Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y39B6A_28
(960 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25151576|ref|NP_741678.1| potassium channel TWIK-1 (36.4 kD) ... 620 e-176
gi|39580228|emb|CAE72984.1| Hypothetical protein CBG20326 [Caeno... 580 e-164
gi|11359774|pir||T45032 hypothetical protein Y39B6B.f [imported]... 534 e-150
gi|27503347|gb|AAH42262.1| MGC53410 protein [Xenopus laevis] 171 2e-41
gi|50741362|ref|XP_419561.1| PREDICTED: similar to putative pota... 164 3e-39
gi|19110344|gb|AAL82795.1| potassium channel TWIK-1 [Cavia porce... 164 4e-39
gi|4504847|ref|NP_002236.1| potassium channel, subfamily K, memb... 163 6e-39
gi|11067417|ref|NP_067720.1| putative potassium channel TWIK [Ra... 162 8e-39
gi|13277636|gb|AAH03729.1| Potassium channel, subfamily K, membe... 162 8e-39
gi|6680538|ref|NP_032456.1| potassium channel, subfamily K, memb... 160 5e-38
gi|2213891|gb|AAB61602.1| rabKCNK1 [Oryctolagus cuniculus] 159 1e-37
gi|34785960|gb|AAH58054.1| LOC402860 protein [Danio rerio] 157 3e-37
gi|28704121|gb|AAH47247.1| Kcnk6-prov protein [Xenopus laevis] 149 7e-35
gi|47221027|emb|CAG12721.1| unnamed protein product [Tetraodon n... 140 4e-32
gi|19110352|gb|AAL82796.1| potassium channel TWIK-2 [Cavia porce... 139 9e-32
gi|4758624|ref|NP_004814.1| potassium channel, subfamily K, memb... 139 1e-31
gi|34855627|ref|XP_215230.2| hypothetical protein XP_215230 [Rat... 138 2e-31
gi|38086199|ref|XP_355877.1| similar to potassium channel, subfa... 137 3e-31
gi|26331778|dbj|BAC29619.1| unnamed protein product [Mus musculus] 137 3e-31
gi|16758650|ref|NP_446258.1| potassium channel, subfamily K, mem... 137 4e-31
gi|47206503|emb|CAF90084.1| unnamed protein product [Tetraodon n... 136 8e-31
gi|32454070|gb|AAP82866.1| pancreatic potassium channel TALK-1b ... 122 2e-26
gi|9988112|emb|CAC07336.1| dJ137F1.2 (novel member of the potass... 121 3e-26
gi|47225271|emb|CAG09771.1| unnamed protein product [Tetraodon n... 121 3e-26
gi|14149764|ref|NP_115491.1| potassium channel, subfamily K, mem... 121 3e-26
gi|50748854|ref|XP_421431.1| PREDICTED: similar to potassium cha... 119 1e-25
gi|15718767|ref|NP_201567.1| potassium channel, subfamily K, mem... 119 1e-25
gi|7576935|gb|AAF64062.1| tandem pore domain potassium channel T... 119 1e-25
gi|15718765|ref|NP_057695.2| potassium channel, subfamily K, mem... 119 1e-25
gi|26349569|dbj|BAC38424.1| unnamed protein product [Mus musculus] 117 3e-25
gi|26331130|dbj|BAC29295.1| unnamed protein product [Mus musculus] 117 3e-25
gi|12831215|ref|NP_075584.1| potassium channel TREK-2 [Rattus no... 117 3e-25
gi|47225555|emb|CAG12038.1| unnamed protein product [Tetraodon n... 117 4e-25
gi|45505228|gb|AAS66991.1| potassium channel TREK-2 [Oryctolagus... 116 7e-25
gi|47229993|emb|CAG10407.1| unnamed protein product [Tetraodon n... 116 9e-25
gi|10863961|ref|NP_066984.1| potassium channel, subfamily K, mem... 116 9e-25
gi|19716292|gb|AAL95706.1| potassium channel TREK2 splice varian... 116 9e-25
gi|19716290|gb|AAL95705.1| potassium channel TREK2 splice varian... 116 9e-25
gi|20143944|ref|NP_612190.1| potassium channel, subfamily K, mem... 116 9e-25
gi|20143946|ref|NP_612191.1| potassium channel, subfamily K, mem... 116 9e-25
gi|29835154|gb|AAH51088.1| Kcnk5 protein [Mus musculus] 115 1e-24
gi|11496265|ref|NP_067517.1| potassium channel, subfamily K, mem... 115 1e-24
gi|34868980|ref|XP_223777.2| similar to dJ137F1.2 (novel member ... 115 1e-24
gi|47217179|emb|CAG11015.1| unnamed protein product [Tetraodon n... 114 4e-24
gi|4504851|ref|NP_003731.1| potassium channel, subfamily K, memb... 113 6e-24
gi|34861038|ref|XP_346569.1| hypothetical protein XP_346568 [Rat... 113 7e-24
gi|39584651|emb|CAE72404.1| Hypothetical protein CBG19563 [Caeno... 112 1e-23
gi|25282403|ref|NP_742038.1| potassium channel, subfamily K, mem... 112 2e-23
gi|50740491|ref|XP_419477.1| PREDICTED: similar to potassium cha... 111 2e-23
gi|20870425|ref|XP_138942.1| RIKEN cDNA 4731413G05 [Mus musculus] 111 2e-23
gi|32454074|gb|AAP82868.1| pancreatic potassium channel TALK-1d ... 111 3e-23
gi|17536613|ref|NP_494333.1| TWiK family of potassium channels (... 111 3e-23
gi|27807241|ref|NP_777111.1| potassium channel, subfamily K, mem... 110 4e-23
gi|18034771|ref|NP_446256.2| potassium inwardly-rectifying chann... 110 4e-23
gi|6680540|ref|NP_032457.1| potassium channel, subfamily K, memb... 110 4e-23
gi|50740290|ref|XP_419418.1| PREDICTED: similar to potassium cha... 110 4e-23
gi|13124054|sp|O95069|CIW2_HUMAN Potassium channel subfamily K m... 110 5e-23
gi|14589851|ref|NP_055032.1| potassium channel, subfamily K, mem... 110 5e-23
gi|5712621|gb|AAD47569.1| TREK-1 potassium channel [Homo sapiens] 110 5e-23
gi|41055407|ref|NP_956927.1| hypothetical protein MGC63921 [Dani... 110 6e-23
gi|38566067|gb|AAH62094.1| Kcnk2 protein [Mus musculus] 110 6e-23
gi|6754432|ref|NP_034737.1| potassium channel, subfamily K, memb... 110 6e-23
gi|50749036|ref|XP_426457.1| PREDICTED: similar to potassium cha... 108 1e-22
gi|47219414|emb|CAG01577.1| unnamed protein product [Tetraodon n... 108 1e-22
gi|19110369|gb|AAL82797.1| potassium channel TWIK-2 [Cavia porce... 108 2e-22
gi|47229323|emb|CAG04075.1| unnamed protein product [Tetraodon n... 107 4e-22
gi|48095690|ref|XP_394509.1| similar to CG9637-PA [Apis mellifera] 107 5e-22
gi|7511511|pir||T32347 outward rectifier potassium channel homol... 107 5e-22
gi|33859576|ref|NP_034738.1| potassium channel, subfamily K, mem... 106 7e-22
gi|15431283|ref|NP_203694.1| potassium channel, subfamily K, mem... 106 7e-22
gi|27807011|ref|NP_776983.1| potassium channel, subfamily K, mem... 106 7e-22
gi|32454072|gb|AAP82867.1| pancreatic potassium channel TALK-1c ... 106 9e-22
gi|4103376|gb|AAD09338.1| putative potassium channel DP4 [Mus mu... 105 1e-21
gi|4504849|ref|NP_002237.1| potassium channel, subfamily K, memb... 105 2e-21
gi|16758136|ref|NP_445857.1| potassium channel, subfamily K, mem... 104 3e-21
gi|14583127|gb|AAK69764.1| potassium channel TASK-3 [Rattus norv... 104 3e-21
gi|24636274|sp|Q9ES08|CIW9_RAT Potassium channel subfamily K mem... 104 3e-21
gi|11177516|gb|AAG32314.1| tandem pore domain potassium channel ... 104 3e-21
gi|16306555|ref|NP_071337.2| potassium channel, subfamily K, mem... 104 3e-21
gi|2465544|gb|AAC53367.1| TWIK-related acid-sensitive K+ channel... 103 6e-21
gi|22122525|ref|NP_666149.1| potassium channel, subfamily K, mem... 103 6e-21
gi|50740494|ref|XP_419478.1| PREDICTED: similar to potassium cha... 103 6e-21
gi|47224316|emb|CAG09162.1| unnamed protein product [Tetraodon n... 103 8e-21
gi|17025230|ref|NP_113648.2| potassium channel, subfamily K, mem... 103 8e-21
gi|24528452|gb|AAN62847.1| tandem pore domain potassium channel ... 102 1e-20
gi|13507377|gb|AAK28551.1| potassium channel TASK-4 [Homo sapiens] 102 1e-20
gi|19343981|gb|AAH25726.1| Potassium channel, subfamily K, membe... 102 1e-20
gi|24646638|ref|NP_650300.1| CG9637-PA [Drosophila melanogaster]... 102 2e-20
gi|11560129|ref|NP_071629.1| tandem pore domain potassium channe... 102 2e-20
gi|50758683|ref|XP_417369.1| PREDICTED: similar to Potassium cha... 101 2e-20
gi|13431425|sp|Q9JL58|CIW9_CAVPO Potassium channel subfamily K m... 101 2e-20
gi|48120923|ref|XP_396471.1| similar to ENSANGP00000021888 [Apis... 101 3e-20
gi|47227295|emb|CAF96844.1| unnamed protein product [Tetraodon n... 100 4e-20
gi|47216202|emb|CAG01236.1| unnamed protein product [Tetraodon n... 100 5e-20
gi|7706135|ref|NP_057685.1| potassium channel, subfamily K, memb... 99 1e-19
gi|25513799|pir||JC7703 TASK-5 protein - human 99 1e-19
gi|11641275|ref|NP_071753.1| potassium family, subfamily K, memb... 99 1e-19
gi|31240391|ref|XP_320609.1| ENSANGP00000010680 [Anopheles gambi... 99 1e-19
gi|39930507|ref|NP_570826.1| potassium channel, subfamily K, mem... 99 2e-19
gi|38075345|ref|XP_141526.2| similar to Potassium channel subfam... 99 2e-19
gi|39592250|emb|CAE75471.1| Hypothetical protein CBG23471 [Caeno... 97 4e-19
gi|24645352|ref|NP_649891.1| CG9361-PA [Drosophila melanogaster]... 97 4e-19
gi|31207013|ref|XP_312473.1| ENSANGP00000021888 [Anopheles gambi... 97 7e-19
gi|9988111|emb|CAC07335.1| dJ137F1.1 (novel member of the potass... 96 9e-19
gi|10944275|emb|CAC14068.1| dJ781B1.1 (Two pore potassium channe... 96 9e-19
gi|17530889|ref|NP_511112.1| CG1615-PB [Drosophila melanogaster]... 96 1e-18
gi|47222681|emb|CAG00115.1| unnamed protein product [Tetraodon n... 95 3e-18
gi|11560127|ref|NP_071628.1| potassium channel, subfamily K, mem... 92 1e-17
gi|11545761|ref|NP_071338.1| potassium channel, subfamily K, mem... 92 1e-17
gi|40445393|ref|NP_954859.1| potassium channel, subfamily K, mem... 92 1e-17
gi|48094838|ref|XP_394281.1| similar to ENSANGP00000013427 [Apis... 92 2e-17
gi|31198023|ref|XP_307959.1| ENSANGP00000013427 [Anopheles gambi... 90 7e-17
gi|39589742|emb|CAE66977.1| Hypothetical protein CBG12373 [Caeno... 90 7e-17
gi|10801598|dbj|BAB16710.1| TASK1 splice bvariant (TASK1b) [Ratt... 90 7e-17
gi|31441785|emb|CAB03071.3| C. elegans TWK-30 protein (correspon... 89 1e-16
gi|17550920|ref|NP_510284.1| TWiK family of potassium channels (... 88 3e-16
gi|7497246|pir||T19860 hypothetical protein C40C9.1 - Caenorhabd... 88 3e-16
gi|39596487|emb|CAE63106.1| Hypothetical protein CBG07401 [Caeno... 87 4e-16
gi|17536611|ref|NP_495961.1| TWiK family of potassium channels (... 86 1e-15
gi|17564900|ref|NP_506103.1| TWiK family of potassium channels (... 86 1e-15
gi|31211993|ref|XP_314981.1| ENSANGP00000021390 [Anopheles gambi... 86 1e-15
gi|19882235|ref|NP_084187.1| TREK2; outward rectifying potassium... 86 2e-15
gi|47228939|emb|CAG09454.1| unnamed protein product [Tetraodon n... 85 3e-15
gi|17563162|ref|NP_507485.1| potassium channel family member (5S... 84 4e-15
gi|50507821|emb|CAB07854.2| Hypothetical protein R12G8.2 [Caenor... 84 4e-15
gi|15419623|gb|AAK97094.1| tandem acid-sensitive potassium chann... 84 4e-15
gi|47208750|emb|CAF94456.1| unnamed protein product [Tetraodon n... 84 4e-15
gi|17507181|ref|NP_492381.1| fibronectin, type III and ion trans... 84 5e-15
gi|7500584|pir||T21834 hypothetical protein F36A2.4 - Caenorhabd... 84 5e-15
gi|34861469|ref|XP_219517.2| similar to mitogen activated protei... 84 6e-15
gi|39587874|emb|CAE67892.1| Hypothetical protein CBG13488 [Caeno... 84 6e-15
gi|9971951|gb|AAG10509.1| 2P domain K+ channel TWIK-2 [Rattus no... 83 8e-15
gi|9971947|gb|AAG10507.1| 2P domain K+ channel TWIK-2 [Homo sapi... 83 1e-14
gi|39596461|emb|CAE63080.1| Hypothetical protein CBG07369 [Caeno... 83 1e-14
gi|24641306|ref|NP_572720.1| CG1756-PA [Drosophila melanogaster]... 82 2e-14
gi|25395539|pir||H88124 protein T12C9.3 [imported] - Caenorhabdi... 82 2e-14
gi|21707910|gb|AAH33577.1| KCNK4 protein [Homo sapiens] 82 2e-14
gi|39589137|emb|CAE57870.1| Hypothetical protein CBG00910 [Caeno... 81 3e-14
gi|39594738|emb|CAE70606.1| Hypothetical protein CBG17283 [Caeno... 81 3e-14
gi|17570153|ref|NP_510305.1| TWiK family of potassium channels (... 81 3e-14
gi|39584817|emb|CAE67712.1| Hypothetical protein CBG13286 [Caeno... 81 3e-14
gi|5821141|dbj|BAA35074.1| double-pore K channel 3 [Mus musculus] 80 5e-14
gi|4103374|gb|AAD09337.1| putative potassium channel DP3 [Mus mu... 80 7e-14
gi|32565295|ref|NP_499470.2| putative protein family member, wit... 80 7e-14
gi|31228794|ref|XP_318112.1| ENSANGP00000017590 [Anopheles gambi... 80 7e-14
gi|7509931|pir||T26953 hypothetical protein Y47D3B.5 - Caenorhab... 80 7e-14
gi|6502965|gb|AAF14528.1| two pore domain potassium channel KCNK... 80 7e-14
gi|8132414|gb|AAF73282.1| two pore domain K+ channel subunit [Mu... 80 7e-14
gi|17570457|ref|NP_509942.1| ion transport protein family member... 80 7e-14
gi|19110360|gb|AAL82798.1| potassium channel KCNK7 [Cavia porcel... 79 1e-13
gi|6649861|gb|AAF21603.1| neuromuscular two P domain potassium c... 79 1e-13
gi|17560382|ref|NP_508031.1| putative protein family member, wit... 79 1e-13
gi|4768615|gb|AAD29577.1| two pore domain K+ channel subunit [Mu... 79 1e-13
gi|31043788|emb|CAB07375.2| Hypothetical protein F31D4.7 [Caenor... 79 1e-13
gi|13124112|sp|Q9Z2T1|CIW8_MOUSE Potassium channel subfamily K m... 79 1e-13
gi|39585309|emb|CAE61631.1| Hypothetical protein CBG05561 [Caeno... 79 1e-13
gi|39587366|emb|CAE75020.1| Hypothetical protein CBG22924 [Caeno... 79 2e-13
gi|25144330|ref|NP_498903.2| TWiK family of potassium channels (... 79 2e-13
gi|1078847|pir||S44635 f22b7.7 protein - Caenorhabditis elegans 79 2e-13
gi|39582763|emb|CAE74226.1| Hypothetical protein CBG21910 [Caeno... 79 2e-13
gi|39585390|emb|CAE61712.1| Hypothetical protein CBG05661 [Caeno... 78 3e-13
gi|17555324|ref|NP_499790.1| twk-8 protein like family member (3... 77 4e-13
gi|39591758|emb|CAE71336.1| Hypothetical protein CBG18237 [Caeno... 77 8e-13
gi|17570155|ref|NP_510654.1| predicted CDS, TWiK family of potas... 77 8e-13
gi|38077857|ref|XP_139424.3| similar to potassium channel TASK3 ... 76 1e-12
gi|25147096|ref|NP_508732.2| twk-8 protein like family member (X... 76 1e-12
gi|39597677|emb|CAE68368.1| Hypothetical protein CBG14123 [Caeno... 75 2e-12
gi|16118231|ref|NP_203133.1| potassium channel, subfamily K, mem... 75 2e-12
gi|5031821|ref|NP_005705.1| potassium channel, subfamily K, memb... 75 2e-12
gi|16118233|ref|NP_203134.1| potassium channel, subfamily K, mem... 75 2e-12
gi|47224354|emb|CAG09200.1| unnamed protein product [Tetraodon n... 75 2e-12
gi|39597860|emb|CAE68552.1| Hypothetical protein CBG14385 [Caeno... 75 3e-12
gi|24647970|ref|NP_650726.1| CG10864-PA [Drosophila melanogaster... 75 3e-12
gi|17565094|ref|NP_507483.1| putative protein family member, wit... 74 5e-12
gi|17536609|ref|NP_495727.1| TWiK family of potassium channels (... 74 5e-12
gi|47217756|emb|CAG05978.1| unnamed protein product [Tetraodon n... 74 6e-12
gi|48124394|ref|XP_396556.1| similar to CG8713-PA [Apis mellifera] 73 8e-12
gi|34850053|gb|AAK39218.3| Twik family of potassium channels pro... 73 8e-12
gi|39580013|emb|CAE56818.1| Hypothetical protein CBG24632 [Caeno... 72 1e-11
gi|39593815|emb|CAE62108.1| Hypothetical protein CBG06143 [Caeno... 72 1e-11
gi|50732038|ref|XP_425942.1| PREDICTED: similar to Potassium cha... 72 2e-11
gi|50507748|emb|CAB01238.2| Hypothetical protein M04B2.5 [Caenor... 72 2e-11
gi|17542644|ref|NP_502170.1| TWiK family of potassium channels (... 72 2e-11
gi|7546841|gb|AAF63707.1| potassium channel TASK3 [Cavia porcellus] 70 5e-11
gi|48107867|ref|XP_396190.1| similar to ENSANGP00000017384 [Apis... 70 5e-11
gi|17565098|ref|NP_507480.1| potassium channel TWIK-1 family mem... 70 5e-11
gi|17570151|ref|NP_508522.1| TWiK family of potassium channels (... 70 9e-11
gi|39585409|emb|CAE61731.1| Hypothetical protein CBG05682 [Caeno... 70 9e-11
gi|39596343|emb|CAE69981.1| Hypothetical protein CBG16379 [Caeno... 70 9e-11
gi|39594328|emb|CAE71906.1| Hypothetical protein CBG18967 [Caeno... 70 9e-11
gi|39590077|emb|CAE61075.1| Hypothetical protein CBG04825 [Caeno... 70 9e-11
gi|7505938|pir||T16629 hypothetical protein M02F4.5 - Caenorhabd... 70 9e-11
gi|7496375|pir||T15584 hypothetical protein C24A3.6 - Caenorhabd... 69 1e-10
gi|39586438|emb|CAE74097.1| Hypothetical protein CBG21757 [Caeno... 69 1e-10
gi|17570149|ref|NP_509516.1| TWiK family of potassium channels (... 69 1e-10
gi|50739068|ref|XP_426109.1| PREDICTED: similar to potassium cha... 69 2e-10
gi|31205787|ref|XP_311845.1| ENSANGP00000017550 [Anopheles gambi... 68 3e-10
gi|39588079|emb|CAE57311.1| Hypothetical protein CBG00233 [Caeno... 67 5e-10
gi|47228958|emb|CAG09473.1| unnamed protein product [Tetraodon n... 67 6e-10
gi|39587238|emb|CAE57706.1| Hypothetical protein CBG00713 [Caeno... 67 6e-10
gi|32562837|ref|NP_492511.2| putative protein family member, wit... 67 8e-10
gi|7503519|pir||T22269 hypothetical protein F46A9.3 - Caenorhabd... 67 8e-10
gi|39595158|emb|CAE60195.1| Hypothetical protein CBG03756 [Caeno... 67 8e-10
gi|7497822|pir||T28933 hypothetical protein C52B9.6 - Caenorhabd... 66 1e-09
gi|25146143|ref|NP_506906.2| potassium channel TWIK-1 family mem... 65 2e-09
gi|7505363|pir||T23373 hypothetical protein K06B4.12 - Caenorhab... 65 2e-09
gi|17564904|ref|NP_504663.1| predicted CDS, TWiK family of potas... 65 2e-09
gi|39590727|emb|CAE65097.1| Hypothetical protein CBG09957 [Caeno... 65 2e-09
gi|17559912|ref|NP_504783.1| ion transport protein family member... 65 3e-09
gi|24655040|ref|NP_612084.1| CG9194-PA [Drosophila melanogaster]... 65 3e-09
gi|7499459|pir||T30037 hypothetical protein F20A1.7 - Caenorhabd... 65 3e-09
gi|17559910|ref|NP_504782.1| ion transport protein family member... 65 3e-09
gi|32566714|ref|NP_872139.1| ion transport protein family member... 65 3e-09
gi|17564894|ref|NP_505731.1| TWiK family of potassium channels (... 64 4e-09
gi|32566087|ref|NP_502685.2| putative protein family member, wit... 64 5e-09
gi|7509540|pir||T26616 hypothetical protein Y37A1B.11 - Caenorha... 64 5e-09
gi|39594463|emb|CAE72041.1| Hypothetical protein CBG19123 [Caeno... 64 5e-09
gi|33300325|emb|CAE17863.1| Hypothetical protein K11H3.7 [Caenor... 64 7e-09
gi|33636599|gb|AAQ23597.1| RE05370p [Drosophila melanogaster] 63 9e-09
gi|17536607|ref|NP_496452.1| TWiK family of potassium channels (... 63 9e-09
gi|32565622|ref|NP_499529.2| ion transport protein (3M891) [Caen... 63 9e-09
gi|50507717|emb|CAA91376.2| Hypothetical protein B0334.2 [Caenor... 63 9e-09
gi|7496433|pir||T19429 hypothetical protein C24H11.8 - Caenorhab... 63 9e-09
gi|39584824|emb|CAE67719.1| Hypothetical protein CBG13294 [Caeno... 63 1e-08
gi|17542646|ref|NP_501578.1| TWiK family of potassium channels (... 63 1e-08
gi|34556101|emb|CAE46687.1| C. elegans TWK-8 protein (correspond... 63 1e-08
gi|39597266|emb|CAE59494.1| Hypothetical protein CBG02879 [Caeno... 62 1e-08
gi|17564898|ref|NP_506078.1| TWiK family of potassium channels (... 62 2e-08
gi|50507754|emb|CAH04700.1| Hypothetical protein F55C5.3b [Caeno... 62 2e-08
gi|17555394|ref|NP_497973.1| TWiK family of potassium channels (... 62 3e-08
gi|48124383|ref|XP_393264.1| similar to ENSANGP00000017550 [Apis... 62 3e-08
gi|19921794|ref|NP_610349.1| CG8713-PA [Drosophila melanogaster]... 62 3e-08
gi|25151936|ref|NP_741845.1| putative potassium channel subunit ... 60 6e-08
gi|11359804|pir||T43393 potassium channel chain n2P17m3 homolog ... 60 6e-08
gi|25151930|ref|NP_741843.1| putative potassium channel subunit ... 60 6e-08
gi|25151933|ref|NP_741842.1| putative potassium channel subunit ... 60 6e-08
gi|21392667|gb|AAM51529.1| Hypothetical protein C44E12.3a [Caeno... 60 6e-08
gi|47222588|emb|CAG02953.1| unnamed protein product [Tetraodon n... 60 6e-08
gi|25151942|ref|NP_741844.1| putative potassium channel subunit ... 60 6e-08
gi|25151939|ref|NP_741846.1| putative potassium channel subunit ... 60 6e-08
gi|31204249|ref|XP_311073.1| ENSANGP00000017384 [Anopheles gambi... 60 1e-07
gi|39590497|emb|CAE66237.1| Hypothetical protein CBG11481 [Caeno... 60 1e-07
gi|39593400|emb|CAE64870.1| Hypothetical protein CBG09670 [Caeno... 59 1e-07
gi|39592213|emb|CAE75434.1| Hypothetical protein CBG23427 [Caeno... 59 1e-07
gi|19921934|ref|NP_610516.1| CG1688-PA [Drosophila melanogaster]... 59 2e-07
gi|39594882|emb|CAE70750.1| Hypothetical protein CBG17497 [Caeno... 59 2e-07
gi|39594957|emb|CAE70825.1| Hypothetical protein CBG17601 [Caeno... 58 3e-07
gi|7507331|pir||T24626 hypothetical protein T06H11.1 - Caenorhab... 58 3e-07
gi|17564896|ref|NP_506416.1| TWiK family of potassium channels (... 58 4e-07
gi|26354474|dbj|BAC40865.1| unnamed protein product [Mus musculus] 58 4e-07
gi|24656702|ref|NP_611547.1| CG15655-PA [Drosophila melanogaster... 57 5e-07
gi|25147273|ref|NP_508526.2| potassium channel subunit n2P16 fam... 57 6e-07
gi|39591002|emb|CAE58782.1| Hypothetical protein CBG01980 [Caeno... 57 6e-07
gi|7503954|pir||T16426 hypothetical protein F52E4.4 - Caenorhabd... 57 6e-07
gi|39582439|emb|CAE74823.1| Hypothetical protein CBG22661 [Caeno... 57 6e-07
gi|25147267|ref|NP_741881.1| UNCoordinated locomotion UNC-110, M... 57 8e-07
gi|48106734|ref|XP_396150.1| similar to ENSANGP00000021390 [Apis... 57 8e-07
gi|17570157|ref|NP_510655.1| TWiK family of potassium channels (... 57 8e-07
gi|25147270|ref|NP_741880.1| UNCoordinated locomotion UNC-110, M... 57 8e-07
gi|17542648|ref|NP_501724.1| TWiK family of potassium channels (... 57 8e-07
gi|7500371|pir||T21683 hypothetical protein F32H5.2 - Caenorhabd... 56 1e-06
gi|34935427|ref|XP_234380.2| similar to potassium channel, subfa... 56 1e-06
gi|7499553|pir||T21188 hypothetical protein F21C3.1 - Caenorhabd... 56 1e-06
gi|32563600|ref|NP_492054.2| TWiK family of potassium channels (... 56 1e-06
gi|25146228|ref|NP_506091.2| TWiK family of potassium channels (... 56 1e-06
gi|7506281|pir||T23907 hypothetical protein R04F11.4 - Caenorhab... 56 1e-06
gi|39584578|emb|CAE74656.1| Hypothetical protein CBG22456 [Caeno... 55 2e-06
gi|17536221|ref|NP_494786.1| twk-8 protein like family member (2... 55 3e-06
gi|50292983|ref|XP_448924.1| unnamed protein product [Candida gl... 55 3e-06
gi|49035146|gb|AAK18976.2| Twik family of potassium channels pro... 55 3e-06
gi|39597681|emb|CAE68372.1| Hypothetical protein CBG14128 [Caeno... 55 3e-06
gi|50725050|dbj|BAD33183.1| putative outward-rectifying potassiu... 54 4e-06
gi|39592237|emb|CAE75458.1| Hypothetical protein CBG23453 [Caeno... 54 4e-06
gi|17506133|ref|NP_491810.1| potassium channel DP4 family member... 54 5e-06
gi|31231315|ref|XP_318503.1| ENSANGP00000021246 [Anopheles gambi... 54 5e-06
gi|39594139|emb|CAE70249.1| Hypothetical protein CBG16741 [Caeno... 54 7e-06
gi|10801600|dbj|BAB16711.1| TWIK-related acid-sensitive K+ chann... 53 9e-06
gi|38085211|ref|XP_285304.2| similar to TWIK-related spinal cord... 53 1e-05
gi|39595653|emb|CAE67155.1| Hypothetical protein CBG12580 [Caeno... 52 2e-05
gi|6322368|ref|NP_012442.1| Target Of K1 Killer Toxin; Tok1p [Sa... 52 2e-05
gi|1147595|emb|CAA64176.1| outward-rectifier potassium channel [... 52 2e-05
gi|15236780|ref|NP_193550.1| outward rectifying potassium channe... 52 2e-05
gi|45594290|gb|AAS68516.1| 2P K ion channel TRESK [Rattus norveg... 52 2e-05
gi|32469495|ref|NP_862823.1| TWIK-related spinal cord K+ channel... 52 2e-05
gi|46134185|ref|XP_389408.1| hypothetical protein FG09232.1 [Gib... 52 3e-05
gi|17556454|ref|NP_497621.1| predicted CDS, open rectifier K+ ch... 51 4e-05
gi|47568805|ref|ZP_00239499.1| potassium channel protein [Bacill... 50 8e-05
gi|39597105|emb|CAE59332.1| Hypothetical protein CBG02674 [Caeno... 50 8e-05
gi|14475603|dbj|BAB60857.1| hypothetical protein [Bacillus cereus] 50 1e-04
gi|30018851|ref|NP_830482.1| Potassium channel protein [Bacillus... 50 1e-04
gi|46434032|gb|EAK93454.1| hypothetical protein CaO19.4175 [Cand... 50 1e-04
gi|50549977|ref|XP_502461.1| hypothetical protein [Yarrowia lipo... 49 1e-04
gi|17535453|ref|NP_495313.1| potassium channel DP4 (2G784) [Caen... 49 1e-04
gi|48838131|ref|ZP_00295079.1| COG1226: Kef-type K+ transport sy... 49 1e-04
gi|38176034|gb|AAK68392.2| Hypothetical protein R05G9.2 [Caenorh... 49 1e-04
gi|45357590|ref|NP_987147.1| putative potassium channel protein ... 48 3e-04
gi|21228960|ref|NP_634882.1| Potassium channel protein [Methanos... 48 3e-04
gi|47199354|emb|CAF95826.1| unnamed protein product [Tetraodon n... 48 3e-04
gi|46117626|ref|ZP_00174072.2| COG1226: Kef-type K+ transport sy... 47 5e-04
gi|21398638|ref|NP_654623.1| hypothetical protein predicted by G... 47 5e-04
gi|42779821|ref|NP_977068.1| conserved hypothetical protein [Bac... 47 5e-04
gi|22535558|dbj|BAC10733.1| putative potassium channel [Oryza sa... 47 5e-04
gi|31228802|ref|XP_318113.1| ENSANGP00000003582 [Anopheles gambi... 47 5e-04
gi|20091059|ref|NP_617134.1| potassium channel protein [Methanos... 47 8e-04
gi|46139449|ref|XP_391415.1| hypothetical protein FG11239.1 [Gib... 47 8e-04
gi|38102438|gb|EAA49275.1| hypothetical protein MG00933.4 [Magna... 47 8e-04
gi|50311387|ref|XP_455718.1| unnamed protein product [Kluyveromy... 46 0.001
gi|47205104|emb|CAF91896.1| unnamed protein product [Tetraodon n... 46 0.001
gi|48138893|ref|XP_396947.1| similar to ENSANGP00000017550 [Apis... 46 0.001
gi|47228959|emb|CAG09474.1| unnamed protein product [Tetraodon n... 45 0.002
gi|48124397|ref|XP_396557.1| similar to ENSANGP00000003582 [Apis... 45 0.002
gi|16122880|ref|NP_406193.1| putative potassium channel protein ... 45 0.002
gi|15217783|ref|NP_171752.1| outward rectifying potassium channe... 45 0.003
gi|16082402|ref|NP_394887.1| probable potassium channel protein ... 45 0.003
gi|38605046|sp|Q9FWX6|KCO4_ARATH Putative outward-rectifying pot... 45 0.003
gi|33594472|ref|NP_882116.1| putative potassium channel protein ... 44 0.005
gi|33595148|ref|NP_882791.1| putative potassium channel protein ... 44 0.005
gi|33599430|ref|NP_886990.1| putative potassium channel protein ... 44 0.005
gi|15237430|ref|NP_199449.1| outward rectifying potassium channe... 44 0.007
gi|6686780|emb|CAB64717.1| KCO2 protein [Arabidopsis thaliana] 44 0.007
gi|3493321|gb|AAC33365.1| delayed rectifier potassium channel [D... 43 0.012
gi|158459|gb|AAA28896.1| Shab11 protein 43 0.012
gi|17380406|sp|P17970|CIKB_DROME Potassium voltage-gated channel... 43 0.012
gi|13541819|ref|NP_111507.1| Kef-type K+ transport system, predi... 43 0.012
gi|47225033|emb|CAF97448.1| unnamed protein product [Tetraodon n... 43 0.012
gi|45532509|ref|ZP_00183513.1| COG1226: Kef-type K+ transport sy... 42 0.016
gi|38081978|ref|XP_357550.1| similar to Potassium channel subfam... 42 0.016
gi|50552031|ref|XP_503490.1| hypothetical protein [Yarrowia lipo... 42 0.016
gi|15668310|ref|NP_247106.1| potassium channel protein [Methanoc... 42 0.016
gi|28144878|gb|AAO32309.1| putative outward rectifying potassium... 42 0.016
gi|9719297|gb|AAF97727.1| Eucalyptus camaldulensis outward-recti... 42 0.021
gi|48833229|ref|ZP_00290251.1| COG1226: Kef-type K+ transport sy... 42 0.021
gi|24376318|ref|NP_720426.1| conserved hypothetical protein [She... 42 0.021
gi|28571421|ref|NP_572321.2| CG3367-PA [Drosophila melanogaster]... 42 0.021
gi|47217755|emb|CAG05977.1| unnamed protein product [Tetraodon n... 42 0.027
gi|17549943|ref|NP_508108.1| putative protein, with at least 3 t... 42 0.027
gi|24656289|ref|NP_523894.2| CG1066-PB [Drosophila melanogaster]... 41 0.035
gi|15234351|ref|NP_192093.1| outward rectifying potassium channe... 41 0.035
gi|24656294|ref|NP_728783.1| CG1066-PA [Drosophila melanogaster]... 41 0.035
gi|23821211|emb|CAD53325.1| potassium channel [Neurospora crassa] 41 0.035
gi|31215061|ref|XP_315955.1| ENSANGP00000013550 [Anopheles gambi... 41 0.035
gi|49079900|ref|XP_403540.1| hypothetical protein UM05925.1 [Ust... 41 0.035
gi|17232125|ref|NP_488673.1| probable ion transporter [Nostoc sp... 41 0.046
gi|48781501|ref|ZP_00278109.1| COG1226: Kef-type K+ transport sy... 41 0.046
gi|46113983|ref|ZP_00184200.2| COG1226: Kef-type K+ transport sy... 41 0.046
gi|29377477|ref|NP_816631.1| conserved hypothetical protein [Ent... 41 0.046
gi|15668309|ref|NP_247105.1| potassium channel protein [Methanoc... 41 0.046
gi|48102756|ref|XP_395425.1| similar to ENSANGP00000021246 [Apis... 41 0.046
gi|24639778|ref|NP_726963.1| CG32770-PA [Drosophila melanogaster... 41 0.046
gi|44890021|emb|CAF32139.1| outward-rectifier potassium channel ... 40 0.060
gi|45532263|ref|ZP_00183274.1| COG1226: Kef-type K+ transport sy... 40 0.060
gi|47197793|emb|CAF88105.1| unnamed protein product [Tetraodon n... 40 0.060
gi|46312337|ref|ZP_00212934.1| COG1226: Kef-type K+ transport sy... 40 0.060
gi|48141224|ref|XP_393546.1| similar to CG1066-PA [Apis mellifera] 40 0.060
gi|50405004|ref|YP_054096.1| K+ channel, putative [Paramecium te... 40 0.060
gi|34899396|ref|NP_911044.1| putative outward-rectifying potassi... 40 0.078
gi|45506627|ref|ZP_00158979.1| COG1226: Kef-type K+ transport sy... 40 0.10
gi|23125946|ref|ZP_00107859.1| COG1226: Kef-type K+ transport sy... 40 0.10
gi|13358138|ref|NP_078412.1| potassium channel protein [Ureaplas... 40 0.10
gi|50760596|ref|XP_418075.1| PREDICTED: potassium voltage-gated ... 40 0.10
gi|42519024|ref|NP_964954.1| hypothetical protein LJ1098 [Lactob... 40 0.10
gi|26006812|sp|Q9PT84|KCH2_CHICK Potassium voltage-gated channel... 40 0.10
gi|48892039|ref|ZP_00325472.1| COG0664: cAMP-binding proteins - ... 39 0.13
gi|15669547|ref|NP_248360.1| potassium channel protein, putative... 39 0.13
gi|15807327|ref|NP_296057.1| potassium channel, putative [Deinoc... 39 0.13
gi|7489262|pir||T07396 probable outward rectifying potassium cha... 39 0.13
gi|15828892|ref|NP_326252.1| POTASSIUM CHANNEL PROTEIN [Mycoplas... 39 0.17
gi|2181186|emb|CAA65988.1| outward rectifying potassium channel ... 39 0.17
gi|4323298|gb|AAD16279.1| pulvinus outward-rectifying channel fo... 39 0.17
gi|6753710|ref|NP_034228.1| opsin (encephalopsin); encephalopsin... 39 0.23
gi|47458968|ref|YP_015830.1| putative K+ ion channel membrane pr... 39 0.23
gi|27684873|ref|XP_220024.1| similar to potassium channel, subfa... 38 0.30
gi|32405542|ref|XP_323384.1| hypothetical protein [Neurospora cr... 38 0.30
gi|34147232|ref|NP_899002.1| potassium channel, subfamily V, mem... 38 0.30
gi|13540928|ref|NP_110616.1| Kef-type K+ transport system, predi... 38 0.30
gi|23100733|ref|NP_694200.1| potassium channel protein [Oceanoba... 38 0.30
gi|17556452|ref|NP_497620.1| predicted CDS, putative protein fam... 38 0.39
gi|48097437|ref|XP_391895.1| similar to ENSANGP00000008044 [Apis... 38 0.39
gi|20094044|ref|NP_613891.1| Kef-type K+ transport systems, pred... 38 0.39
gi|29377322|ref|NP_816476.1| ion transporter, putative [Enteroco... 38 0.39
gi|7512004|pir||T13168 probable potassium channel elk chain - fr... 38 0.39
gi|17136946|ref|NP_477009.1| CG5076-PA [Drosophila melanogaster]... 38 0.39
gi|13276863|emb|CAC34339.1| K+ channel protein [Solanum tuberosum] 38 0.39
gi|4151117|emb|CAA12225.1| K+ channel protein [Solanum tuberosum] 38 0.39
gi|15240552|ref|NP_200374.1| outward rectifying potassium channe... 38 0.39
gi|28870939|ref|NP_793558.1| potassium channel protein, putative... 38 0.39
gi|21225475|ref|NP_631254.1| putative ion transport integral mem... 37 0.51
gi|32566708|ref|NP_872137.1| putative protein family member, wit... 37 0.51
gi|31198437|ref|XP_308166.1| ENSANGP00000009272 [Anopheles gambi... 37 0.51
gi|48098119|ref|XP_393977.1| similar to ENSANGP00000009272 [Apis... 37 0.51
gi|47219730|emb|CAG12652.1| unnamed protein product [Tetraodon n... 37 0.51
gi|15831004|ref|NP_309777.1| putative potassium channel protein ... 37 0.51
gi|11354242|pir||T45507 hypothetical protein kch [imported] - Es... 37 0.51
gi|16129211|ref|NP_415766.1| putative potassium channel protein;... 37 0.51
gi|902412|gb|AAB60095.1| putative potassium channel 37 0.51
gi|15801476|ref|NP_287493.1| putative potassium channel protein ... 37 0.51
gi|902394|gb|AAB60079.1| putative potassium channel 37 0.51
gi|902439|gb|AAB60119.1| putative potassium channel 37 0.51
gi|30062771|ref|NP_836942.1| putative potassium channel protein ... 37 0.51
gi|13540549|ref|NP_110406.1| potassium voltage-gated channel, su... 37 0.51
gi|37520502|ref|NP_923879.1| potassium channel protein [Gloeobac... 37 0.51
gi|32477506|ref|NP_870500.1| potassium channel [Pirellula sp. 1]... 37 0.51
gi|16329750|ref|NP_440478.1| potassium channel [Synechocystis sp... 37 0.51
gi|24112647|ref|NP_707157.1| putative potassium channel protein ... 37 0.51
gi|26247580|ref|NP_753620.1| Putative potassium channel protein ... 37 0.51
gi|21224301|ref|NP_630080.1| putative membrane protein [Streptom... 37 0.51
gi|23465246|ref|NP_695849.1| possible voltage-gated potassium ch... 37 0.66
gi|38077855|ref|XP_139425.3| similar to potassium channel, subfa... 37 0.66
gi|50876151|emb|CAG35991.1| related to voltage-gated potassium c... 37 0.66
gi|7243225|dbj|BAA92660.1| KIAA1422 protein [Homo sapiens] 37 0.66
gi|30023424|ref|NP_835055.1| Potassium channel protein [Bacillus... 37 0.66
gi|46190713|ref|ZP_00121151.2| COG1226: Kef-type K+ transport sy... 37 0.66
gi|15894597|ref|NP_347946.1| Potassium channel subunit [Clostrid... 37 0.66
gi|47570514|ref|ZP_00241142.1| potassium channel, putative [Baci... 37 0.66
gi|13365907|dbj|BAB39327.1| hypothetical protein [Macaca fascicu... 37 0.66
gi|15606902|ref|NP_214283.1| potassium channel protein [Aquifex ... 37 0.86
gi|103386|pir||S12746 potassium channel protein shab11 - fruit f... 37 0.86
gi|39592580|emb|CAE63657.1| Hypothetical protein CBG08159 [Caeno... 37 0.86
gi|46142369|ref|ZP_00149049.2| COG1226: Kef-type K+ transport sy... 37 0.86
gi|34496564|ref|NP_900779.1| probable ATP-sensitive inward recti... 37 0.86
gi|33863599|ref|NP_895159.1| putative potassium channel, VIC fam... 37 0.86
gi|19424136|ref|NP_598004.1| potassium channel, subfamily V, mem... 37 0.86
gi|46323671|ref|ZP_00224034.1| COG1226: Kef-type K+ transport sy... 37 0.86
gi|17545169|ref|NP_518571.1| PUTATIVE ATP-SENSITIVE INWARD RECTI... 37 0.86
gi|46314962|ref|ZP_00215546.1| COG1226: Kef-type K+ transport sy... 37 0.86
gi|47224426|emb|CAG08676.1| unnamed protein product [Tetraodon n... 37 0.86
gi|16758818|ref|NP_446389.1| potassium voltage-gated channel, su... 37 0.86
gi|28202039|ref|NP_780671.1| potassium channel, subfamily T, mem... 37 0.86
gi|7321945|gb|AAC60504.2| action potential broadening potassium ... 37 0.86
gi|743110|prf||2011375A K channel 37 0.86
gi|7657289|ref|NP_055194.1| potassium channel, subfamily V, memb... 36 1.1
gi|20381121|gb|AAH28739.1| Potassium channel, subfamily V, membe... 36 1.1
gi|21397876|ref|NP_653861.1| KTN, KTN NAD-binding domain [Bacill... 36 1.1
gi|28460685|ref|NP_080476.1| potassium channel Kv8.1 homolog; ne... 36 1.1
gi|21323543|dbj|BAB98170.1| Kef-type K+ transport systems, predi... 36 1.1
gi|12848914|dbj|BAB28134.1| unnamed protein product [Mus musculus] 36 1.1
gi|11067433|ref|NP_067729.1| potassium channel, subfamily V, mem... 36 1.1
gi|49478984|ref|YP_039385.1| potassium channel protein [Bacillus... 36 1.1
gi|17136454|ref|NP_476713.1| CG3182-PA [Drosophila melanogaster]... 36 1.1
gi|1438971|gb|AAC52727.1| potassium channel Kv8.1 [Mesocricetus ... 36 1.1
gi|23508957|ref|NP_701625.1| hypothetical protein [Plasmodium fa... 36 1.1
gi|19552003|ref|NP_600005.1| predicted NAD-binding component of ... 36 1.1
gi|23126456|ref|ZP_00108350.1| COG1226: Kef-type K+ transport sy... 36 1.1
gi|499659|gb|AAA29794.1| K+ channel protein [Panulirus interruptus] 36 1.1
gi|38091877|ref|XP_112511.2| similar to potassium voltage-gated ... 36 1.1
gi|33357898|pdb|1P7B|A Chain A, Crystal Structure Of An Inward R... 36 1.1
gi|31212889|ref|XP_312206.1| ENSANGP00000002689 [Anopheles gambi... 36 1.1
gi|45526586|ref|ZP_00177790.1| COG1226: Kef-type K+ transport sy... 36 1.5
gi|34396046|gb|AAQ65225.1| K+-channel protein PAK5.1 [Paramecium... 36 1.5
gi|47522858|ref|NP_999183.1| intermediate-conductance calcium-ac... 36 1.5
gi|26345098|dbj|BAC36198.1| unnamed protein product [Mus musculus] 36 1.5
gi|17569273|ref|NP_509795.1| EGg Laying defective EGL-36, SHaW f... 36 1.5
gi|15679517|ref|NP_276634.1| potassium channel related protein [... 36 1.5
gi|50259918|gb|EAL22586.1| hypothetical protein CNBB4630 [Crypto... 36 1.5
gi|2218158|gb|AAB95119.1| voltage-dependent potassium channel al... 36 1.5
gi|11177892|ref|NP_068625.1| potassium channel, subfamily T, mem... 36 1.5
gi|13021998|gb|AAK11604.1| Kv1.10 potassium channel [Xenopus lae... 36 1.5
gi|47209870|emb|CAF90439.1| unnamed protein product [Tetraodon n... 36 1.5
gi|37360374|dbj|BAC98165.1| mKIAA1422 protein [Mus musculus] 36 1.5
gi|50085477|ref|YP_046987.1| putative potassium channel protein ... 36 1.5
gi|39586721|emb|CAE65763.1| Hypothetical protein CBG10852 [Caeno... 36 1.5
gi|13623463|gb|AAH06334.1| KCNH6 protein [Homo sapiens] 35 1.9
gi|32398793|emb|CAD98503.1| conserved hypothetical multi-pass tr... 35 1.9
gi|7511689|pir||T34116 voltage-gated potassium channel klq-1 - C... 35 1.9
gi|4519932|dbj|BAA75810.1| Kv2 channel alpha-subunit [Halocynthi... 35 1.9
gi|25147238|ref|NP_741820.1| potassium channel, KvQLT family (77... 35 1.9
gi|50750517|ref|XP_422030.1| PREDICTED: similar to potassium vol... 35 1.9
gi|16767618|ref|NP_463233.1| putative potassium channels [Salmon... 35 1.9
gi|25147242|ref|NP_741819.1| potassium channel, KvQLT family (82... 35 1.9
gi|46106789|ref|XP_380612.1| hypothetical protein FG00436.1 [Gib... 35 1.9
gi|15643968|ref|NP_229017.1| NADH dehydrogenase, putative [Therm... 35 1.9
gi|47086359|ref|NP_998002.1| potassium voltage-gated channel, su... 35 1.9
gi|34396040|gb|AAQ65222.1| K+-channel protein PAK3.1 [Paramecium... 35 1.9
gi|50731856|ref|XP_418390.1| PREDICTED: similar to potassium cha... 35 1.9
gi|38505613|ref|NP_942234.1| slr5078 [Synechocystis sp. PCC 6803... 35 1.9
gi|1163141|gb|AAC59757.1| potassium channel alpha subunit Kv2.2 ... 35 1.9
gi|47215607|emb|CAG11638.1| unnamed protein product [Tetraodon n... 35 1.9
gi|47199936|emb|CAF89004.1| unnamed protein product [Tetraodon n... 35 1.9
gi|17228574|ref|NP_485122.1| probable potassium channel protein ... 35 1.9
gi|26051273|ref|NP_742054.1| voltage-gated potassium channel, su... 35 2.5
gi|26006813|sp|Q9TSZ3|KCH2_CANFA Potassium voltage-gated channel... 35 2.5
gi|30583511|gb|AAP36000.1| potassium voltage-gated channel, subf... 35 2.5
gi|1245451|gb|AAB02884.1| voltage-dependent potassium channel Sq... 35 2.5
gi|38635441|emb|CAE82156.1| potassium voltage-gated channel, sub... 35 2.5
gi|17225492|gb|AAL37430.1| potassium voltage-gated channel [Sus ... 35 2.5
gi|16758912|ref|NP_446452.1| potassium voltage gated channel, Sh... 35 2.5
gi|17366231|sp|O89109|KCN4_MOUSE Intermediate conductance calciu... 35 2.5
gi|31982238|ref|NP_032459.2| intermediate conductance calcium-ac... 35 2.5
gi|34811832|gb|AAQ82708.1| potassium channel erg1a [Mus musculus] 35 2.5
gi|26006798|sp|O35219|KCH2_MOUSE Potassium voltage-gated channel... 35 2.5
gi|7305203|ref|NP_038597.1| voltage-gated potassium channel, sub... 35 2.5
gi|33239377|ref|NP_573470.1| potassium voltage-gated channel, su... 35 2.5
gi|6981120|ref|NP_037318.1| potassium voltage gated channel, Sha... 35 2.5
gi|24642070|ref|NP_511158.2| CG10952-PA [Drosophila melanogaster... 35 2.5
gi|399253|sp|Q02280|CIKE_DROME Potassium voltage-gated channel p... 35 2.5
gi|9967389|dbj|BAB12398.1| voltage-dependent potassium channel [... 35 2.5
gi|18777774|ref|NP_571987.1| potassium channel erg3 [Rattus norv... 35 2.5
gi|186798|gb|AAA36156.1| voltage-gated potassium channel 35 2.5
gi|30410858|gb|AAH51422.1| Kcnb1 protein [Mus musculus] 35 2.5
gi|4826784|ref|NP_004966.1| potassium voltage-gated channel, Sha... 35 2.5
>gi|25151576|ref|NP_741678.1| potassium channel TWIK-1 (36.4 kD)
(5T541) [Caenorhabditis elegans]
gi|21038842|emb|CAD31817.1| Hypothetical protein Y39B6A.19
[Caenorhabditis elegans]
Length = 319
Score = 620 bits (1599), Expect = e-176
Identities = 309/319 (96%), Positives = 309/319 (96%)
Frame = +1
Query: 1 MGLEMFTMHTKVLNGMEGRMRESNMRILVGLGVAVVYLFVGAIVFVRIEYPLEKIEREAY 180
MGLEMFTMHTKVLNGMEGRMRESNMRILVGLGVAVVYLFVGAIVFVRIEYPLEKIEREAY
Sbjct: 1 MGLEMFTMHTKVLNGMEGRMRESNMRILVGLGVAVVYLFVGAIVFVRIEYPLEKIEREAY 60
Query: 181 LDYQNQWRDRLIQLDIDESEIDKLFLNIREAALNGIWMDRNLTSDPNWTFGQAFFFAGTL 360
LDYQNQWRDRLIQLDIDESEIDKLFLNIREAALNGIWMDRNLTSDPNWTFGQAFFFAGTL
Sbjct: 61 LDYQNQWRDRLIQLDIDESEIDKLFLNIREAALNGIWMDRNLTSDPNWTFGQAFFFAGTL 120
Query: 361 ISTVGYGRVSPRTEYGKLFTILYCVIGIPLTLALLSAIVARMREPSHKLRGLLNQRLGHL 540
ISTVGYGRVSPRTEYGKLFTILYCVIGIPLTLALLSAIVARMREPSHKLRGLLNQRLGHL
Sbjct: 121 ISTVGYGRVSPRTEYGKLFTILYCVIGIPLTLALLSAIVARMREPSHKLRGLLNQRLGHL 180
Query: 541 FTVNHIQLIHVGVVFASLLLFVFAIPAWVFSSIETDWSYLDAFYYCFVSLTTIGLGDFEP 720
FTVNHIQLIHVGVVFASLLLFVFAIPAWVFSSIETDWSYLDAFYYCFVSLTTIGLGDFEP
Sbjct: 181 FTVNHIQLIHVGVVFASLLLFVFAIPAWVFSSIETDWSYLDAFYYCFVSLTTIGLGDFEP 240
Query: 721 GDDPNQSFRGLYKIGATVYXXXXXXXXXXFLATLYDIPQFNLTSFFVKSDEEMRFSEEDG 900
GDDPNQSFRGLYKIGATVY FLATLYDIPQFNLTSFFVKSDEEMRFSEEDG
Sbjct: 241 GDDPNQSFRGLYKIGATVYLMGGLCCMMLFLATLYDIPQFNLTSFFVKSDEEMRFSEEDG 300
Query: 901 KYGTLDSNVVENGFYSADH 957
KYGTLDSNVVENGFYSADH
Sbjct: 301 KYGTLDSNVVENGFYSADH 319