Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y38C1BA_4
         (876 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17543166|ref|NP_500138.1| COLlagen structural gene (29.0 kD) ...   228   1e-58
gi|39583745|emb|CAE63849.1| Hypothetical protein CBG08408 [Caeno...   225   9e-58
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ...    94   3e-18
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno...    92   1e-17
gi|39588941|emb|CAE69571.1| Hypothetical protein CBG15783 [Caeno...    86   1e-15
gi|17557099|ref|NP_499700.1| COLlagen structural gene (30.3 kD) ...    85   2e-15
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [...    80   8e-14
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno...    79   1e-13
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ...    79   1e-13
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno...    79   1e-13
gi|687634|gb|AAA62504.1| collagen                                      78   2e-13
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ...    78   2e-13
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ...    78   2e-13
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno...    78   2e-13
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno...    78   3e-13
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ...    78   3e-13
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C...    77   4e-13
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ...    77   4e-13
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C...    77   5e-13
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno...    76   9e-13
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ...    76   1e-12
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno...    76   1e-12
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno...    76   1e-12
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-...    75   1e-12
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [...    75   1e-12
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno...    75   2e-12
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno...    74   3e-12
gi|39592242|emb|CAE75463.1| Hypothetical protein CBG23461 [Caeno...    74   6e-12
gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT...    74   6e-12
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ...    74   6e-12
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >...    73   7e-12
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ...    73   7e-12
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno...    73   7e-12
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl...    73   7e-12
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno...    73   7e-12
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno...    72   2e-11
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno...    72   2e-11
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno...    72   2e-11
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ...    71   4e-11
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ...    71   4e-11
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ...    71   4e-11
gi|17561476|ref|NP_505888.1| COLlagen structural gene (col-155) ...    53   5e-11
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno...    70   6e-11
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ...    70   6e-11
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ...    70   6e-11
gi|39588940|emb|CAE69570.1| Hypothetical protein CBG15782 [Caeno...    69   1e-10
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno...    67   4e-10
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e...    67   5e-10
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ...    67   7e-10
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [...    66   1e-09
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_...    66   1e-09
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus)       66   1e-09
gi|39596498|emb|CAE63117.1| Hypothetical protein CBG07414 [Caeno...    65   2e-09
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans]             65   2e-09
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno...    65   3e-09
gi|1589837|gb|AAC48358.1| cuticle preprocollagen [Meloidogyne in...    64   3e-09
gi|1184072|gb|AAC47437.1| COL-1                                        64   4e-09
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno...    64   6e-09
gi|17539418|ref|NP_501561.1| COLlagen structural gene (col-119) ...    63   1e-08
gi|17568109|ref|NP_510274.1| COLlagen structural gene (col-44) [...    63   1e-08
gi|39582210|emb|CAE64161.1| Hypothetical protein CBG08781 [Caeno...    62   1e-08
gi|115397|sp|P08124|CC01_CAEEL Cuticle collagen 1 precursor (Squ...    62   1e-08
gi|39580392|emb|CAE70951.1| Hypothetical protein CBG17762 [Caeno...    62   1e-08
gi|32698037|emb|CAE11316.1| Hypothetical protein H06A10.2 [Caeno...    62   1e-08
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ...    62   2e-08
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ...    49   3e-08
gi|17537301|ref|NP_494562.1| COLlagen structural gene (37.0 kD) ...    60   5e-08
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno...    60   6e-08
gi|39588428|emb|CAE72779.1| Hypothetical protein CBG20034 [Caeno...    59   1e-07
gi|17542184|ref|NP_501700.1| COLlagen structural gene (29.4 kD) ...    59   1e-07
gi|17551424|ref|NP_510247.1| COLlagen structural gene (col-183) ...    59   2e-07
gi|39596517|emb|CAE63136.1| Hypothetical protein CBG07436 [Caeno...    59   2e-07
gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33) [...    58   3e-07
gi|39596527|emb|CAE63146.1| Hypothetical protein CBG07448 [Caeno...    57   4e-07
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [...    57   5e-07
gi|4809258|gb|AAD30169.1| collagen [Haemonchus contortus]              57   7e-07
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno...    42   7e-07
gi|39580360|emb|CAE61465.1| Hypothetical protein CBG05357 [Caeno...    54   5e-06
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel...    53   8e-06
gi|39593552|emb|CAE61844.1| Hypothetical protein CBG05818 [Caeno...    53   8e-06
gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114) ...    53   8e-06
gi|7498195|pir||T34203 hypothetical protein D2024.8 - Caenorhabd...    53   8e-06
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi...    53   1e-05
gi|115399|sp|P16252|CAC2_HAECO Cuticle collagen 2C >gnl|BL_ORD_I...    53   1e-05
gi|321007|pir||B44984 collagen - nematode (Haemonchus contortus)...    53   1e-05
gi|39596499|emb|CAE63118.1| Hypothetical protein CBG07415 [Caeno...    53   1e-05
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p...    52   1e-05
gi|50405059|ref|YP_054151.1| hypothetical protein PTMB.222 [Para...    52   2e-05
gi|17535685|ref|NP_496589.1| ROLler: helically twisted, animals ...    52   2e-05
gi|159171|gb|AAA29174.1| collagen 8E                                   51   3e-05
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [...    50   7e-05
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [...    50   9e-05
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd...    50   9e-05
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno...    50   9e-05
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g...    49   1e-04
gi|39591412|emb|CAE73466.1| Hypothetical protein CBG20917 [Caeno...    49   1e-04
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno...    49   1e-04
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-...    49   1e-04
gi|1245105|gb|AAC52934.1| glutamine repeat protein-1                   49   1e-04
gi|17568107|ref|NP_510273.1| COLlagen structural gene (col-9) [C...    49   1e-04
gi|17532741|ref|NP_495367.1| DumPY : shorter than wild-type DPY-...    49   2e-04
gi|7332272|gb|AAA17398.2| collagen [Caenorhabditis elegans]            49   2e-04
gi|543967|sp|P35799|CCD2_CAEEL Cuticle collagen dpy-2 precursor        49   2e-04
gi|7494560|pir||T37285 collagen dpy-2 - Caenorhabditis elegans         49   2e-04
gi|17539916|ref|NP_500598.1| COLlagen structural gene (col-110) ...    47   4e-04
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno...    47   4e-04
gi|11466451|ref|NP_046743.1| Rep-like [Dictyostelium discoideum]...    47   6e-04
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ...    47   6e-04
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8]                  47   7e-04
gi|28829276|gb|AAO51818.1| similar to Kaposi's sarcoma-associate...    47   7e-04
gi|39591507|emb|CAE73561.1| Hypothetical protein CBG21031 [Caeno...    46   0.001
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd...    46   0.001
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [...    46   0.001
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ...    46   0.001
gi|47568496|ref|ZP_00239196.1| spermine/spermidine synthase fami...    45   0.002
gi|39591680|emb|CAE71258.1| Hypothetical protein CBG18138 [Caeno...    45   0.002
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ...    45   0.002
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ...    45   0.002
gi|29245456|gb|EAA37093.1| GLP_227_3888_5990 [Giardia lamblia AT...    45   0.003
gi|39587615|emb|CAE58553.1| Hypothetical protein CBG01712 [Caeno...    45   0.003
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8]                 44   0.004
gi|543968|sp|P35800|CCDA_CAEEL Cuticle collagen dpy-10 precursor...    44   0.005
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno...    44   0.005
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)...    44   0.006
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno...    44   0.006
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno...    44   0.006
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno...    44   0.006
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ...    43   0.008
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ...    43   0.008
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno...    43   0.008
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co...    43   0.008
gi|39595279|emb|CAE60316.1| Hypothetical protein CBG03907 [Caeno...    43   0.008
gi|47847440|dbj|BAD21392.1| mFLJ00158 protein [Mus musculus]           43   0.010
gi|28828396|gb|AAO51028.1| similar to Dictyostelium discoideum (...    43   0.010
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ...    43   0.010
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno...    43   0.010
gi|13235592|emb|CAC33779.1| SclB protein [Streptococcus pyogenes]      39   0.013
gi|50260271|gb|EAL22930.1| hypothetical protein CNBA6990 [Crypto...    42   0.014
gi|39590295|emb|CAE66033.1| Hypothetical protein CBG11229 [Caeno...    42   0.014
gi|50424343|ref|XP_460758.1| unnamed protein product [Debaryomyc...    42   0.014
gi|49481187|ref|YP_039199.1| spermidine synthase [Bacillus thuri...    42   0.014
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno...    42   0.014
gi|23468050|ref|ZP_00123621.1| COG5295: Autotransporter adhesin ...    36   0.015
gi|34864831|ref|XP_217647.2| similar to nongradient byssal precu...    31   0.016
gi|13560500|gb|AAK30078.1| collagen-like protein B [Streptococcu...    38   0.017
gi|17385615|emb|CAD12627.1| involucrin [Sus scrofa]                    42   0.018
gi|7710074|ref|NP_057919.1| nucleosome binding protein 1; nucleo...    42   0.018
gi|5263198|dbj|BAA33783.2| GARP45 [Mus musculus]                       42   0.018
gi|23396775|sp|Q9JL35|NSB1_MOUSE Nucleosome binding protein 1 (N...    42   0.018
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ...    42   0.018
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ...    42   0.018
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ...    42   0.018
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ...    42   0.018
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g...    42   0.018
gi|50555313|ref|XP_505065.1| hypothetical protein [Yarrowia lipo...    42   0.018
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster...    42   0.018
gi|11559966|ref|NP_071531.1| involucrin gene [Rattus norvegicus]...    42   0.018
gi|32565701|ref|NP_495366.2| collagen triple helix repeat family...    42   0.023
gi|34857875|ref|XP_346628.1| hypothetical protein XP_346627 [Rat...    42   0.023
gi|29570382|gb|AAO38600.2| Dumpy : shorter than wild-type protei...    42   0.023
gi|2623357|gb|AAC53436.1| sex determining protein [Mus musculus ...    42   0.023
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor...    42   0.023
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ...    42   0.023
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira...    42   0.023
gi|7494559|pir||T28887 collagen dpy-10 - Caenorhabditis elegans        42   0.023
gi|39585160|emb|CAE57403.1| Hypothetical protein CBG00356 [Caeno...    42   0.023
gi|50547317|ref|XP_501128.1| hypothetical protein [Yarrowia lipo...    41   0.030
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ...    41   0.030
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum]            41   0.030
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043...    41   0.030
gi|48832889|ref|ZP_00289916.1| hypothetical protein Mmc102001633...    41   0.030
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (...    41   0.030
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv...    41   0.030
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno...    41   0.040
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ...    41   0.040
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn...    41   0.040
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ...    41   0.040
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc...    41   0.040
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ...    41   0.040
gi|39592028|emb|CAE75248.1| Hypothetical protein CBG23205 [Caeno...    41   0.040
gi|39590294|emb|CAE66032.1| Hypothetical protein CBG11227 [Caeno...    41   0.040
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab...    41   0.040
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans     41   0.040
gi|50120047|ref|YP_049214.1| exonuclease [Erwinia carotovora sub...    41   0.040
gi|39597872|emb|CAE68564.1| Hypothetical protein CBG14399 [Caeno...    40   0.052
gi|11346371|pir||T47235 sex determining protein [imported] - wes...    40   0.052
gi|50752016|ref|XP_422615.1| PREDICTED: similar to alpha 4 colla...    40   0.052
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-...    40   0.052
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par...    40   0.052
gi|13235235|emb|CAC33514.1| STATc protein [Dictyostelium discoid...    40   0.052
gi|16305113|gb|AAL16979.1| 50kD gamma zein [Zea mays]                  40   0.052
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL...    40   0.068
gi|50289215|ref|XP_447038.1| unnamed protein product [Candida gl...    40   0.068
gi|47523948|ref|NP_999613.1| involucrin [Sus scrofa] >gnl|BL_ORD...    40   0.068
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ...    40   0.068
gi|17385617|emb|CAD12628.1| involucrin [Sus scrofa]                    40   0.068
gi|17385613|emb|CAD12626.1| involucrin [Sus scrofa]                    40   0.068
gi|23613570|ref|NP_704591.1| E1-E2_ATPase/hydrolase, putative [P...    40   0.088
gi|6755761|ref|NP_035694.1| sex determining region Y; testis det...    40   0.088
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ...    40   0.088
gi|124732|sp|P17941|INVO_HYLLA Involucrin >gnl|BL_ORD_ID|1811533...    40   0.088
gi|6677817|ref|NP_033126.1| repetin [Mus musculus] >gnl|BL_ORD_I...    40   0.088
gi|50424619|ref|XP_460899.1| unnamed protein product [Debaryomyc...    40   0.088
gi|39590714|emb|CAE65084.1| Hypothetical protein CBG09942 [Caeno...    40   0.088
gi|48838606|ref|ZP_00295547.1| COG0457: FOG: TPR repeat [Methano...    40   0.088
gi|29290091|gb|AAO67562.1| Pol protein [Drosophila virilis]            39   0.12
gi|23346429|ref|NP_032691.2| myelin transcription factor 1; neur...    39   0.12
gi|31201295|ref|XP_309595.1| ENSANGP00000010937 [Anopheles gambi...    39   0.12
gi|17507553|ref|NP_490679.1| COLlagen structural gene (col-45) [...    39   0.12
gi|46444158|gb|EAL03435.1| hypothetical protein CaO19.4998 [Cand...    39   0.12
gi|50306605|ref|XP_453276.1| unnamed protein product [Kluyveromy...    39   0.12
gi|49022813|dbj|BAC41451.2| mKIAA0835 protein [Mus musculus]           39   0.12
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno...    39   0.12
gi|32565703|ref|NP_872048.1| dumpy shorter than wild-type protei...    39   0.12
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno...    39   0.12
gi|11360369|pir||T42712 myelin transcription factor 1 - mouse >g...    39   0.12
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa...    39   0.12
gi|124727|sp|P24708|INVO_AOTTR Involucrin >gnl|BL_ORD_ID|1836165...    39   0.15
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna...    39   0.15
gi|28828729|gb|AAO51324.1| similar to Dictyostelium discoideum (...    39   0.15
gi|41054736|ref|NP_955828.1| Unknown (protein for MGC:65851); sb...    39   0.15
gi|28374176|gb|AAH46263.1| LOC398566 protein [Xenopus laevis]          39   0.15
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ...    39   0.15
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno...    39   0.15
gi|17539404|ref|NP_503048.1| COLlagen structural gene (28.0 kD) ...    39   0.20
gi|28574692|ref|NP_787977.1| CG11924-PD [Drosophila melanogaster...    39   0.20
gi|28574688|ref|NP_787978.1| CG11924-PB [Drosophila melanogaster...    39   0.20
gi|46434633|gb|EAK94037.1| hypothetical protein CaO19.1897 [Cand...    39   0.20
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g...    39   0.20
gi|24581749|ref|NP_523474.1| CG11924-PA [Drosophila melanogaster...    39   0.20
gi|28829296|gb|AAO51838.1| similar to hypothetical protein [Schi...    39   0.20
gi|34328045|ref|NP_031761.1| procollagen, type IV, alpha 4 [Mus ...    39   0.20
gi|39586115|emb|CAE69191.1| Hypothetical protein CBG15226 [Caeno...    39   0.20
gi|17384366|emb|CAD13202.1| involucrin [Sus scrofa]                    39   0.20
gi|39579269|emb|CAE56956.1| Hypothetical protein CBG24806 [Caeno...    34   0.21
gi|13235584|emb|CAC33775.1| SclB protein [Streptococcus pyogenes]      35   0.21
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-...    38   0.26
gi|2623347|gb|AAC53431.1| sex determining protein [Mus musculus ...    38   0.26
gi|39580382|emb|CAE71742.1| Hypothetical protein CBG18726 [Caeno...    38   0.26
gi|13235588|emb|CAC33777.1| SclB protein [Streptococcus pyogenes]      38   0.26
gi|31982941|ref|NP_055885.2| KIAA0853 [Homo sapiens] >gnl|BL_ORD...    38   0.26
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ...    38   0.26
gi|21732311|emb|CAD38544.1| hypothetical protein [Homo sapiens]        38   0.26
gi|50748622|ref|XP_421330.1| PREDICTED: similar to chromogranin ...    38   0.26
gi|2623355|gb|AAC53435.1| sex determining protein [Mus musculus ...    38   0.26
gi|32411593|ref|XP_326277.1| hypothetical protein [Neurospora cr...    38   0.26
gi|31077132|ref|NP_852034.1| histidine rich calcium binding prot...    38   0.26
gi|20178621|gb|AAL50184.1| collagen-like protein 2 [Streptococcu...    38   0.26
gi|22652113|gb|AAN03620.1| alpha 1 type XXII collagen [Homo sapi...    38   0.26
gi|40805823|ref|NP_690848.1| collagen, type XXII, alpha 1 [Homo ...    38   0.26
gi|48867374|ref|ZP_00320910.1| hypothetical protein Hinf80100166...    38   0.26
gi|17507951|ref|NP_491958.1| COLlagen structural gene (col-59) [...    38   0.26
gi|13811671|gb|AAK40236.1| glutamate-rich protein [Plasmodium re...    38   0.26
gi|11078661|gb|AAG29138.1| Ras guanine nucleotide exchange facto...    38   0.26
gi|24286634|gb|AAN46871.1| nucleotide exchange factor RasGEF B [...    38   0.26
gi|32410297|ref|XP_325629.1| predicted protein [Neurospora crass...    38   0.26
gi|27469566|gb|AAH42075.1| COL22A1 protein [Homo sapiens]              38   0.26
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ...    38   0.26
gi|2623363|gb|AAC53439.1| sex determining protein [Mus musculus ...    38   0.26
gi|13560496|gb|AAK30077.1| collagen-like protein B [Streptococcu...    36   0.28
gi|27802723|emb|CAD60828.1| SI:bZ1D10.2 (novel protein similar t...    38   0.34
gi|25518714|pir||G86385 hypothetical protein F2J7.4 [imported] -...    38   0.34
gi|23612236|ref|NP_703816.1| hypothetical protein [Plasmodium fa...    38   0.34
gi|23593332|ref|NP_473112.2| hypothetical protein [Plasmodium fa...    38   0.34
gi|31213353|ref|XP_315620.1| ENSANGP00000017827 [Anopheles gambi...    38   0.34
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ...    38   0.34
gi|34876983|ref|XP_343606.1| similar to alpha 4 collagen IV [Rat...    38   0.34
gi|31240941|ref|XP_320884.1| ENSANGP00000019179 [Anopheles gambi...    38   0.34
gi|5737842|gb|AAD50121.1| adenylyl cyclase [Dictyostelium discoi...    38   0.34
gi|7494396|pir||H71602 protein with DnaJ domain (RESA-like) PFB0...    38   0.34
gi|30689268|ref|NP_173925.3| phytochrome and flowering time regu...    38   0.34
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno...    38   0.34
gi|17551704|ref|NP_508747.1| COLlagen structural gene (33.9 kD) ...    37   0.44
gi|2271479|gb|AAC53450.1| sex determining protein [Mus musculus ...    37   0.44
gi|40788379|dbj|BAA74858.2| KIAA0835 protein [Homo sapiens]            37   0.44
gi|50731940|ref|XP_418425.1| PREDICTED: similar to collagen, typ...    37   0.44
gi|50550003|ref|XP_502474.1| hypothetical protein [Yarrowia lipo...    37   0.44
gi|20066260|gb|AAM09367.1| similar to Dictyostelium discoideum (...    37   0.44
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c...    37   0.44
gi|28703797|gb|AAH47305.1| COL4A1 protein [Homo sapiens]               37   0.44
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno...    37   0.44
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g...    37   0.44
gi|416785|sp|Q01522|CF23_DROME Chorion transcription factor Cf2,...    37   0.44
gi|542553|pir||C36901 chorion transcription factor CF2-III (alte...    37   0.44
gi|28850332|gb|AAM08494.2| similar to Mus musculus (Mouse). GABA...    37   0.44
gi|16805171|ref|NP_473199.1| hypothetical protein [Plasmodium fa...    37   0.44
gi|225874|prf||1402236A collagen alpha1(IV)                            37   0.44
gi|25518265|pir||JC7732 trypsin-plasmin inhibitor, bdellin-KL - ...    37   0.44
gi|542552|pir||B36901 chorion transcription factor CF2-II (alter...    37   0.44
gi|32420269|ref|XP_330578.1| predicted protein [Neurospora crass...    37   0.44
gi|46227005|gb|EAK87955.1| membrane associated thioredoxin [Cryp...    37   0.44
gi|37531244|ref|NP_919924.1| unknown protein [Oryza sativa (japo...    37   0.44
gi|24649158|ref|NP_651102.1| CG13840-PA [Drosophila melanogaster...    37   0.44
gi|12314281|emb|CAC13153.1| bA472K17.2 (collagen type IV alpha 1...    37   0.44
gi|542551|pir||A36901 chorion transcription factor CF2-I (altern...    37   0.44
gi|416786|sp|P20385|CF2_DROME Chorion transcription factor Cf2, ...    37   0.44
gi|50420655|ref|XP_458864.1| unnamed protein product [Debaryomyc...    37   0.44
gi|15242846|ref|NP_195991.1| hypothetical protein [Arabidopsis t...    37   0.44
gi|17975763|ref|NP_004526.1| myelin transcription factor 1; prot...    37   0.44
gi|290214|gb|AAA28395.1| DNA-binding protein isoform II                37   0.44
gi|39585963|emb|CAE68252.1| Hypothetical protein CBG13929 [Caeno...    37   0.44
gi|28828697|gb|AAO51294.1| similar to Dictyostelium discoideum (...    37   0.44
gi|29549|emb|CAA68698.1| unnamed protein product [Homo sapiens]        37   0.44
gi|7656985|ref|NP_001836.1| alpha 1 type IV collagen preproprote...    37   0.44
gi|46432346|gb|EAK91832.1| hypothetical protein CaO19.1842 [Cand...    37   0.44
gi|34861086|ref|XP_342606.1| similar to neural zinc finger prote...    37   0.44
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ...    37   0.44
gi|47228390|emb|CAG05210.1| unnamed protein product [Tetraodon n...    37   0.57
gi|33149359|gb|AAO64414.1| type VII collagen [Canis familiaris]        37   0.57
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ...    37   0.57
gi|4519617|dbj|BAA75668.1| collagen pro alpha-chain [Haliotis di...    37   0.57
gi|17564310|ref|NP_504735.1| COLlagen structural gene (col-141) ...    37   0.57
gi|46125133|ref|XP_387120.1| hypothetical protein FG06944.1 [Gib...    37   0.57
gi|50420779|ref|XP_458929.1| unnamed protein product [Debaryomyc...    37   0.57
gi|12053007|emb|CAB66679.1| hypothetical protein [Homo sapiens]        37   0.57
gi|50255862|gb|EAL18593.1| hypothetical protein CNBJ0190 [Crypto...    37   0.57
gi|47228041|emb|CAF97670.1| unnamed protein product [Tetraodon n...    37   0.57
gi|47227297|emb|CAF96846.1| unnamed protein product [Tetraodon n...    37   0.57
gi|17552718|ref|NP_498862.1| C.Elegans Chromodomain protein (33....    37   0.57
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno...    37   0.57
gi|13560506|gb|AAK30079.1| collagen-like protein B [Streptococcu...    33   0.74
gi|49074246|ref|XP_401271.1| hypothetical protein UM03656.1 [Ust...    37   0.75
gi|42476169|ref|NP_061961.2| hypothetical protein F23149_1 [Homo...    37   0.75
gi|45384382|ref|NP_990679.1| type VI collagen alpha-2 subunit [G...    37   0.75
gi|23483767|gb|EAA19328.1| Arabidopsis thaliana At5g66540/K1F13_...    37   0.75
gi|21400216|ref|NP_656201.1| Transglycosyl, Transglycosylase [Ba...    37   0.75
gi|50545801|ref|XP_500439.1| hypothetical protein [Yarrowia lipo...    37   0.75
gi|23508380|ref|NP_701049.1| hypothetical protein [Plasmodium fa...    37   0.75
gi|32419126|ref|XP_330041.1| hypothetical protein [Neurospora cr...    37   0.75
gi|7511982|pir||T13349 parallel sister chromatids protein - frui...    37   0.75
gi|45551388|ref|NP_726796.2| CG3707-PB [Drosophila melanogaster]...    37   0.75
gi|212861|gb|AAA49132.1| type VI collagen                              37   0.75
gi|21429082|gb|AAM50260.1| LD29979p [Drosophila melanogaster]          37   0.75
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (...    37   0.75
gi|49185194|ref|YP_028446.1| penicillin-binding protein 1A [Baci...    37   0.75
gi|3024638|sp|Q62565|SRY_MUSSI Sex-determining region Y protein ...    37   0.75
gi|104612|pir||S23377 collagen alpha 2(VI) chain short form prec...    37   0.75
gi|34858179|ref|XP_227375.2| similar to RIKEN cDNA 5430400H23 [R...    37   0.75
gi|108605|pir||A39762 collagen alpha 1(XIV) chain - bovine (frag...    37   0.75
gi|49477628|ref|YP_036449.1| penicillin-binding protein 1A [Baci...    37   0.75
gi|7511983|pir||T13610 parallel sister chromatids protein - frui...    37   0.75
gi|24639283|ref|NP_525042.2| CG3707-PA [Drosophila melanogaster]...    37   0.75
gi|3287674|gb|AAC25503.1| F23149_1 [Homo sapiens]                      37   0.75
gi|39585657|emb|CAE59859.1| Hypothetical protein CBG03334 [Caeno...    37   0.75
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno...    37   0.75
gi|41106697|ref|XP_371312.1| hypothetical protein FLJ39117 [Homo...    37   0.75
gi|211616|gb|AAA48705.1| type VI collagen, alpha-2 subunit             37   0.75
gi|7494557|pir||T37286 collagen 40 - Caenorhabditis elegans >gnl...    37   0.75
gi|13235596|emb|CAC33780.1| SclB protein [Streptococcus pyogenes]      32   0.75
gi|30851578|gb|AAH52428.1| Col15a1 protein [Mus musculus]              28   0.92
gi|50732575|ref|XP_418701.1| PREDICTED: similar to KIAA0744 prot...    36   0.98
gi|29290093|gb|AAO67564.1| Pol protein [Drosophila virilis]            36   0.98
gi|31239125|ref|XP_319976.1| ENSANGP00000022392 [Anopheles gambi...    36   0.98
gi|30038111|gb|AAP12719.1| mastermind [Drosophila americana]           36   0.98
gi|46125803|ref|XP_387455.1| hypothetical protein FG07279.1 [Gib...    36   0.98
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel...    36   0.98
gi|28850391|gb|AAO53165.1| similar to midasin, a large protein w...    36   0.98
gi|21431496|sp||P12105_1 [Segment 1 of 3] Collagen alpha 1(III) ...    36   0.98
gi|46442819|gb|EAL02105.1| hypothetical protein CaO19.801 [Candi...    36   0.98
gi|34327950|dbj|BAA20761.2| KIAA0301 [Homo sapiens]                    36   0.98
gi|28574851|ref|NP_788536.1| CG9614-PL [Drosophila melanogaster]...    36   0.98
gi|50750041|ref|XP_421846.1| PREDICTED: similar to procollagen t...    36   0.98
gi|39585885|emb|CAE61299.1| Hypothetical protein CBG05125 [Caeno...    36   0.98
gi|50286091|ref|XP_445474.1| unnamed protein product [Candida gl...    36   0.98
gi|19848530|gb|AAK15783.1| collagen IV alpha 1 chain precursor [...    36   0.98
gi|50750043|ref|XP_421847.1| PREDICTED: similar to [Segment 3 of...    36   0.98
gi|34394194|dbj|BAC84646.1| hypothetical protein [Oryza sativa (...    36   0.98
gi|31239123|ref|XP_319975.1| ENSANGP00000016783 [Anopheles gambi...    36   0.98
gi|23491066|gb|EAA22695.1| hypothetical protein [Plasmodium yoel...    36   0.98
gi|46227721|gb|EAK88641.1| eIF4G eukaryotic initiation factor 4,...    36   0.98
gi|6319766|ref|NP_009848.1| Involved in global regulation of tra...    36   0.98
gi|172638|gb|AAA35062.1| SNF5 protein                                  36   0.98
gi|24415404|ref|NP_055426.1| MDN1, midasin homolog [Homo sapiens...    36   0.98
gi|38085863|ref|XP_133185.3| similar to hypothetical protein FLJ...    36   1.3
gi|30268307|emb|CAD89962.1| hypothetical protein [Homo sapiens]        36   1.3
gi|17137252|ref|NP_477190.1| CG16858-PA [Drosophila melanogaster...    36   1.3
gi|17555486|ref|NP_497131.1| COLlagen structural gene (29.1 kD) ...    36   1.3
gi|47229450|emb|CAF99438.1| unnamed protein product [Tetraodon n...    36   1.3
gi|1314210|gb|AAA99480.1| alpha-5 type IV collagen                     36   1.3
gi|7023594|dbj|BAA92020.1| unnamed protein product [Homo sapiens]      36   1.3
gi|39592976|emb|CAE62590.1| Hypothetical protein CBG06704 [Caeno...    36   1.3
gi|47026413|gb|AAT08469.1| RE66582p [Drosophila melanogaster]          36   1.3
gi|180825|gb|AAA52045.1| collagen type IV alpha 5 chain                36   1.3
gi|2144796|pir||I36912 involucrin S - douroucouli (fragment) >gn...    36   1.3
gi|50754535|ref|XP_425157.1| PREDICTED: similar to type VII coll...    36   1.3
gi|41582236|ref|NP_899228.2| hypothetical protein LOC200030 [Hom...    36   1.3
gi|7710982|emb|CAB90289.1| dA24A23.1 (collagen, type IV, alpha 5...    36   1.3
gi|38679296|gb|AAR26472.1| abpE [Dictyostelium discoideum]             36   1.3
gi|4502955|ref|NP_000486.1| alpha 5 type IV collagen isoform 1, ...    36   1.3
gi|732526|gb|AAA64312.1| alpha2(IV) collagen                           36   1.3
gi|6323816|ref|NP_013887.1| Multicopy Suppressor of STA10 - 11; ...    36   1.3
gi|28828435|gb|AAO51053.1| similar to Y56A3A.13.p [Caenorhabditi...    36   1.3
gi|460123|gb|AAB60446.1| Sry >gnl|BL_ORD_ID|1784943 gi|2623359|g...    36   1.3
gi|24660935|ref|NP_648226.2| CG7015-PA [Drosophila melanogaster]...    36   1.3
gi|15890086|ref|NP_203699.1| alpha 5 type IV collagen isoform 2,...    36   1.3
gi|23507939|ref|NP_700609.1| hypothetical protein [Plasmodium fa...    36   1.3
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto...    36   1.3
gi|584868|sp|P17140|CA24_CAEEL Collagen alpha 2(IV) chain precur...    36   1.3
gi|17568911|ref|NP_510664.1| CoLlagen, Basement membrane type, L...    36   1.3
gi|28829875|gb|AAO52372.1| similar to Dictyostelium discoideum (...    36   1.3
gi|953173|emb|CAA80537.1| a2(IV) collagen [Caenorhabditis elegans]     36   1.3
gi|17568913|ref|NP_510663.1| CoLlagen, Basement membrane type, L...    36   1.3
gi|42656081|ref|XP_375869.1| hypothetical protein XP_375869 [Hom...    36   1.3
gi|17555622|ref|NP_498151.1| g-protein beta WD-40 repeat (3G476)...    36   1.3
gi|33591257|gb|AAL06398.2| unknown [Francisella tularensis subsp...    36   1.3
gi|38348250|ref|NP_940867.1| Nik related kinase [Homo sapiens] >...    36   1.3
gi|177924|gb|AAA51558.1| alpha-5 type IV collagen                      36   1.3
gi|4262101|gb|AAD14401.1| spinocerebellar ataxia type 1 [Homo sa...    36   1.3
gi|17559062|ref|NP_506053.1| COLlagen structural gene (col-37) [...    36   1.3
gi|29290087|gb|AAO67559.1| Pol protein [Drosophila virilis]            36   1.3
gi|46205649|ref|ZP_00209964.1| hypothetical protein Magn021176 [...    36   1.3
gi|124736|sp|P14708|INVO_PONPY Involucrin >gnl|BL_ORD_ID|1318093...    36   1.3
gi|15890088|ref|NP_203700.1| alpha 5 type IV collagen isoform 3,...    36   1.3
gi|18652045|gb|AAL76931.1| chromogranin B [Rana ridibunda]             36   1.3
gi|40888884|gb|AAR97288.1| DIF insensitive mutant A [Dictyosteli...    36   1.3
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ...    36   1.3
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ...    36   1.3
gi|45383788|ref|NP_989495.1| collagen, type XVIII, alpha 1 [Gall...    35   1.5
gi|47211363|emb|CAF95382.1| unnamed protein product [Tetraodon n...    35   1.7
gi|21750448|dbj|BAC03778.1| unnamed protein product [Homo sapiens]     35   1.7
gi|46228478|gb|EAK89348.1| hypothetical protein with glutamine r...    35   1.7
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2                    35   1.7
gi|15620855|dbj|BAB67791.1| KIAA1898 protein [Homo sapiens]            35   1.7
gi|38080873|ref|XP_207119.2| similar to hypothetical protein [Mu...    35   1.7
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ...    35   1.7
gi|39593091|emb|CAE64560.1| Hypothetical protein CBG09310 [Caeno...    35   1.7
gi|22096343|sp|P34804|CC40_CAEEL Cuticle collagen 40                   35   1.7
gi|23612990|ref|NP_704529.1| hypothetical protein [Plasmodium fa...    35   1.7
gi|17536229|ref|NP_493913.1| COLlagen structural gene (col-40) [...    35   1.7
gi|27461187|gb|AAL83712.1| type IV collagen alpha 5 chain [Canis...    35   1.7
gi|17940700|gb|AAL49726.1| LKB1-interacting protein 1 [Homo sapi...    35   1.7
gi|24308376|ref|NP_443134.1| LKB1 interacting protein; STK11 int...    35   1.7
gi|47221117|emb|CAG05438.1| unnamed protein product [Tetraodon n...    35   1.7
gi|33468851|ref|NP_031762.1| procollagen, type IV, alpha 5 [Mus ...    35   1.7
gi|23099424|ref|NP_692890.1| heat shock protein [Oceanobacillus ...    35   1.7
gi|46372001|gb|AAO33458.2| type IV collagen alpha 5 [Canis famil...    35   1.7
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n...    35   1.7
gi|40225945|gb|AAH14114.2| STK11IP protein [Homo sapiens]              35   1.7
gi|50258309|gb|EAL21000.1| hypothetical protein CNBD6010 [Crypto...    35   1.7
gi|27696597|gb|AAH43317.1| Col4a5 protein [Mus musculus]               35   1.7
gi|46442629|gb|EAL01917.1| hypothetical protein CaO19.11787 [Can...    35   1.7
gi|39595809|emb|CAE67312.1| Hypothetical protein CBG12769 [Caeno...    35   1.7
gi|39587583|emb|CAE58521.1| Hypothetical protein CBG01673 [Caeno...    35   1.7
gi|26348681|dbj|BAC37980.1| unnamed protein product [Mus musculus]     35   1.7
gi|46442495|gb|EAL01784.1| hypothetical protein CaO19.4312 [Cand...    35   1.7
gi|34876987|ref|XP_343607.1| similar to alpha 4 collagen IV [Rat...    35   1.7
gi|2493785|sp|Q28247|CA54_CANFA Collagen alpha 5(IV) chain >gnl|...    35   1.7
gi|17558722|ref|NP_506300.1| COLlagen structural gene (col-161) ...    35   1.7
gi|20386036|gb|AAM21558.1| MEK1 interacting protein 1 [Dictyoste...    35   1.7
gi|18418034|ref|NP_567896.1| WD-40 repeat family protein (LEUNIG...    35   2.2
gi|938175|emb|CAA46238.1| alpha1 (XIV) collagen [Gallus gallus]        35   2.2
gi|11141605|gb|AAG32022.1| LEUNIG [Arabidopsis thaliana]               35   2.2
gi|50806838|ref|XP_428858.1| PREDICTED: similar to tumor-related...    35   2.2
gi|45384490|ref|NP_990665.1| collagen XIV [Gallus gallus] >gnl|B...    35   2.2
gi|50545257|ref|XP_500166.1| hypothetical protein [Yarrowia lipo...    35   2.2
gi|20502826|gb|AAM22643.1| cGMP-dependent protein kinase [Eimeri...    35   2.2
gi|13235590|emb|CAC33778.1| SclB protein [Streptococcus pyogenes]      35   2.2
gi|49117309|gb|AAH72650.1| Col4a1 protein [Mus musculus]               35   2.2
gi|7486768|pir||T08588 hypothetical protein L23H3.30 - Arabidops...    35   2.2
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno...    35   2.2
gi|13235586|emb|CAC33776.1| SclB protein [Streptococcus pyogenes]      35   2.2
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa...    35   2.2
gi|29290085|gb|AAO67557.1| Pol protein [Drosophila virilis]            35   2.2
gi|23613764|ref|NP_704785.1| hypothetical protein [Plasmodium fa...    35   2.2
gi|7441226|pir||S31212 collagen alpha 1(XIV) chain precursor, sh...    35   2.2
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl...    35   2.2
gi|422706|pir||A45974 collagen alpha 1(XIV) chain precursor, sho...    35   2.2
gi|46137953|ref|XP_390667.1| hypothetical protein FG10491.1 [Gib...    35   2.2
gi|1778210|gb|AAC47545.1| fibrillar collagen [Arenicola marina]        35   2.2
gi|24666012|ref|NP_730287.1| CG32180-PA [Drosophila melanogaster...    35   2.2
gi|38110797|gb|EAA56463.1| hypothetical protein MG06434.4 [Magna...    35   2.2
gi|50551375|ref|XP_503161.1| hypothetical protein [Yarrowia lipo...    35   2.2
gi|34879634|ref|XP_214400.2| similar to collagen alpha 1(IV) cha...    35   2.2
gi|6678399|ref|NP_033434.1| topoisomerase (DNA) I [Mus musculus]...    35   2.2
gi|24666017|ref|NP_730288.1| CG32180-PB [Drosophila melanogaster...    35   2.2
gi|28380878|gb|AAO41406.1| SD03570p [Drosophila melanogaster]          35   2.2
gi|28828911|gb|AAO51497.1| similar to Mus musculus (Mouse). simi...    35   2.2
gi|85124|pir||S04722 puff 74E protein - fruit fly (Drosophila me...    35   2.2
gi|50547379|ref|XP_501159.1| hypothetical protein [Yarrowia lipo...    35   2.2
gi|462434|sp|P34099|KAPC_DICDI cAMP-dependent protein kinase cat...    35   2.2
gi|29290086|gb|AAO67558.1| Gag protein [Drosophila virilis] >gnl...    35   2.2
gi|241277|gb|AAB20716.1| serine/threonine protein kinase [Dictyo...    35   2.2
gi|23486147|gb|EAA20734.1| hypothetical protein [Plasmodium yoel...    35   2.2
gi|50502|emb|CAA29946.1| unnamed protein product [Mus musculus]        35   2.2
gi|38099143|gb|EAA46524.1| hypothetical protein MG08867.4 [Magna...    35   2.2
gi|47217077|emb|CAG02388.1| unnamed protein product [Tetraodon n...    35   2.2
gi|24642014|ref|NP_511156.2| CG9533-PA [Drosophila melanogaster]...    35   2.2
gi|23612979|ref|NP_704518.1| hypothetical protein [Plasmodium fa...    35   2.2
gi|17561556|ref|NP_505902.1| COLlagen structural gene (col-156) ...    35   2.2
gi|31198279|ref|XP_308087.1| ENSANGP00000019758 [Anopheles gambi...    35   2.2
gi|33859528|ref|NP_034061.1| procollagen, type IV, alpha 1 [Mus ...    35   2.2
gi|39598361|emb|CAE69054.1| Hypothetical protein CBG15063 [Caeno...    27   2.7
gi|17540706|ref|NP_499982.1| COLlagen structural gene (33.8 kD) ...    35   2.8
gi|48862101|ref|ZP_00315999.1| COG2304: Uncharacterized protein ...    35   2.8
gi|17540820|ref|NP_500070.1| COLlagen structural gene (28.0 kD) ...    35   2.8
gi|20380052|gb|AAH28178.1| COL3A1 protein [Homo sapiens]               35   2.8
gi|39593890|emb|CAE62183.1| Hypothetical protein CBG06230 [Caeno...    35   2.8
gi|39592328|emb|CAE63405.1| Hypothetical protein CBG07844 [Caeno...    35   2.8
gi|47224421|emb|CAG08671.1| unnamed protein product [Tetraodon n...    35   2.8
gi|23508651|ref|NP_701320.1| hypothetical protein [Plasmodium fa...    35   2.8


>gi|17543166|ref|NP_500138.1| COLlagen structural gene (29.0 kD)
           (col-109) [Caenorhabditis elegans]
 gi|7331814|gb|AAF60502.1| Hypothetical protein Y38C1BA.3
           [Caenorhabditis elegans]
          Length = 291

 Score =  228 bits (581), Expect = 1e-58
 Identities = 133/209 (63%), Positives = 133/209 (63%)
 Frame = -1

Query: 876 MEDTREKAYKAVTYSAVTFSFLAILSVCISMPIIYNFVDSIHQQTKRDMTFCKSTARDIM 697
           MEDTREKAYKAVTYSAVTFSFLAILSVCISMPIIYNFVDSIHQQTKRDMTFCKSTARDIM
Sbjct: 1   MEDTREKAYKAVTYSAVTFSFLAILSVCISMPIIYNFVDSIHQQTKRDMTFCKSTARDIM 60

Query: 696 SEISHKKPIAAAIAGNLTTIRNKRQAVGCAGCCXXXXXXXXXXXXXXXXXXXXXXXXXXX 517
           SEISHKKPIAAAIAGNLTTIRNKRQAVGCAGCC
Sbjct: 61  SEISHKKPIAAAIAGNLTTIRNKRQAVGCAGCCKPGHPGRPGLPGRNGKPGVPGAPGRPG 120

Query: 516 XXXXXPIVCEEQDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGA 337
                PIVCEEQDV                                            GA
Sbjct: 121 TPGRPPIVCEEQDVPPCNPCPPGPPGPQGPTGNSGQPGRPGNPGRPGSPGTPGPVGPNGA 180

Query: 336 SGDSGAPGNDGEKGEPGRPAQSTPSTPGE 250
           SGDSGAPGNDGEKGEPGRPAQSTPSTPGE
Sbjct: 181 SGDSGAPGNDGEKGEPGRPAQSTPSTPGE 209



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/23 (100%), Positives = 23/23 (100%)
 Frame = -1

Query: 72  ERGICPKYCALDGGVFFEDGTRR 4
           ERGICPKYCALDGGVFFEDGTRR
Sbjct: 269 ERGICPKYCALDGGVFFEDGTRR 291



 Score = 34.3 bits (77), Expect = 3.7
 Identities = 14/27 (51%), Positives = 18/27 (65%)
 Frame = -1

Query: 336 SGDSGAPGNDGEKGEPGRPAQSTPSTP 256
           +G +GAPG+DG  G  G+P QS P  P
Sbjct: 216 AGATGAPGDDGAPGRDGQPGQSGPPGP 242



 Score = 33.1 bits (74), Expect = 8.3
 Identities = 15/29 (51%), Positives = 17/29 (57%)
 Frame = -1

Query: 339 ASGDSGAPGNDGEKGEPGRPAQSTPSTPG 253
           A GD GAPG DG+ G+ G P    P  PG
Sbjct: 221 APGDDGAPGRDGQPGQSGPP--GPPGPPG 247




[DB home][top]