 2e-38
Identities = 81/105 (77%), Positives = 81/105 (77%)
Frame = +1
Query: 1 MSKAFVDGLLQSSKVVVFSKSYCPYCHKARAALESVNVKPDALQWIEIDERKDCNEIQDY 180
MSKAFVDGLLQSSKVVVFSKSYCPYCHKARAALESVNVKPDALQWIEIDERKDCNEIQDY
Sbjct: 1 MSKAFVDGLLQSSKVVVFSKSYCPYCHKARAALESVNVKPDALQWIEIDERKDCNEIQDY 60
Query: 181 LGSLTGARSVPRVFINXXXXXXXXXXXXXXXXXXXXXXXXETGAL 315
LGSLTGARSVPRVFIN ETGAL
Sbjct: 61 LGSLTGARSVPRVFINGKFFGGGDDTAAGAKNGKLAALLKETGAL 105