Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y38A8_2
(615 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535357|ref|NP_494913.1| proteasome Beta Subunit (22.7 kD) (... 413 e-114
gi|39596786|emb|CAE59013.1| Hypothetical protein CBG02289 [Caeno... 410 e-114
gi|21355629|ref|NP_649858.1| CG11981-PA [Drosophila melanogaster... 234 1e-60
gi|31241927|ref|XP_321394.1| ENSANGP00000012182 [Anopheles gambi... 224 1e-57
gi|50760756|ref|XP_418119.1| PREDICTED: similar to Zgc:56374 [Ga... 224 1e-57
gi|7513167|pir||S55041 C 3.4.25.1 proteasome endopeptidase compl... 223 3e-57
gi|22538465|ref|NP_002786.2| proteasome beta 3 subunit; proteaso... 223 3e-57
gi|47087031|ref|NP_998529.1| zgc:56374 [Danio rerio] >gnl|BL_ORD... 222 4e-57
gi|6755202|ref|NP_036101.1| proteasome beta 3 subunit; proteasom... 222 5e-57
gi|8394082|ref|NP_058981.1| proteasome (prosome, macropain) subu... 221 8e-57
gi|6093786|sp|O73817|PSB3_ONCMY Proteasome subunit beta type 3 (... 219 3e-56
gi|17380214|sp|Q9LST7|PSB3_ORYSA Proteasome subunit beta type 3 ... 214 1e-54
gi|17380183|sp|O65084|PSB3_PICMA Proteasome subunit beta type 3 ... 213 2e-54
gi|49388033|dbj|BAD25149.1| Proteasome subunit beta type 3 [Oryz... 211 1e-53
gi|20880508|ref|XP_140340.1| similar to proteasome subunit C10-I... 207 1e-52
gi|18395025|ref|NP_564149.1| 20S proteasome beta subunit C1 (PBC... 205 5e-52
gi|29841419|gb|AAP06451.1| similar to NM_011971 proteasome (pros... 204 1e-51
gi|19928159|sp|Q9XI05|PS31_ARATH Proteasome subunit beta type 3-... 204 1e-51
gi|18411547|ref|NP_565156.1| 20S proteasome beta subunit C (PBC2... 204 1e-51
gi|50419453|ref|XP_458253.1| unnamed protein product [Debaryomyc... 204 1e-51
gi|19075485|ref|NP_587985.1| putative proteasome component [Schi... 203 2e-51
gi|21553663|gb|AAM62756.1| putative 20S proteasome beta subunit ... 202 5e-51
gi|46432996|gb|EAK92454.1| hypothetical protein CaO19.1336 [Cand... 201 9e-51
gi|47223967|emb|CAG06144.1| unnamed protein product [Tetraodon n... 198 6e-50
gi|49067673|ref|XP_398126.1| hypothetical protein UM00511.1 [Ust... 198 6e-50
gi|46432977|gb|EAK92436.1| hypothetical protein CaO19.8916 [Cand... 198 8e-50
gi|38089417|ref|XP_357902.1| similar to proteasome subunit C10-I... 196 2e-49
gi|32420593|ref|XP_330740.1| hypothetical protein [Neurospora cr... 194 1e-48
gi|34859236|ref|XP_215842.2| similar to Proteasome subunit beta ... 191 9e-48
gi|46228012|gb|EAK88932.1| possible proteasome component [Crypto... 191 1e-47
gi|50260584|gb|EAL23237.1| hypothetical protein CNBA3530 [Crypto... 190 2e-47
gi|17380264|sp|Q9NDA1|PSB3_TRYBB Proteasome subunit beta type 3 ... 189 3e-47
gi|25290060|pir||F96803 hypothetical protein T5M16.3 [imported] ... 189 4e-47
gi|46108708|ref|XP_381412.1| conserved hypothetical protein [Gib... 187 1e-46
gi|49094250|ref|XP_408586.1| conserved hypothetical protein [Asp... 187 2e-46
gi|50556674|ref|XP_505745.1| hypothetical protein [Yarrowia lipo... 186 4e-46
gi|38104184|gb|EAA50792.1| hypothetical protein MG04551.4 [Magna... 185 5e-46
gi|14594927|emb|CAC43324.1| putative beta 3 proteasome subunit [... 182 4e-45
gi|27450761|gb|AAO14683.1| beta 3 subunit of 20S proteasome [Pyr... 182 4e-45
gi|50309707|ref|XP_454865.1| unnamed protein product [Kluyveromy... 180 2e-44
gi|50290063|ref|XP_447463.1| unnamed protein product [Candida gl... 179 4e-44
gi|6320941|ref|NP_011020.1| 20S proteasome subunit beta3_sc; Pup... 177 2e-43
gi|3114278|pdb|1RYP|J Chain J, Crystal Structure Of The 20s Prot... 177 2e-43
gi|19073955|ref|NP_584561.1| 26S PROTEASOME BETA SUBUNIT, theta ... 171 1e-41
gi|45185449|ref|NP_983166.1| ABR217Cp [Eremothecium gossypii] >g... 167 1e-40
gi|29245247|gb|EAA36897.1| GLP_541_11075_11698 [Giardia lamblia ... 159 4e-38
gi|17380218|sp|Q9N9W8|PSB3_GIALA Proteasome subunit beta type 3 ... 159 4e-38
gi|23482323|gb|EAA18337.1| 7006-8626 [Plasmodium yoelii yoelii] 158 9e-38
gi|23613439|ref|NP_703283.1| beta3 proteasome subunit, putative ... 150 2e-35
gi|37779068|gb|AAP20194.1| proteasome subunit [Pagrus major] 148 7e-35
gi|730379|sp|P33672|PSB3_BOVIN Proteasome subunit beta type 3 (P... 138 7e-32
gi|34864937|ref|XP_235057.2| similar to Leukotriene A-4 hydrolas... 111 9e-24
gi|26340816|dbj|BAC34070.1| unnamed protein product [Mus musculus] 107 2e-22
gi|20892093|ref|XP_148246.1| similar to proteasome beta 3 subuni... 106 3e-22
gi|27694605|gb|AAH43739.1| Psmb1-prov protein [Xenopus laevis] 98 1e-19
gi|15669422|ref|NP_248232.1| proteasome, subunit beta (psmB) [Me... 96 5e-19
gi|50741458|ref|XP_419592.1| PREDICTED: similar to Proteasome su... 96 7e-19
gi|45360639|ref|NP_988993.1| hypothetical protein MGC75736 [Xeno... 95 9e-19
gi|12653473|gb|AAH00508.1| Proteasome beta 1 subunit [Homo sapiens] 95 1e-18
gi|4506193|ref|NP_002784.1| proteasome beta 1 subunit; proteasom... 95 1e-18
gi|21465654|pdb|1IRU|M Chain M, Crystal Structure Of The Mammali... 95 1e-18
gi|37231712|gb|AAH58455.1| Proteasome (prosome, macropain) subun... 94 2e-18
gi|7242197|ref|NP_035315.1| proteasome (prosome, macropain) subu... 94 2e-18
gi|1165123|emb|CAA56702.1| component C5 of proteasome [Mus muscu... 94 2e-18
gi|16758370|ref|NP_446042.1| proteasome (prosome, macropain) sub... 94 2e-18
gi|47217169|emb|CAG11005.1| unnamed protein product [Tetraodon n... 94 2e-18
gi|20094664|ref|NP_614511.1| Protease subunit of the proteasome ... 93 5e-18
gi|11498092|ref|NP_069317.1| proteasome, subunit beta (psmB) [Ar... 92 8e-18
gi|11357104|pir||T48677 proteasome beta-1 chain [validated] - Ha... 92 1e-17
gi|17380207|sp|Q9IB84|PS11_CARAU Proteasome subunit beta type 1-... 91 2e-17
gi|17380206|sp|Q9IB83|PS12_CARAU Proteasome subunit beta type 1-... 91 2e-17
gi|29726328|pdb|1J2Q|H Chain H, 20s Proteasome In Complex With C... 88 1e-16
gi|49619079|gb|AAT68124.1| proteasome beta-subunit C5 [Danio rerio] 88 1e-16
gi|18314179|ref|NP_560846.1| proteasome, beta subunit [Pyrobacul... 87 2e-16
gi|13812053|ref|NP_113188.1| 26S proteasome SU [Guillardia theta... 86 4e-16
gi|29247973|gb|EAA39519.1| GLP_703_43894_43130 [Giardia lamblia ... 86 4e-16
gi|392868|gb|AAC46465.1| proteasome subunit 86 4e-16
gi|17737605|ref|NP_524115.1| CG4097-PA [Drosophila melanogaster]... 86 4e-16
gi|14600766|ref|NP_147287.1| proteasome, beta subunit [Aeropyrum... 85 1e-15
gi|31212223|ref|XP_315096.1| ENSANGP00000011435 [Anopheles gambi... 82 6e-15
gi|45358258|ref|NP_987815.1| proteasome, subunit beta [Methanoco... 82 6e-15
gi|15232965|ref|NP_191641.1| 20S proteasome beta subunit F1 (PBF... 80 4e-14
gi|600387|emb|CAA47753.1| proteosome subunit [Arabidopsis thaliana] 80 4e-14
gi|15679213|ref|NP_276330.1| proteasome, beta subunit [Methanoth... 80 4e-14
gi|19115641|ref|NP_594729.1| putative proteasome component c5 [S... 79 5e-14
gi|14520958|ref|NP_126433.1| proteasome, subunit beta [Pyrococcu... 79 7e-14
gi|23613205|ref|NP_703527.1| proteasome subunit beta type 1 [Pla... 78 1e-13
gi|42407968|dbj|BAD09106.1| putative proteasome subunit beta typ... 77 2e-13
gi|17380182|sp|O64464|PSB1_ORYSA Proteasome subunit beta type 1 ... 77 3e-13
gi|18977776|ref|NP_579133.1| proteasome, subunit beta (multicata... 77 3e-13
gi|17380265|sp|Q9P992|PSMB_METTE Proteasome beta subunit precurs... 77 3e-13
gi|20092669|ref|NP_618744.1| multicatalytic endopeptidase comple... 77 3e-13
gi|15790018|ref|NP_279842.1| proteasome, subunit alpha; PsmA [Ha... 77 3e-13
gi|10121721|gb|AAG13340.1| proteasome subunit beta type 1 [Gilli... 76 4e-13
gi|14600776|ref|NP_147297.1| proteasome, beta subunit [Aeropyrum... 76 6e-13
gi|21226796|ref|NP_632718.1| Proteasome, beta subunit [Methanosa... 74 2e-12
gi|48838589|ref|ZP_00295531.1| COG0638: 20S proteasome, alpha an... 74 2e-12
gi|13541494|ref|NP_111182.1| Proteasome protease subunit beta [T... 74 2e-12
gi|17380185|sp|O82531|PSB1_PETHY Proteasome subunit beta type 1 ... 74 2e-12
gi|15920523|ref|NP_376192.1| 197aa long hypothetical proteasome ... 74 3e-12
gi|14591201|ref|NP_143277.1| proteasome beta subunit precursor [... 74 3e-12
gi|16081708|ref|NP_394085.1| proteasome, beta chain [Thermoplasm... 74 3e-12
gi|14594933|emb|CAC43327.1| putative beta6 proteasome subunit [N... 73 4e-12
gi|41614998|ref|NP_963496.1| NEQ203 [Nanoarchaeum equitans Kin4-... 72 6e-12
gi|48852543|ref|ZP_00306728.1| COG0638: 20S proteasome, alpha an... 72 8e-12
gi|28829610|gb|AAO52127.1| similar to Petunia hybrida (Petunia).... 71 1e-11
gi|18124169|gb|AAL59852.1| proteasome beta-subunit [Ginglymostom... 71 1e-11
gi|21263862|sp|Q8UW64|PSB9_ORYLA Proteasome subunit beta type 9 ... 71 2e-11
gi|15920692|ref|NP_376361.1| 207aa long hypothetical proteasome ... 70 3e-11
gi|15897221|ref|NP_341826.1| Proteasome subunit [Sulfolobus solf... 70 3e-11
gi|18859275|ref|NP_571466.1| proteasome (prosome, macropain) sub... 70 3e-11
gi|18312192|ref|NP_558859.1| proteasome beta subunit [Pyrobaculu... 70 3e-11
gi|2055311|dbj|BAA19766.1| LMP2 [Oryzias latipes] 70 4e-11
gi|46397057|sp|Q9U794|PSB1_TRYBB Proteasome subunit beta type 1 ... 69 5e-11
gi|48477758|ref|YP_023464.1| proteasome beta subunit [Picrophilu... 69 7e-11
gi|46237560|emb|CAE83940.1| proteasome (prosome, macropain) subu... 69 9e-11
gi|6981426|ref|NP_036840.1| proteosome (prosome, macropain) subu... 68 1e-10
gi|39579329|emb|CAE56933.1| Hypothetical protein CBG24778 [Caeno... 68 1e-10
gi|19074754|ref|NP_586260.1| PROTEASOME B-TYPE SUBUNIT DELTA CHA... 68 2e-10
gi|50550033|ref|XP_502489.1| hypothetical protein [Yarrowia lipo... 67 3e-10
gi|49073216|ref|XP_400840.1| hypothetical protein UM03225.1 [Ust... 67 3e-10
gi|18976531|ref|NP_577888.1| multicatalytic endopeptidase comple... 66 5e-10
gi|17554384|ref|NP_498806.1| proteasome Beta Subunit, required f... 66 5e-10
gi|630515|pir||S44611 C02F5.9 protein - Caenorhabditis elegans 66 5e-10
gi|37781216|gb|AAP36733.1| proteasome beta subunit [Xenopus trop... 66 6e-10
gi|18124172|gb|AAL59853.1| proteasome beta-subunit [Heterodontus... 66 6e-10
gi|32423127|ref|XP_332001.1| hypothetical protein [Neurospora cr... 65 8e-10
gi|9910839|sp|Q9UXF3|PSMB_SULSO Proteasome beta subunit precurso... 65 8e-10
gi|15897668|ref|NP_342273.1| Proteasome subunit [Sulfolobus solf... 65 8e-10
gi|17380240|sp|O35522|PSB9_MUSMB Proteasome subunit beta type 9 ... 65 1e-09
gi|37781212|gb|AAP36732.1| proteasome beta subunit [Xenopus trop... 65 1e-09
gi|17380242|sp|O35524|PSB9_MUSSI Proteasome subunit beta type 9 ... 65 1e-09
gi|543275|pir||JC2019 C 3.4.25.1 proteasome endopeptidase comple... 65 1e-09
gi|130856|sp|P28076|PSB9_MOUSE Proteasome subunit beta type 9 pr... 65 1e-09
gi|17380239|sp|O35521|PSB9_MUSDU Proteasome subunit beta type 9 ... 65 1e-09
gi|38101566|gb|EAA48512.1| hypothetical protein MG00170.4 [Magna... 65 1e-09
gi|172260|gb|AAA34906.1| proteosome-related protein 64 2e-09
gi|8671502|dbj|BAA96834.1| beta 1 subunit of 20S proteasome [Ory... 64 2e-09
gi|6325360|ref|NP_015428.1| 20S proteasome beta-type subunit, re... 64 2e-09
gi|14520445|ref|NP_125920.1| proteasome, subunit beta [Pyrococcu... 64 2e-09
gi|48097501|ref|XP_391905.1| similar to ENSANGP00000019976 [Apis... 64 2e-09
gi|33417116|gb|AAH56039.1| MGC68991 protein [Xenopus laevis] 64 2e-09
gi|50257328|gb|EAL20037.1| hypothetical protein CNBF3630 [Crypto... 64 2e-09
gi|8567394|ref|NP_038613.1| proteosome (prosome, macropain) subu... 64 3e-09
gi|4506205|ref|NP_002791.1| proteasome beta 9 subunit isoform 1 ... 64 3e-09
gi|23490372|gb|EAA22166.1| proteasome subunit beta type 1-relate... 64 3e-09
gi|50288021|ref|XP_446439.1| unnamed protein product [Candida gl... 64 3e-09
gi|23110932|ref|NP_683756.1| proteasome beta 9 subunit isoform 2... 64 3e-09
gi|345690|pir||S30539 C 3.4.25.1 proteasome endopeptidase comple... 63 4e-09
gi|34933825|ref|XP_344007.1| similar to Proteasome subunit beta ... 63 4e-09
gi|15231544|ref|NP_189265.1| 20S proteasome beta subunit E, puta... 63 4e-09
gi|2851557|sp|P34065|PSB5_CHICK Proteasome subunit beta type 5 p... 63 4e-09
gi|11514002|pdb|1G0U|K Chain K, A Gated Channel Into The Proteas... 63 5e-09
gi|7141312|gb|AAF37285.1| 20S proteasome beta 5 subunit [Trypano... 63 5e-09
gi|2055297|dbj|BAA19759.1| LMP2 [Xenopus laevis] 63 5e-09
gi|1405323|dbj|BAA10932.1| LMPX of lamprey [Petromyzon marinus] 63 5e-09
gi|10185394|emb|CAC08538.1| proteasome PRCE (beta-5) subunit pre... 63 5e-09
gi|11513423|pdb|1G65|K Chain K, Crystal Structure Of Epoxomicin:... 63 5e-09
gi|14590176|ref|NP_142241.1| proteasome beta subunit [Pyrococcus... 62 7e-09
gi|1071888|pir||S27332 proteasome endopeptidase complex (EC 3.4.... 62 7e-09
gi|46125017|ref|XP_387062.1| conserved hypothetical protein [Gib... 62 7e-09
gi|46228168|gb|EAK89067.1| PUP1/proteasome subunit beta type 7, ... 62 7e-09
gi|50310861|ref|XP_455453.1| unnamed protein product [Kluyveromy... 62 7e-09
gi|31239303|ref|XP_320065.1| ENSANGP00000012339 [Anopheles gambi... 62 9e-09
gi|3114280|pdb|1RYP|L Chain L, Crystal Structure Of The 20s Prot... 62 1e-08
gi|50556048|ref|XP_505432.1| hypothetical protein [Yarrowia lipo... 62 1e-08
gi|15235889|ref|NP_194858.1| 20S proteasome beta subunit A (PBA1... 61 1e-08
gi|17380241|sp|O35523|PSB9_MUSPL Proteasome subunit beta type 9 ... 61 1e-08
gi|3914430|sp|O24361|PSB5_SPIOL Proteasome subunit beta type 5 p... 61 1e-08
gi|46226580|gb|EAK87568.1| Pre2p/proteasome subunit beta type 5;... 61 1e-08
gi|4050075|gb|AAC97957.1| proteasome beta 5 subunit [Trypanosoma... 61 2e-08
gi|19113087|ref|NP_596295.1| proteasome component precursor [Sch... 61 2e-08
gi|15222152|ref|NP_172765.1| 20S proteasome beta subunit E1 (PBE... 61 2e-08
gi|15292875|gb|AAK92808.1| putative proteasome epsilon chain pre... 61 2e-08
gi|50308397|ref|XP_454200.1| unnamed protein product [Kluyveromy... 61 2e-08
gi|1405329|dbj|BAA10935.1| nurse shark LMPX [Ginglymostoma cirra... 60 3e-08
gi|50423687|ref|XP_460428.1| unnamed protein product [Debaryomyc... 60 3e-08
gi|50546901|ref|XP_500920.1| hypothetical protein [Yarrowia lipo... 60 3e-08
gi|21592365|gb|AAM64316.1| multicatalytic endopeptidase complex,... 60 4e-08
gi|50286241|ref|XP_445549.1| unnamed protein product [Candida gl... 60 4e-08
gi|1405321|dbj|BAA10931.1| LMPX of hagfish [Myxine glutinosa] 60 4e-08
gi|49093216|ref|XP_408069.1| hypothetical protein AN3932.2 [Aspe... 60 4e-08
gi|29251225|gb|EAA42708.1| GLP_81_66910_67563 [Giardia lamblia A... 60 4e-08
gi|3811395|gb|AAC69911.1| LMP 2 [Mus musculus] 59 6e-08
gi|19115456|ref|NP_594544.1| putative proteasome component precu... 59 7e-08
gi|1799522|dbj|BAA19146.1| proteasome component PUP1 precursor [... 59 7e-08
gi|17541700|ref|NP_500125.1| proteasome Beta Subunit (pbs-1) [Ca... 59 7e-08
gi|37231619|gb|AAH58451.1| Psmb6 protein [Rattus norvegicus] 58 1e-07
gi|47169486|tpe|CAE48380.1| TPA: proteasome subunit beta type 6-... 58 1e-07
gi|34874125|ref|XP_341315.1| proteasome (prosome, macropain) sub... 58 1e-07
gi|24653999|ref|NP_652031.2| CG8392-PA [Drosophila melanogaster]... 58 1e-07
gi|16768432|gb|AAL28435.1| GM04535p [Drosophila melanogaster] 58 1e-07
gi|17945936|gb|AAL49013.1| RE44901p [Drosophila melanogaster] 58 1e-07
gi|464446|sp|P28073|PSB6_RAT Proteasome subunit beta type 6 prec... 58 1e-07
gi|45190280|ref|NP_984534.1| AEL326Cp [Eremothecium gossypii] >g... 58 1e-07
gi|46436357|gb|EAK95720.1| hypothetical protein CaO19.9775 [Cand... 58 1e-07
gi|45200773|ref|NP_986343.1| AGL324Wp [Eremothecium gossypii] >g... 58 1e-07
gi|20129563|ref|NP_609804.1| CG17331-PA [Drosophila melanogaster... 58 2e-07
gi|3914434|sp|O55234|PSB5_MOUSE Proteasome subunit beta type 5 p... 58 2e-07
gi|6755204|ref|NP_035316.1| proteasome (prosome, macropain) subu... 58 2e-07
gi|15126628|gb|AAH12246.1| Proteasome (prosome, macropain) subun... 58 2e-07
gi|1346785|sp|P28075|PSB5_RAT Proteasome subunit beta type 5 pre... 58 2e-07
gi|19074564|ref|NP_586070.1| 20S PROTEASOME ALPHA-TYPE SUBUNIT [... 58 2e-07
gi|31227438|ref|XP_317882.1| ENSANGP00000019976 [Anopheles gambi... 58 2e-07
gi|23110925|ref|NP_002789.1| proteasome beta 6 subunit; proteaso... 58 2e-07
gi|50287473|ref|XP_446166.1| unnamed protein product [Candida gl... 58 2e-07
gi|46105478|ref|XP_380543.1| conserved hypothetical protein [Gib... 57 2e-07
gi|49096920|ref|XP_409920.1| hypothetical protein AN5783.2 [Aspe... 57 2e-07
gi|46441180|gb|EAL00479.1| hypothetical protein CaO19.7605 [Cand... 57 2e-07
gi|3024440|sp|P93395|PSB6_TOBAC Proteasome subunit beta type 6 p... 57 2e-07
gi|18158433|ref|NP_542945.1| proteosome (prosome, macropain) sub... 57 4e-07
gi|1172604|sp|P28064|PSB8_RAT Proteasome subunit beta type 8 pre... 57 4e-07
gi|46237562|emb|CAE83942.1| proteasome (prosome, macropain) subu... 57 4e-07
gi|50426409|ref|XP_461801.1| unnamed protein product [Debaryomyc... 57 4e-07
gi|50427419|ref|XP_462322.1| unnamed protein product [Debaryomyc... 57 4e-07
gi|26347247|dbj|BAC37272.1| unnamed protein product [Mus musculu... 56 5e-07
gi|17380261|sp|Q60692|PSB6_MOUSE Proteasome subunit beta type 6 ... 56 5e-07
gi|30584671|gb|AAP36588.1| Homo sapiens proteasome (prosome, mac... 56 5e-07
gi|4506201|ref|NP_002788.1| proteasome beta 5 subunit; proteasom... 56 5e-07
gi|6324731|ref|NP_014800.1| putative proteasome subunit; Pup1p [... 56 5e-07
gi|32400975|gb|AAP80693.1| proteasome subunit [Griffithsia japon... 56 5e-07
gi|48139584|ref|XP_393468.1| similar to Proteasome subunit beta ... 56 5e-07
gi|31874085|emb|CAD97956.1| hypothetical protein [Homo sapiens] 56 5e-07
gi|1172607|sp|P28074|PSB5_HUMAN Proteasome subunit beta type 5 p... 56 5e-07
gi|49092338|ref|XP_407630.1| hypothetical protein AN3493.2 [Aspe... 56 5e-07
gi|1362909|pir||B54589 proteasome subunit Y - human 56 5e-07
gi|558528|dbj|BAA06098.1| proteasome subunit Y [Homo sapiens] 56 5e-07
gi|39587961|emb|CAE67980.1| Hypothetical protein CBG13586 [Caeno... 56 5e-07
gi|47228090|emb|CAF97719.1| unnamed protein product [Tetraodon n... 56 6e-07
gi|3114276|pdb|1RYP|H Chain H, Crystal Structure Of The 20s Prot... 56 6e-07
gi|12845889|dbj|BAB26942.1| unnamed protein product [Mus musculus] 56 6e-07
gi|49092864|ref|XP_407893.1| conserved hypothetical protein [Asp... 56 6e-07
gi|50311275|ref|XP_455662.1| unnamed protein product [Kluyveromy... 56 6e-07
gi|2136006|pir||I52906 proteasome subunit MB1 - human (fragment)... 56 6e-07
gi|49088894|ref|XP_406222.1| hypothetical protein AN2085.2 [Aspe... 55 8e-07
gi|41352683|gb|AAS01048.1| putative proteasome 20S beta1 subunit... 55 1e-06
gi|16588840|gb|AAL26914.1| putative 20S proteasome beta subunit ... 55 1e-06
gi|49069202|ref|XP_398890.1| hypothetical protein UM01275.1 [Ust... 55 1e-06
gi|27802774|emb|CAD60863.1| SI:zC14A17.1 (proteasome (prosome, m... 55 1e-06
gi|5833459|gb|AAD53518.1| proteasome subunit beta 5 [Danio rerio] 55 1e-06
gi|2055299|dbj|BAA19760.1| proteasome subunit Y [Xenopus laevis] 55 1e-06
gi|41352685|gb|AAS01049.1| putative proteasome 20S beta1.1 subun... 55 1e-06
gi|48101578|ref|XP_395163.1| similar to ENSANGP00000011435 [Apis... 55 1e-06
gi|2654058|gb|AAB87679.1| LMP7 [Danio rerio] >gnl|BL_ORD_ID|1797... 55 1e-06
gi|2134182|pir||I51536 XeLMPa.aa - African clawed frog >gnl|BL_O... 55 1e-06
gi|6322459|ref|NP_012533.1| 20S proteasome beta-type subunit, re... 55 1e-06
gi|50257480|gb|EAL20187.1| hypothetical protein CNBF2630 [Crypto... 55 1e-06
gi|47216876|emb|CAG11683.1| unnamed protein product [Tetraodon n... 55 1e-06
gi|50293069|ref|XP_448962.1| unnamed protein product [Candida gl... 55 1e-06
gi|3114281|pdb|1RYP|M Chain M, Crystal Structure Of The 20s Prot... 55 1e-06
gi|48096398|ref|XP_394680.1| similar to ENSANGP00000018548 [Apis... 55 1e-06
gi|38104270|gb|EAA50863.1| hypothetical protein MG04622.4 [Magna... 55 1e-06
gi|21465653|pdb|1IRU|L Chain L, Crystal Structure Of The Mammali... 55 1e-06
gi|6319430|ref|NP_009512.1| 20S proteasome beta-type subunit; Pr... 55 1e-06
gi|21465649|pdb|1IRU|H Chain H, Crystal Structure Of The Mammali... 54 2e-06
gi|2055313|dbj|BAA19767.1| LMP7 [Oryzias latipes] 54 2e-06
gi|49078886|ref|XP_403150.1| hypothetical protein UM05535.1 [Ust... 54 2e-06
gi|45184652|ref|NP_982370.1| AAL172Cp [Eremothecium gossypii] >g... 54 2e-06
gi|47271420|ref|NP_571467.2| proteasome (prosome, macropain) sub... 54 2e-06
gi|45361029|ref|NP_989151.1| hypothetical protein MGC75674 [Xeno... 54 2e-06
gi|11513426|pdb|1G65|N Chain N, Crystal Structure Of Epoxomicin:... 54 3e-06
gi|50550679|ref|XP_502812.1| hypothetical protein [Yarrowia lipo... 54 3e-06
gi|18539490|gb|AAL74417.1| proteosome PSMB5/8 protein [Branchios... 54 3e-06
gi|37589390|gb|AAH59335.1| MGC69086 protein [Xenopus laevis] 54 3e-06
gi|23619227|ref|NP_705189.1| proteasome subunit beta type 7 prec... 53 4e-06
gi|24664391|ref|NP_524076.2| CG3329-PA [Drosophila melanogaster]... 53 4e-06
gi|2134183|pir||I51537 XeLMPb.aa - African clawed frog >gnl|BL_O... 53 4e-06
gi|3114277|pdb|1RYP|I Chain I, Crystal Structure Of The 20s Prot... 53 5e-06
gi|14488813|pdb|1FNT|I Chain I, Crystal Structure Of The 20s Pro... 53 5e-06
gi|50878269|ref|NP_571226.1| proteasome (prosome, macropain) sub... 53 5e-06
gi|46142175|ref|ZP_00147899.2| COG0638: 20S proteasome, alpha an... 53 5e-06
gi|50419349|ref|XP_458199.1| unnamed protein product [Debaryomyc... 53 5e-06
gi|8919092|emb|CAB96046.1| proteasome beta 2 subunit [Giardia in... 52 7e-06
gi|48146081|emb|CAG33263.1| PSMB10 [Homo sapiens] 52 7e-06
gi|2511578|emb|CAA73621.1| multicatalytic endopeptidase [Arabido... 52 7e-06
gi|29247395|gb|EAA38958.1| GLP_205_2996_3817 [Giardia lamblia AT... 52 7e-06
gi|4506191|ref|NP_002792.1| proteasome beta 10 subunit proprotei... 52 7e-06
gi|18405364|ref|NP_566818.1| 20S proteasome beta subunit B (PBB1... 52 7e-06
gi|30688785|ref|NP_850641.1| 20S proteasome beta subunit B (PBB1... 52 7e-06
gi|6755208|ref|NP_034854.1| proteosome (prosome, macropain) subu... 52 7e-06
gi|32418502|ref|XP_329729.1| hypothetical protein [Neurospora cr... 52 7e-06
gi|88166|pir||S17522 C 3.4.25.1 proteasome endopeptidase complex... 52 7e-06
gi|4758970|ref|NP_004150.1| proteasome beta 8 subunit isoform E1... 52 7e-06
gi|49456283|emb|CAG46462.1| PSMB8 [Homo sapiens] 52 7e-06
gi|8671504|dbj|BAA96835.1| beta 2 subunit of 20S proteasome [Ory... 52 7e-06
gi|1082739|pir||C44324 proteasome endopeptidase complex (EC 3.4.... 52 7e-06
gi|596142|gb|AAA56778.1| proteasome subunit LMP7 52 7e-06
gi|23110929|ref|NP_683720.1| proteasome beta 8 subunit isoform E... 52 7e-06
gi|7435870|pir||G01564 proteasome chain LMP7 precursor, splice f... 52 7e-06
gi|2133439|pir||JC5073 proteasome epsilon chain precursor - Geod... 52 9e-06
gi|476044|emb|CAA55591.1| proteasomal subunit Pre3 [Saccharomyce... 52 9e-06
gi|20260224|gb|AAM13010.1| 20S proteasome beta subunit PBB2 [Ara... 52 9e-06
gi|21593337|gb|AAM65286.1| 20S proteasome beta subunit PBB2 [Ara... 52 9e-06
gi|28573221|ref|NP_649515.3| CG12161-PA [Drosophila melanogaster... 52 1e-05
gi|12003013|gb|AAG43440.1| low molecular mass protein 7 [Salmo s... 52 1e-05
gi|20302762|gb|AAM18885.1| unknown [Branchiostoma floridae] 52 1e-05
gi|16923940|ref|NP_476440.1| proteasome (prosome, macropain) sub... 52 1e-05
gi|31204967|ref|XP_311432.1| ENSANGP00000018548 [Anopheles gambi... 52 1e-05
gi|18859271|ref|NP_571227.1| proteasome (prosome, macropain) sub... 52 1e-05
gi|673450|emb|CAA45780.1| proteasome subunit MC13 [Mus musculus] 52 1e-05
gi|972990|gb|AAA75037.1| 20S proteasome subunit Lmp7 [Mus musculus] 52 1e-05
gi|1172603|sp|P28063|PSB8_MOUSE Proteasome subunit beta type 8 p... 52 1e-05
gi|972986|gb|AAA75035.1| 20S proteasome subunit Lmp7 [Mus muscul... 52 1e-05
gi|12003011|gb|AAG43439.1| low molecular mass protein 7 [Salmo s... 51 2e-05
gi|14594931|emb|CAC43326.1| putative beta5 proteasome subunit [N... 51 2e-05
gi|15237451|ref|NP_198874.1| 20S proteasome beta subunit B (PBB2... 51 2e-05
gi|49077212|ref|XP_402498.1| hypothetical protein UM04883.1 [Ust... 51 2e-05
gi|2564233|emb|CAA05209.1| proteasome Z subunit [Ciona intestina... 51 2e-05
gi|50302329|ref|XP_451099.1| unnamed protein product [Kluyveromy... 51 2e-05
gi|3980264|emb|CAA09603.1| 20S proteasome beta subunit [Cicer ar... 50 3e-05
gi|27659052|ref|XP_214687.1| similar to proteasome (prosome, mac... 50 3e-05
gi|1405327|dbj|BAA10934.1| LMP7 [Ginglymostoma cirratum] 50 3e-05
gi|984938|gb|AAA75375.1| delta proteasome subunit 50 3e-05
gi|2118156|pir||I49121 C 3.4.25.1 proteasome endopeptidase compl... 50 3e-05
gi|19070763|gb|AAL83984.1| proteasome subunit [Oryza sativa] 50 3e-05
gi|23507915|ref|NP_700585.1| 20S proteasome beta subunit, putati... 50 3e-05
gi|50540152|ref|NP_001002543.1| zgc:92791 [Danio rerio] >gnl|BL_... 50 3e-05
gi|17508499|ref|NP_493558.1| proteasome Beta Subunit (31.2 kD) (... 50 3e-05
gi|23480306|gb|EAA16900.1| proteasome subunit, beta type, 7 [Pla... 50 3e-05
gi|46122507|ref|XP_385807.1| conserved hypothetical protein [Gib... 50 3e-05
gi|39584419|emb|CAE72557.1| Hypothetical protein CBG19741 [Caeno... 50 4e-05
gi|47522620|ref|NP_999100.1| proteasome subunit LMP7 [Sus scrofa... 50 4e-05
gi|19173511|ref|NP_597314.1| 20S PROTEASOME BETA-TYPE SUBUNIT CO... 50 4e-05
gi|20130281|ref|NP_611776.1| CG9868-PA [Drosophila melanogaster]... 50 4e-05
gi|10803370|emb|CAC13117.1| low molecular mass polypeptide subun... 50 4e-05
gi|18447060|gb|AAL68121.1| AT21741p [Drosophila melanogaster] 50 4e-05
gi|38104159|gb|EAA50770.1| hypothetical protein MG04529.4 [Magna... 50 4e-05
gi|19111957|ref|NP_595165.1| proteasome component; PROS28 family... 49 6e-05
gi|41352687|gb|AAS01050.1| putative proteasome 20S beta5 subunit... 49 6e-05
gi|46228005|gb|EAK88925.1| Pre3p/proteasome regulatory subunit b... 49 6e-05
gi|1708781|emb|CAA66313.1| LMP7-like protein [Botryllus schlosseri] 49 6e-05
gi|2144253|pir||JC5074 proteasome epsilon chain precursor - Botr... 49 6e-05
gi|21355573|ref|NP_652014.1| CG12323-PA [Drosophila melanogaster... 49 6e-05
gi|6715438|gb|AAF26416.1| 20S proteasome beta5 subunit [Drosophi... 49 6e-05
gi|8117714|gb|AAF72737.1| proteasome B type subunit [Cryptospori... 49 6e-05
gi|2582504|gb|AAB82570.1| 20S proteasome beta2 subunit [Drosophi... 49 6e-05
gi|296734|emb|CAA43963.1| macropain subunit delta [Homo sapiens] 49 6e-05
gi|28317309|gb|AAO39651.1| AT12292p [Drosophila melanogaster] 49 6e-05
gi|24639979|ref|NP_572267.1| CG18341-PA [Drosophila melanogaster... 49 6e-05
gi|45184943|ref|NP_982661.1| AAR119Wp [Eremothecium gossypii] >g... 49 8e-05
gi|2654060|gb|AAB87680.1| proteasome subunit X [Danio rerio] 49 8e-05
gi|32423089|ref|XP_331982.1| hypothetical protein [Neurospora cr... 49 8e-05
gi|17380243|sp|O35955|PSBA_MOUSE Proteasome subunit beta type 10... 49 1e-04
gi|13435741|gb|AAH04730.1| Proteasome (prosome, macropain) subun... 49 1e-04
gi|38108003|gb|EAA54101.1| hypothetical protein MG02086.4 [Magna... 49 1e-04
gi|28273089|dbj|BAC56920.1| proteosome A [Theileria orientalis] 49 1e-04
gi|2582506|gb|AAB82571.1| 20S proteasome beta2 subunit [Drosophi... 49 1e-04
gi|50405049|ref|YP_054141.1| Proteosome subunit, putative [Param... 48 1e-04
gi|2511568|emb|CAA73616.1| multicatalytic endopeptidase [Arabido... 48 1e-04
gi|19114737|ref|NP_593825.1| proteasome component pts1 precursor... 48 1e-04
gi|320623|pir||JS0753 C 3.4.25.1 proteasome endopeptidase comple... 48 1e-04
gi|38047537|gb|AAR09671.1| similar to Drosophila melanogaster Pr... 48 1e-04
gi|7305417|ref|NP_038668.1| proteasome (prosome, macropain) subu... 48 2e-04
gi|31982099|ref|NP_032972.2| proteasome (prosome, macropain) sub... 47 2e-04
gi|5823090|gb|AAD53036.1| proteasome delta [Oncorhynchus mykiss] 47 2e-04
gi|30802211|gb|AAH51450.1| Similar to proteosome (prosome, macro... 47 2e-04
gi|23483352|gb|EAA19051.1| proteosome PSMB5/8 protein [Plasmodiu... 47 3e-04
gi|46108636|ref|XP_381376.1| hypothetical protein FG01200.1 [Gib... 47 3e-04
gi|21228722|ref|NP_634644.1| Proteasome, subunit-alpha [Methanos... 47 3e-04
gi|10803371|emb|CAC13118.1| low molecular mass polypeptide subun... 47 4e-04
gi|29246576|gb|EAA38167.1| GLP_675_9982_10866 [Giardia lamblia A... 47 4e-04
gi|20090630|ref|NP_616705.1| multicatalytic endopeptidase comple... 46 5e-04
gi|47210318|emb|CAF91166.1| unnamed protein product [Tetraodon n... 46 5e-04
gi|37778970|gb|AAP20145.1| 20S proteasome beta 6 subunit [Pagrus... 46 5e-04
gi|13812188|ref|NP_113318.1| 26S proteasome SU B6 [Guillardia th... 46 5e-04
gi|6492303|gb|AAF14267.1| 20S proteasome beta-subunit precursor ... 46 6e-04
gi|4218580|emb|CAA10208.1| proteasome subunit beta-2 [Trypanosom... 46 6e-04
gi|23612640|ref|NP_704201.1| proteasome subunit alpha type 5, pu... 45 0.001
gi|46436285|gb|EAK95650.1| hypothetical protein CaO19.6991 [Cand... 45 0.001
gi|18921038|gb|AAL82481.1| proteasome subunit LMP10 [Bos taurus] 45 0.001
gi|50554559|ref|XP_504688.1| hypothetical protein [Yarrowia lipo... 45 0.001
gi|1405325|dbj|BAA10933.1| LMP7 of nurse shark [Ginglymostoma ci... 45 0.001
gi|24581176|ref|NP_608698.2| CG17301-PA [Drosophila melanogaster... 45 0.001
gi|6653277|gb|AAF22654.1| interferon-gamma inducible proteasome ... 44 0.003
gi|284628|pir||B42762 C 3.4.25.1 proteasome endopeptidase comple... 44 0.003
gi|47210559|emb|CAF96424.1| unnamed protein product [Tetraodon n... 43 0.004
gi|20093823|ref|NP_613670.1| Protease subunit of the proteasome ... 43 0.004
gi|45550918|ref|NP_722823.2| CG17302-PA [Drosophila melanogaster... 43 0.004
gi|45184842|ref|NP_982560.1| AAR019Wp [Eremothecium gossypii] >g... 43 0.005
gi|6320849|ref|NP_010928.1| 20S proteasome beta-type subunit; lo... 42 0.007
gi|19173194|ref|NP_596997.1| PROTEASOME BETA-TYPE SUBUNIT (MACRO... 42 0.007
gi|23489205|gb|EAA21516.1| proteasome subunit alpha type 5 [Plas... 42 0.009
gi|47216875|emb|CAG11682.1| unnamed protein product [Tetraodon n... 42 0.009
gi|18124200|gb|AAL59861.1| proteasome beta-subunit LMP7-like pro... 42 0.009
gi|29250887|gb|EAA42374.1| GLP_137_15973_15398 [Giardia lamblia ... 42 0.009
gi|50259965|gb|EAL22631.1| hypothetical protein CNBB2630 [Crypto... 42 0.009
gi|24644201|ref|NP_649529.1| CG12000-PA [Drosophila melanogaster... 42 0.012
gi|23491164|gb|EAA22766.1| proteasome beta-subunit, putative [Pl... 41 0.016
gi|46442133|gb|EAL01425.1| hypothetical protein CaO19.10269 [Can... 41 0.016
gi|50807165|ref|XP_424548.1| PREDICTED: similar to zeta proteaso... 41 0.016
gi|39589722|emb|CAE66957.1| Hypothetical protein CBG12349 [Caeno... 41 0.016
gi|50404970|ref|YP_054062.1| Proteasome subunit, putative [Param... 41 0.016
gi|25290071|pir||T51986 C 3.4.25.1 proteasome endopeptidase comp... 41 0.021
gi|32413036|ref|XP_326998.1| hypothetical protein [Neurospora cr... 41 0.021
gi|49118346|gb|AAH73346.1| Unknown (protein for MGC:80760) [Xeno... 40 0.027
gi|46142155|ref|ZP_00147872.2| COG0638: 20S proteasome, alpha an... 40 0.027
gi|47222687|emb|CAG00121.1| unnamed protein product [Tetraodon n... 40 0.027
gi|38101759|gb|EAA48673.1| hypothetical protein MG00331.4 [Magna... 40 0.027
gi|17508491|ref|NP_492360.1| proteasome Alpha Subunit (28.2 kD) ... 40 0.027
gi|21465646|pdb|1IRU|E Chain E, Crystal Structure Of The Mammali... 40 0.027
gi|88168|pir||S17521 C 3.4.25.1 proteasome endopeptidase complex... 40 0.027
gi|41352543|gb|AAS01024.1| proteasome alpha subunit [Ornithodoro... 40 0.027
gi|45387823|ref|NP_991271.1| proteasome subunit, alpha type, 5 [... 40 0.027
gi|284629|pir||C42762 C 3.4.25.1 proteasome endopeptidase comple... 40 0.027
gi|50304213|ref|XP_452056.1| unnamed protein product [Kluyveromy... 40 0.027
gi|7106387|ref|NP_036097.1| proteasome (prosome, macropain) subu... 40 0.035
gi|47227266|emb|CAF96815.1| unnamed protein product [Tetraodon n... 40 0.035
gi|32414343|ref|XP_327651.1| hypothetical protein [Neurospora cr... 40 0.046
gi|17223778|gb|AAL18244.1| proteasomal subunit beta type III [Mu... 40 0.046
gi|46432997|gb|EAK92455.1| hypothetical protein CaO19.1337 [Cand... 40 0.046
gi|45357814|ref|NP_987371.1| proteasome, subunit alpha [Methanoc... 39 0.060
gi|17508493|ref|NP_492765.1| proteasome Alpha Subunit (27.2 kD) ... 39 0.060
gi|13021641|gb|AAK11501.1| proteasome theta chain [Xenopus laevis] 39 0.060
gi|12229946|sp|Q9V2V6|PSM1_HALVO Proteasome alpha-1 subunit (Mul... 39 0.060
gi|17380213|sp|Q9LST6|PSB2_ORYSA Proteasome subunit beta type 2 ... 39 0.060
gi|7435894|pir||JE0101 proteasome subunit 1 - slime mold (Dictyo... 39 0.060
gi|16800385|ref|NP_470653.1| highly similar to beta-type subunit... 39 0.078
gi|27552546|gb|AAO19369.1| 20S proteasome beta 4 subunit [Oryza ... 39 0.078
gi|8394072|ref|NP_058978.1| proteasome (prosome, macropain) subu... 39 0.078
gi|3914440|sp|Q27563|PSA3_DICDI Proteasome subunit alpha type 3 ... 39 0.10
gi|454256|emb|CAA82203.1| Pre2p [Saccharomyces cerevisiae] 39 0.10
gi|3122620|sp|Q29576|PSB8_PIG Proteasome subunit beta type 8 (Pr... 39 0.10
gi|14594921|emb|CAC43321.1| putative beta proteasome subunit [Ni... 38 0.13
gi|47094601|ref|ZP_00232246.1| ATP-dependent protease HslV [List... 38 0.13
gi|16803318|ref|NP_464803.1| highly similar to beta-type subunit... 38 0.13
gi|16805254|ref|NP_473282.1| proteasome component C8, putative [... 37 0.23
gi|50660436|gb|AAT80906.1| 26S proteasome beta subunit [Lemna mi... 37 0.23
gi|46432978|gb|EAK92437.1| hypothetical protein CaO19.8917 [Cand... 37 0.23
gi|48477876|ref|YP_023582.1| proteasome alpha subunit [Picrophil... 37 0.23
gi|6755198|ref|NP_036098.1| proteasome (prosome, macropain) subu... 37 0.30
gi|8394076|ref|NP_058979.1| proteasome (prosome, macropain) subu... 37 0.30
gi|45198776|ref|NP_985805.1| AFR258Wp [Eremothecium gossypii] >g... 37 0.30
gi|47605682|sp|Q84F94|HSLV_MYXXA ATP-dependent protease hslV >gn... 37 0.39
gi|37546059|ref|XP_063287.6| similar to RIKEN cDNA 5830406J20 [H... 37 0.39
gi|19921232|ref|NP_609623.1| CG5648-PA [Drosophila melanogaster]... 37 0.39
gi|23482682|gb|EAA18594.1| proteasome beta-subunit [Plasmodium y... 36 0.51
gi|9408027|emb|CAB99309.1| proteasome beta-5 subunit [Giardia in... 36 0.51
gi|1045471|gb|AAA80235.1| large multifunctional protease 7 [Homo... 36 0.51
gi|20302768|gb|AAM18890.1| unknown [Branchiostoma floridae] 36 0.51
gi|1448947|gb|AAB04621.1| heat shock protein 36 0.51
gi|15594641|ref|NP_212430.1| heat shock protein (hslV) [Borrelia... 36 0.51
gi|27700006|ref|XP_224175.1| similar to Proteasome subunit beta ... 36 0.66
gi|28207945|emb|CAD62626.1| unnamed protein product [Homo sapiens] 36 0.66
gi|38103615|gb|EAA50294.1| hypothetical protein MG04053.4 [Magna... 35 0.86
gi|296736|emb|CAA43964.1| macropain subunit iota [Homo sapiens] 35 0.86
gi|34862138|ref|XP_345014.1| similar to Proteasome subunit beta ... 35 1.1
gi|39580819|emb|CAE58988.1| Hypothetical protein CBG02261 [Caeno... 35 1.1
gi|45184835|ref|NP_982553.1| AAR012Cp [Eremothecium gossypii] >g... 35 1.5
gi|26353354|dbj|BAC40307.1| unnamed protein product [Mus musculus] 35 1.5
gi|30424826|ref|NP_780413.1| RIKEN cDNA 5830406J20 [Mus musculus... 35 1.5
gi|24584895|ref|NP_724081.1| CG31742-PA [Drosophila melanogaster... 35 1.5
gi|19112166|ref|NP_595374.1| 20S proteasome component (alpha 1) ... 34 1.9
gi|23613831|ref|NP_704852.1| proteosome precursor, putative [Pla... 34 1.9
gi|50303013|ref|XP_451444.1| unnamed protein product [Kluyveromy... 34 2.5
gi|16082284|ref|NP_394744.1| proteasome alpha subunit [Thermopla... 34 2.5
gi|46436840|gb|EAK96196.1| hypothetical protein CaO19.7178 [Cand... 34 2.5
gi|31211921|ref|XP_314945.1| ENSANGP00000019329 [Anopheles gambi... 34 2.5
gi|47184838|emb|CAF87014.1| unnamed protein product [Tetraodon n... 33 3.3
gi|11513994|pdb|1G0U|C Chain C, A Gated Channel Into The Proteas... 33 3.3
gi|3114272|pdb|1RYP|D Chain D, Crystal Structure Of The 20s Prot... 33 3.3
gi|15594992|ref|NP_212781.1| ferric uptake regulation protein (f... 33 3.3
gi|42659854|ref|XP_208060.3| similar to tripartite motif-contain... 33 3.3
gi|6324535|ref|NP_014604.1| 20S proteasome alpha-type subunit; P... 33 3.3
gi|29827297|ref|NP_821931.1| hypothetical protein SAV756 [Strept... 33 3.3
gi|23112165|ref|ZP_00097687.1| hypothetical protein [Desulfitoba... 33 4.3
gi|27802773|emb|CAD60862.1| SI:zC14A17.13 (novel protein similar... 33 4.3
gi|50285195|ref|XP_445026.1| unnamed protein product [Candida gl... 33 4.3
gi|18417671|ref|NP_567856.1| pentatricopeptide (PPR) repeat-cont... 33 4.3
gi|25407684|pir||G85360 puative protein [imported] - Arabidopsis... 33 4.3
gi|46121687|ref|XP_385398.1| conserved hypothetical protein [Gib... 33 4.3
gi|3228662|gb|AAC23597.1| proteasome A type subunit [Cryptospori... 33 5.6
gi|39725451|emb|CAE45687.1| hypothetical protein [Streptomyces p... 33 5.6
gi|46227993|gb|EAK88913.1| proteasome subunit alpha type 1, NTN ... 33 5.6
gi|45185919|ref|NP_983635.1| ACR233Wp [Eremothecium gossypii] >g... 33 5.6
gi|14249256|ref|NP_116070.1| tripartite motif-containing 51 [Hom... 32 7.3
gi|27151809|gb|AAM76148.2| proteosome subunit Y [Boltenia villosa] 32 7.3
gi|50427307|ref|XP_462266.1| unnamed protein product [Debaryomyc... 32 7.3
gi|3114274|pdb|1RYP|F Chain F, Crystal Structure Of The 20s Prot... 32 7.3
gi|6323974|ref|NP_014045.1| 20S proteasome alpha-type subunit; P... 32 7.3
gi|45528284|ref|ZP_00179483.1| COG1020: Non-ribosomal peptide sy... 32 9.5
gi|23483153|gb|EAA18916.1| proteasome subunit beta type 2 [Plasm... 32 9.5
gi|46810472|gb|AAT01617.1| omega gliadin [Triticum aestivum] 32 9.5
gi|634095|emb|CAA58746.1| D13094 [Schizosaccharomyces pombe] 32 9.5
>gi|17535357|ref|NP_494913.1| proteasome Beta Subunit (22.7 kD)
(pbs-3) [Caenorhabditis elegans]
gi|17380195|sp|Q23237|PSB3_CAEEL Proteasome subunit beta type 3
(Proteasome subunit beta 3)
gi|7509595|pir||T26649 hypothetical protein Y38A8.2 -
Caenorhabditis elegans
gi|1280152|gb|AAA98018.1| Proteasome beta subunit protein 3
[Caenorhabditis elegans]
Length = 204
Score = 413 bits (1062), Expect = e-114
Identities = 204/204 (100%), Positives = 204/204 (100%)
Frame = -1
Query: 615 MSIMSYTGGTVVAMAGDECVCIASDLRIGEQMTTIATDQKKVHKVTDKVYVGLAGFQSDA 436
MSIMSYTGGTVVAMAGDECVCIASDLRIGEQMTTIATDQKKVHKVTDKVYVGLAGFQSDA
Sbjct: 1 MSIMSYTGGTVVAMAGDECVCIASDLRIGEQMTTIATDQKKVHKVTDKVYVGLAGFQSDA 60
Query: 435 RTVLEKIMFRKNLYELRENRNIKPQVLSEMISNLAYQHRFGSYFTEPLVAGLDDTNKPYI 256
RTVLEKIMFRKNLYELRENRNIKPQVLSEMISNLAYQHRFGSYFTEPLVAGLDDTNKPYI
Sbjct: 61 RTVLEKIMFRKNLYELRENRNIKPQVLSEMISNLAYQHRFGSYFTEPLVAGLDDTNKPYI 120
Query: 255 CCMDTIGCVSAPRDFVAVGTGQEYLLGVCENFWRENMKPDELFEATAQSILSCLERDAAS 76
CCMDTIGCVSAPRDFVAVGTGQEYLLGVCENFWRENMKPDELFEATAQSILSCLERDAAS
Sbjct: 121 CCMDTIGCVSAPRDFVAVGTGQEYLLGVCENFWRENMKPDELFEATAQSILSCLERDAAS 180
Query: 75 GWGAVVYTITKDKVNVSTIKARMD 4
GWGAVVYTITKDKVNVSTIKARMD
Sbjct: 181 GWGAVVYTITKDKVNVSTIKARMD 204
>gi|39596786|emb|CAE59013.1| Hypothetical protein CBG02289
[Caenorhabditis briggsae]
Length = 204
Score = 410 bits (1055), Expect = e-114
Identities = 202/204 (99%), Positives = 203/204 (99%)
Frame = -1
Query: 615 MSIMSYTGGTVVAMAGDECVCIASDLRIGEQMTTIATDQKKVHKVTDKVYVGLAGFQSDA 436
MSIMSYTGGTVVAMAGDECVCIASDLRIGEQMTTIATDQKKVHKVTDKVYVGLAGFQSDA
Sbjct: 1 MSIMSYTGGTVVAMAGDECVCIASDLRIGEQMTTIATDQKKVHKVTDKVYVGLAGFQSDA 60
Query: 435 RTVLEKIMFRKNLYELRENRNIKPQVLSEMISNLAYQHRFGSYFTEPLVAGLDDTNKPYI 256
RTVLEKIMFRKNLYELRENR IKPQVLSEMISNLAYQHRFGSYFTEPLVAGLDDTNKPYI
Sbjct: 61 RTVLEKIMFRKNLYELRENRRIKPQVLSEMISNLAYQHRFGSYFTEPLVAGLDDTNKPYI 120
Query: 255 CCMDTIGCVSAPRDFVAVGTGQEYLLGVCENFWRENMKPDELFEATAQSILSCLERDAAS 76
CCMDTIGCVSAPRDFVAVGTGQEYLLGVCENFWRENMKPDELFEATAQSILSCLERDAAS
Sbjct: 121 CCMDTIGCVSAPRDFVAVGTGQEYLLGVCENFWRENMKPDELFEATAQSILSCLERDAAS 180
Query: 75 GWGAVVYTITKDKVNVSTIKARMD 4
GWGAVVYTITKDKVN+STIKARMD
Sbjct: 181 GWGAVVYTITKDKVNISTIKARMD 204