Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y39B6A_45
         (390 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|25146411|ref|NP_741696.1| HesB protein (5T664) [Caenorhabditi...   256   7e-68
gi|39580452|emb|CAE73141.1| Hypothetical protein CBG20529 [Caeno...   240   5e-63
gi|24642263|ref|NP_573062.1| CG8198-PA [Drosophila melanogaster]...   164   3e-40
gi|47226595|emb|CAG08611.1| unnamed protein product [Tetraodon n...   157   4e-38
gi|41147094|ref|XP_371741.1| similar to hypothetical protein [Ho...   156   8e-38
gi|31206473|ref|XP_312196.1| ENSANGP00000002682 [Anopheles gambi...   155   1e-37
gi|21740005|emb|CAD39021.1| hypothetical protein [Homo sapiens]       155   2e-37
gi|12803679|gb|AAH02675.1| HESB like domain containing 2 [Homo s...   155   2e-37
gi|13569911|ref|NP_112202.1| HESB like domain containing 2 [Homo...   155   2e-37
gi|31745170|ref|NP_853657.1| HesB protein [Rattus norvegicus] >g...   154   3e-37
gi|38074374|ref|XP_356650.1| similar to RIKEN cDNA 1810010A06 [M...   154   5e-37
gi|21312189|ref|NP_081197.1| HESB like domain containing 2 [Mus ...   154   5e-37
gi|47226594|emb|CAG08610.1| unnamed protein product [Tetraodon n...   146   8e-35
gi|50762378|ref|XP_425036.1| PREDICTED: similar to the gene is e...   143   9e-34
gi|41151137|ref|XP_371153.1| similar to hypothetical protein [Ho...   140   4e-33
gi|50406224|ref|XP_456615.1| unnamed protein product [Debaryomyc...   133   7e-31
gi|46440887|gb|EAL00188.1| hypothetical protein CaO19.5521 [Cand...   132   1e-30
gi|45201063|ref|NP_986633.1| AGL033Cp [Eremothecium gossypii] >g...   130   5e-30
gi|6323001|ref|NP_013073.1| Mitochondrial matrix protein involve...   130   6e-30
gi|50311733|ref|XP_455894.1| unnamed protein product [Kluyveromy...   130   8e-30
gi|46138745|ref|XP_391063.1| hypothetical protein FG10887.1 [Gib...   129   2e-29
gi|50553450|ref|XP_504136.1| hypothetical protein [Yarrowia lipo...   128   2e-29
gi|29841436|gb|AAP06468.1| similar to CG8198 gene product in Dro...   128   3e-29
gi|21592728|gb|AAM64677.1| putative HesB-like protein [Arabidops...   127   5e-29
gi|15227287|ref|NP_179262.1| hesB-like domain-containing protein...   127   5e-29
gi|11359495|pir||T51222 hypothetical protein B24M22.180 [importe...   126   1e-28
gi|50288207|ref|XP_446532.1| unnamed protein product [Candida gl...   124   3e-28
gi|46202563|ref|ZP_00052993.2| COG0316: Uncharacterized conserve...   124   4e-28
gi|16798390|gb|AAL29443.1| iron-sulfur cluster assembly protein ...   123   7e-28
gi|15227614|ref|NP_181168.1| iron-sulfur cluster assembly comple...   113   1e-24
gi|42520721|ref|NP_966636.1| HesB/YadR/YfhF family protein [Wolb...   112   1e-24
gi|50286831|ref|XP_445845.1| unnamed protein product [Candida gl...   112   2e-24
gi|21805702|gb|AAM76757.1| hypothetical protein [Arabidopsis tha...   112   2e-24
gi|50257782|gb|EAL20483.1| hypothetical protein CNBE4040 [Crypto...   111   3e-24
gi|34581605|ref|ZP_00143085.1| hesB protein [Rickettsia sibirica...   108   2e-23
gi|48765627|ref|ZP_00270177.1| COG0316: Uncharacterized conserve...   108   3e-23
gi|32420761|ref|XP_330824.1| hypothetical protein [Neurospora cr...   107   5e-23
gi|15892651|ref|NP_360365.1| hesB protein [Rickettsia conorii st...   107   5e-23
gi|49088612|ref|XP_406111.1| hypothetical protein AN1974.2 [Aspe...   107   7e-23
gi|15604345|ref|NP_220861.1| HESB PROTEIN (hesB2) [Rickettsia pr...   104   4e-22
gi|19075612|ref|NP_588112.1| hypothetical protein; possible invo...   104   4e-22
gi|50084579|ref|YP_046089.1| iron-binding protein , putative reg...   102   2e-21
gi|22958646|ref|ZP_00006313.1| COG0316: Uncharacterized conserve...   102   2e-21
gi|39935536|ref|NP_947812.1| Protein of unknown function, HesB/Y...   100   5e-21
gi|23501823|ref|NP_697950.1| HesB/YadR/YfhF family protein [Bruc...    99   1e-20
gi|17987317|ref|NP_539951.1| HESB PROTEIN [Brucella melitensis 1...    99   1e-20
gi|23466613|ref|ZP_00122201.1| COG0316: Uncharacterized conserve...    99   3e-20
gi|32029430|ref|ZP_00132453.1| COG0316: Uncharacterized conserve...    99   3e-20
gi|37678941|ref|NP_933550.1| uncharacterized conserved protein [...    98   4e-20
gi|46308362|ref|ZP_00210555.1| COG0316: Uncharacterized conserve...    97   6e-20
gi|45914567|ref|ZP_00193009.2| COG0316: Uncharacterized conserve...    97   6e-20
gi|23105218|ref|ZP_00091676.1| COG0316: Uncharacterized conserve...    97   7e-20
gi|27363904|ref|NP_759432.1| HesB family protein [Vibrio vulnifi...    97   7e-20
gi|33152208|ref|NP_873561.1| hesB family protein [Haemophilus du...    97   1e-19
gi|16126101|ref|NP_420665.1| HesB/YadR/YfhF family protein [Caul...    96   2e-19
gi|32034039|ref|ZP_00134283.1| COG0316: Uncharacterized conserve...    96   2e-19
gi|26987580|ref|NP_743005.1| iron-binding protein IscA [Pseudomo...    96   2e-19
gi|13470348|ref|NP_101914.1| HesB-like protein [Mesorhizobium lo...    96   2e-19
gi|28897372|ref|NP_796977.1| HesB family protein [Vibrio parahae...    95   3e-19
gi|24373819|ref|NP_717862.1| HesB/YadR/YfhF family protein [Shew...    95   3e-19
gi|46912373|emb|CAG19165.1| Putative hesB family protein [Photob...    95   3e-19
gi|42630673|ref|ZP_00156212.1| COG0316: Uncharacterized conserve...    95   4e-19
gi|15640769|ref|NP_230399.1| hesB family protein [Vibrio cholera...    95   4e-19
gi|30249422|ref|NP_841492.1| Hypothetical hesB/yadR/yfhF family ...    94   5e-19
gi|48787814|ref|ZP_00283793.1| COG0316: Uncharacterized conserve...    94   5e-19
gi|46321394|ref|ZP_00221771.1| COG0316: Uncharacterized conserve...    94   5e-19
gi|15602185|ref|NP_245257.1| unknown [Pasteurella multocida Pm70...    94   5e-19
gi|17545740|ref|NP_519142.1| CONSERVED HYPOTHETICAL PROTEIN [Ral...    94   6e-19
gi|16272324|ref|NP_438537.1| hypothetical protein HI0376 [Haemop...    94   6e-19
gi|15889122|ref|NP_354803.1| AGR_C_3339p [Agrobacterium tumefaci...    94   6e-19
gi|33592863|ref|NP_880507.1| [Fe-S] cluster formation/repair pro...    94   8e-19
gi|23470406|ref|ZP_00125739.1| COG0316: Uncharacterized conserve...    94   8e-19
gi|15965483|ref|NP_385836.1| CONSERVED HYPOTHETICAL PROTEIN [Sin...    93   1e-18
gi|50122157|ref|YP_051324.1| conserved hypothetical protein [Erw...    93   1e-18
gi|46312137|ref|ZP_00212736.1| COG0316: Uncharacterized conserve...    93   1e-18
gi|28868632|ref|NP_791251.1| iron-binding protein IscA [Pseudomo...    92   2e-18
gi|15677244|ref|NP_274397.1| HesB/YadR/YfhF family protein [Neis...    92   2e-18
gi|49080304|gb|AAT50002.1| PA3812 [synthetic construct]                91   7e-18
gi|48850230|ref|ZP_00304472.1| COG0316: Uncharacterized conserve...    91   7e-18
gi|16761455|ref|NP_457072.1| conserved hypothetical protein [Sal...    91   7e-18
gi|49258913|pdb|1S98|A Chain A, E.Coli Isca Crystal Structure To...    91   7e-18
gi|15599007|ref|NP_252501.1| probable iron-binding protein IscA ...    91   7e-18
gi|23345069|gb|AAN17747.1| IscA [Xenorhabdus nematophila]              90   9e-18
gi|24113857|ref|NP_708367.1| putative regulator [Shigella flexne...    90   1e-17
gi|40889628|pdb|1R94|A Chain A, Crystal Structure Of Isca (Mercu...    90   1e-17
gi|15803055|ref|NP_289085.1| putative regulator [Escherichia col...    90   1e-17
gi|37527161|ref|NP_930505.1| hypothetical protein [Photorhabdus ...    90   1e-17
gi|45519367|ref|ZP_00170918.1| COG0316: Uncharacterized conserve...    89   2e-17
gi|45548288|ref|ZP_00188322.1| COG0316: Uncharacterized conserve...    89   3e-17
gi|15794490|ref|NP_284312.1| HesB-like protein [Neisseria mening...    88   3e-17
gi|41725506|ref|ZP_00152264.1| COG0316: Uncharacterized conserve...    88   4e-17
gi|50120789|ref|YP_049956.1| conserved hypothetical protein [Erw...    87   6e-17
gi|34496547|ref|NP_900762.1| probable HesB-like protein [Chromob...    87   6e-17
gi|48770778|ref|ZP_00275121.1| COG0316: Uncharacterized conserve...    87   8e-17
gi|16123085|ref|NP_406398.1| conserved hypothetical protein [Yer...    87   8e-17
gi|41690734|ref|ZP_00147266.1| COG0316: Uncharacterized conserve...    87   8e-17
gi|37544076|ref|XP_064257.5| similar to HESB like domain contain...    87   1e-16
gi|15837007|ref|NP_297695.1| conserved hypothetical protein [Xyl...    87   1e-16
gi|48830913|ref|ZP_00288007.1| COG0316: Uncharacterized conserve...    86   1e-16
gi|22995525|ref|ZP_00040001.1| COG0316: Uncharacterized conserve...    86   1e-16
gi|47575135|ref|ZP_00245170.1| COG0316: Uncharacterized conserve...    86   1e-16
gi|33860676|ref|NP_892237.1| conserved hypothetical protein [Pro...    86   2e-16
gi|45521598|ref|ZP_00173116.1| COG0316: Uncharacterized conserve...    86   2e-16
gi|21229963|ref|NP_635880.1| conserved hypothetical protein [Xan...    85   3e-16
gi|48730224|ref|ZP_00263972.1| COG0316: Uncharacterized conserve...    85   4e-16
gi|45512484|ref|ZP_00164050.1| COG0316: Uncharacterized conserve...    84   6e-16
gi|42629834|ref|ZP_00155379.1| COG0316: Uncharacterized conserve...    84   6e-16
gi|48786030|ref|ZP_00282239.1| COG0316: Uncharacterized conserve...    84   6e-16
gi|16122626|ref|NP_405939.1| conserved hypothetical protein [Yer...    82   2e-15
gi|23010339|ref|ZP_00051062.1| COG0316: Uncharacterized conserve...    82   2e-15
gi|21241270|ref|NP_640852.1| conserved hypothetical protein [Xan...    82   2e-15
gi|22125826|ref|NP_669249.1| hypothetical protein y1934 [Yersini...    82   2e-15
gi|15802096|ref|NP_288118.1| orf, hypothetical protein [Escheric...    82   3e-15
gi|16129640|ref|NP_416199.1| orf, hypothetical protein; conserve...    82   3e-15
gi|26247934|ref|NP_753974.1| SufA protein [Escherichia coli CFT0...    82   3e-15
gi|49474146|ref|YP_032188.1| hypothetical protein BQ05250 [Barto...    81   4e-15
gi|49475511|ref|YP_033552.1| hypothetical protein BH07400 [Barto...    81   5e-15
gi|1170246|sp|P46053|HESB_PLEBO Protein hesB >gnl|BL_ORD_ID|1699...    81   5e-15
gi|48833361|ref|ZP_00290381.1| COG0316: Uncharacterized conserve...    80   9e-15
gi|24113073|ref|NP_707583.1| orf, conserved hypothetical protein...    80   9e-15
gi|11465683|ref|NP_053827.1| ORF114 [Porphyra purpurea] >gnl|BL_...    80   1e-14
gi|33866746|ref|NP_898305.1| conserved hypothetical protein [Syn...    79   2e-14
gi|14424103|sp|Q9XIK3|Y105_ARATH Hypothetical protein At1g10500 ...    79   2e-14
gi|45681608|ref|ZP_00193047.1| COG0316: Uncharacterized conserve...    79   2e-14
gi|16760538|ref|NP_456155.1| conserved hypothetical protein [Sal...    79   2e-14
gi|15218553|ref|NP_172520.1| hesB-like domain-containing protein...    79   2e-14
gi|20804091|emb|CAD31294.1| HYPOTHETICAL CONSERVED PROTEIN [Meso...    79   3e-14
gi|31615730|pdb|1NWB|A Chain A, Solution Structure Of The Hypoth...    79   3e-14
gi|15606896|ref|NP_214277.1| hypothetical protein aq_1857 [Aquif...    79   3e-14
gi|15676462|ref|NP_273601.1| conserved hypothetical protein [Nei...    78   4e-14
gi|27379870|ref|NP_771399.1| blr4759 [Bradyrhizobium japonicum U...    78   5e-14
gi|33864234|ref|NP_895794.1| conserved hypothetical protein [Pro...    78   5e-14
gi|17229877|ref|NP_486425.1| hypothetical protein [Nostoc sp. PC...    77   6e-14
gi|13474947|ref|NP_106517.1| hypothetical protein mll5942 [Mesor...    77   6e-14
gi|16126252|ref|NP_420816.1| HesB/YadR/YfhF family protein [Caul...    77   6e-14
gi|16764719|ref|NP_460334.1| hypothetical protein STM1369 [Salmo...    77   8e-14
gi|37526513|ref|NP_929857.1| SufA protein [Photorhabdus luminesc...    77   8e-14
gi|2183309|gb|AAC35199.1| HesB [Cyanothece sp. PCC 8801]               77   1e-13
gi|48764207|ref|ZP_00268759.1| COG0316: Uncharacterized conserve...    77   1e-13
gi|23472798|ref|ZP_00128120.1| COG0316: Uncharacterized conserve...    77   1e-13
gi|48728578|ref|ZP_00262334.1| COG0316: Uncharacterized conserve...    76   1e-13
gi|15965274|ref|NP_385627.1| CONSERVED HYPOTHETICAL PROTEIN [Sin...    75   2e-13
gi|23130099|ref|ZP_00111918.1| COG0316: Uncharacterized conserve...    75   2e-13
gi|17545213|ref|NP_518615.1| CONSERVED HYPOTHETICAL PROTEIN [Ral...    75   2e-13
gi|21242369|ref|NP_641951.1| conserved hypothetical protein [Xan...    75   2e-13
gi|4325122|gb|AAD17270.1| NifV [Frankia sp. EuIK1]                     75   3e-13
gi|45509112|ref|ZP_00161447.1| COG0316: Uncharacterized conserve...    75   3e-13
gi|23105985|ref|ZP_00092439.1| COG0316: Uncharacterized conserve...    75   3e-13
gi|33519818|ref|NP_878650.1| putative HesB-like domain [Candidat...    75   4e-13
gi|11342545|emb|CAC17124.1| SufA protein [Erwinia chrysanthemi]        75   4e-13
gi|33593893|ref|NP_881537.1| conserved hypothetical protein [Bor...    75   4e-13
gi|21231016|ref|NP_636933.1| conserved hypothetical protein [Xan...    75   4e-13
gi|48893654|ref|ZP_00326852.1| COG0316: Uncharacterized conserve...    74   5e-13
gi|15595862|ref|NP_249356.1| conserved hypothetical protein [Pse...    74   5e-13
gi|13471190|ref|NP_102759.1| hypothetical protein mlr1094 [Mesor...    74   7e-13
gi|16329338|ref|NP_440066.1| hypothetical protein [Synechocystis...    74   9e-13
gi|26987174|ref|NP_742599.1| HesB/YadR/YfhF family protein [Pseu...    74   9e-13
gi|46323962|ref|ZP_00224324.1| COG0316: Uncharacterized conserve...    74   9e-13
gi|45520878|ref|ZP_00172403.1| COG0316: Uncharacterized conserve...    74   9e-13
gi|15889020|ref|NP_354701.1| AGR_C_3148p [Agrobacterium tumefaci...    74   9e-13
gi|48856931|ref|ZP_00311088.1| COG0316: Uncharacterized conserve...    73   1e-12
gi|11612207|gb|AAG37300.1| HesB [Sinorhizobium fredii]                 73   1e-12
gi|46119644|ref|ZP_00177007.2| COG0316: Uncharacterized conserve...    73   1e-12
gi|34499149|ref|NP_903364.1| conserved hypothetical protein [Chr...    73   1e-12
gi|48767960|ref|ZP_00272312.1| COG0316: Uncharacterized conserve...    73   1e-12
gi|24111594|ref|NP_706104.1| orf, conserved hypothetical protein...    73   1e-12
gi|26246102|ref|NP_752141.1| Hypothetical protein yadR [Escheric...    73   1e-12
gi|27376866|ref|NP_768395.1| blr1755 [Bradyrhizobium japonicum U...    73   1e-12
gi|37523951|ref|NP_927328.1| hypothetical protein gll4382 [Gloeo...    73   1e-12
gi|39546289|ref|NP_459209.2| hypothetical protein STM0204.S [Sal...    73   1e-12
gi|15799840|ref|NP_285852.1| orf, hypothetical protein [Escheric...    73   1e-12
gi|16759195|ref|NP_454812.1| conserved hypothetical protein [Sal...    73   1e-12
gi|22124714|ref|NP_668137.1| hypothetical protein y0801 [Yersini...    72   2e-12
gi|24372882|ref|NP_716924.1| HesB/YadR/YfhF family protein [Shew...    72   2e-12
gi|16519984|ref|NP_444104.1| Y4vC [Rhizobium sp. NGR234] >gnl|BL...    72   2e-12
gi|16123536|ref|NP_406849.1| conserved hypothetical protein [Yer...    72   2e-12
gi|39935921|ref|NP_948197.1| Protein of unknown function, HesB/Y...    72   2e-12
gi|23466715|ref|ZP_00122302.1| COG0316: Uncharacterized conserve...    72   3e-12
gi|32029699|ref|ZP_00132682.1| COG0316: Uncharacterized conserve...    72   3e-12
gi|77958|pir||S04873 hypothetical protein 118 (nifS 5' region) -...    72   3e-12
gi|45520124|ref|ZP_00171675.1| COG0316: Uncharacterized conserve...    72   3e-12
gi|37524896|ref|NP_928240.1| hypothetical protein [Photorhabdus ...    71   4e-12
gi|48785105|ref|ZP_00281410.1| COG0316: Uncharacterized conserve...    71   4e-12
gi|49074414|gb|AAT49402.1| PA0665 [synthetic construct]                71   4e-12
gi|2495213|sp|Q47887|YNIU_FRAAL HYPOTHETICAL 14.1 KD PROTEIN IN ...    71   4e-12
gi|17987374|ref|NP_540008.1| HESB PROTEIN [Brucella melitensis 1...    71   6e-12
gi|29251525|gb|EAA43006.1| GLP_170_159275_159670 [Giardia lambli...    71   6e-12
gi|37521674|ref|NP_925051.1| hypothetical protein gvip289 [Gloeo...    71   6e-12
gi|15602323|ref|NP_245395.1| unknown [Pasteurella multocida Pm70...    71   6e-12
gi|50122228|ref|YP_051395.1| conserved hypothetical protein [Erw...    70   7e-12
gi|37680911|ref|NP_935520.1| HesB family protein [Vibrio vulnifi...    70   7e-12
gi|22298410|ref|NP_681657.1| ORF_ID:tll0867~hypothetical protein...    70   7e-12
gi|30249399|ref|NP_841469.1| Hypothetical hesB/yadR/yfhF family ...    70   7e-12
gi|16080269|ref|NP_391096.1| yutM [Bacillus subtilis subsp. subt...    70   7e-12
gi|42629070|ref|ZP_00154620.1| COG0316: Uncharacterized conserve...    70   7e-12
gi|16273609|ref|NP_439864.1| unknown protein [Haemophilus influe...    70   7e-12
gi|21672405|ref|NP_660472.1| hypothetical 13.3 kDa protein [Buch...    70   7e-12
gi|22960157|ref|ZP_00007799.1| COG0316: Uncharacterized conserve...    70   1e-11
gi|50083307|ref|YP_044817.1| conserved hypothetical protein [Aci...    70   1e-11
gi|49234802|gb|AAT57939.1| hesB-like domain-containing protein [...    70   1e-11
gi|48861191|ref|ZP_00315095.1| COG0316: Uncharacterized conserve...    70   1e-11
gi|49474354|ref|YP_032396.1| hypothetical protein BQ07680 [Barto...    70   1e-11
gi|15839151|ref|NP_299839.1| conserved hypothetical protein [Xyl...    70   1e-11
gi|46321136|ref|ZP_00221516.1| COG0316: Uncharacterized conserve...    70   1e-11
gi|17228926|ref|NP_485474.1| HesB protein [Nostoc sp. PCC 7120] ...    70   1e-11
gi|28899248|ref|NP_798853.1| HesB family protein [Vibrio parahae...    70   1e-11
gi|47572999|ref|ZP_00243039.1| COG0316: Uncharacterized conserve...    70   1e-11
gi|46316075|ref|ZP_00216655.1| COG0316: Uncharacterized conserve...    70   1e-11
gi|27904694|ref|NP_777820.1| HesB/YadR/YfhF family protein [Buch...    69   2e-11
gi|16805307|ref|NP_473335.1| HesB-like domain protein; HesB-like...    69   2e-11
gi|46201883|ref|ZP_00054147.2| COG0316: Uncharacterized conserve...    69   2e-11
gi|33239589|ref|NP_874531.1| Uncharacterized HesB family conserv...    69   2e-11
gi|42522729|ref|NP_968109.1| Scaffold protein for iron-sulfur cl...    69   2e-11
gi|34894088|ref|NP_908369.1| P0005A05.9 [Oryza sativa (japonica ...    69   2e-11
gi|48833499|ref|ZP_00290518.1| COG0316: Uncharacterized conserve...    69   2e-11
gi|97701|pir||S11901 hypothetical protein 2 - Anabaena sp >gnl|B...    69   3e-11
gi|15640647|ref|NP_230276.1| hesB family protein [Vibrio cholera...    69   3e-11
gi|41690369|ref|ZP_00146901.1| COG0316: Uncharacterized conserve...    69   3e-11
gi|45508648|ref|ZP_00160985.1| COG0316: Uncharacterized conserve...    68   4e-11
gi|21492743|ref|NP_659818.1| probable HesB protein. [Rhizobium e...    68   4e-11
gi|46446719|ref|YP_008084.1| conserved hypothetical protein [Par...    68   5e-11
gi|14424404|sp|Q9MSA1|YC83_GALSU Hypothetical 12.5 kDa protein y...    68   5e-11
gi|33151861|ref|NP_873214.1| conserved hypothetical protein [Hae...    67   6e-11
gi|1170198|sp|P46052|HEB2_ANAVA Protein hesB, vegetative >gnl|BL...    67   8e-11
gi|32043857|ref|ZP_00141119.1| COG0316: Uncharacterized conserve...    67   8e-11
gi|15616830|ref|NP_240042.1| hypothetical protein BU211 [Buchner...    67   1e-10
gi|32473209|ref|NP_866203.1| conserved hypothetical protein-puta...    67   1e-10
gi|46191933|ref|ZP_00007633.2| COG0316: Uncharacterized conserve...    66   1e-10
gi|46323961|ref|ZP_00224323.1| COG0316: Uncharacterized conserve...    66   2e-10
gi|21220638|ref|NP_626417.1| conserved hypothetical protein [Str...    65   2e-10
gi|29655163|ref|NP_820855.1| HesB/YadR/YfhF family protein [Coxi...    65   3e-10
gi|32034486|ref|ZP_00134658.1| COG0316: Uncharacterized conserve...    65   3e-10
gi|48786031|ref|ZP_00282240.1| COG0316: Uncharacterized conserve...    65   3e-10
gi|49475741|ref|YP_033782.1| hypothetical protein BH09960 [Barto...    65   3e-10
gi|48893832|ref|ZP_00327030.1| COG0316: Uncharacterized conserve...    65   3e-10
gi|48836765|ref|ZP_00293761.1| COG0316: Uncharacterized conserve...    65   3e-10
gi|23104287|ref|ZP_00090753.1| COG0316: Uncharacterized conserve...    65   4e-10
gi|39937668|ref|NP_949944.1| Protein of unknown function, HesB/Y...    65   4e-10
gi|32491110|ref|NP_871364.1| ydiC [Wigglesworthia glossinidia en...    65   4e-10
gi|2495212|sp|Q44540|YNIU_AZOVI HYPOTHETICAL 11.0 KD PROTEIN IN ...    65   4e-10
gi|46112957|ref|ZP_00182091.2| COG0316: Uncharacterized conserve...    65   4e-10
gi|46912159|emb|CAG18954.1| putative HesB family protein [Photob...    64   5e-10
gi|48763179|ref|ZP_00267735.1| COG0316: Uncharacterized conserve...    64   7e-10
gi|15615972|ref|NP_244277.1| BH3410~unknown conserved protein [B...    64   9e-10
gi|48894974|ref|ZP_00328083.1| COG0316: Uncharacterized conserve...    64   9e-10
gi|15892016|ref|NP_359730.1| hesB protein [Rickettsia conorii st...    64   9e-10
gi|15616742|ref|NP_239954.1| hypothetical protein BU122 [Buchner...    63   1e-09
gi|27365040|ref|NP_760568.1| HesB family protein [Vibrio vulnifi...    63   1e-09
gi|21672491|ref|NP_660558.1| hypothetical 12.1 kDa protein [Buch...    63   1e-09
gi|34580948|ref|ZP_00142428.1| hesB protein [Rickettsia sibirica...    63   1e-09
gi|46199574|ref|YP_005241.1| hesB protein [Thermus thermophilus ...    63   2e-09
gi|29832584|ref|NP_827218.1| hypothetical protein SAV6042 [Strep...    63   2e-09
gi|29654652|ref|NP_820344.1| HesB/YadR/YfhF family protein [Coxi...    63   2e-09
gi|25028645|ref|NP_738699.1| conserved hypothetical protein [Cor...    62   2e-09
gi|22970665|ref|ZP_00017714.1| hypothetical protein [Chloroflexu...    62   2e-09
gi|2738590|gb|AAC46070.1| ORF113 [Buchnera aphidicola]                 62   3e-09
gi|15603942|ref|NP_220457.1| HESB PROTEIN (hesB1) [Rickettsia pr...    62   3e-09
gi|19553399|ref|NP_601401.1| hypothetical protein NCgl2117 [Cory...    61   4e-09
gi|48850276|ref|ZP_00304518.1| COG0316: Uncharacterized conserve...    61   6e-09
gi|49078724|ref|XP_403086.1| hypothetical protein UM05471.1 [Ust...    60   8e-09
gi|28493209|ref|NP_787370.1| unknown [Tropheryma whipplei str. T...    60   8e-09
gi|27379455|ref|NP_770984.1| blr4344 [Bradyrhizobium japonicum U...    60   1e-08
gi|11034775|gb|AAG27072.1| unknown [Gluconacetobacter diazotroph...    60   1e-08
gi|33519629|ref|NP_878461.1| conserved hypothetical protein [Can...    60   1e-08
gi|15805466|ref|NP_294162.1| HesB/YadR/YfhF family protein [Dein...    60   1e-08
gi|46365649|ref|ZP_00228104.1| COG0316: Uncharacterized conserve...    60   1e-08
gi|41724014|ref|ZP_00150904.1| COG0316: Uncharacterized conserve...    60   1e-08
gi|27467552|ref|NP_764189.1| conserved hypothetical protein [Sta...    59   2e-08
gi|15609341|ref|NP_216720.1| hypothetical protein Rv2204c [Mycob...    59   2e-08
gi|23485741|gb|EAA20551.1| HesB-like domain protein-related [Pla...    59   2e-08
gi|28572677|ref|NP_789457.1| conserved hypothetical protein [Tro...    59   2e-08
gi|49068320|ref|XP_398449.1| hypothetical protein UM00834.1 [Ust...    59   3e-08
gi|23613249|ref|NP_703571.1| hypothetical protein, conserved [Pl...    59   3e-08
gi|38234206|ref|NP_939973.1| Conserved hypothetical protein [Cor...    59   3e-08
gi|21282551|ref|NP_645639.1| conserved hypothetical protein [Sta...    58   4e-08
gi|23130534|ref|ZP_00112347.1| COG0316: Uncharacterized conserve...    58   5e-08
gi|47230196|emb|CAG10610.1| unnamed protein product [Tetraodon n...    58   5e-08
gi|32490823|ref|NP_871077.1| yadR [Wigglesworthia glossinidia en...    58   5e-08
gi|23125137|ref|ZP_00107084.1| COG0316: Uncharacterized conserve...    57   6e-08
gi|47566971|ref|ZP_00237688.1| HESB protein [Bacillus cereus G92...    57   6e-08
gi|49187795|ref|YP_031048.1| hesB/yadR/yfhF family protein [Baci...    57   6e-08
gi|21397417|ref|NP_653402.1| HesB-like, HesB-like domain [Bacill...    57   6e-08
gi|48862817|ref|ZP_00316712.1| COG0316: Uncharacterized conserve...    57   6e-08
gi|16804963|ref|NP_472992.1| hypothetical protein, conserved [Pl...    57   8e-08
gi|42784119|ref|NP_981366.1| hesB/yadR/yfhF family protein [Baci...    57   8e-08
gi|15923930|ref|NP_371464.1| conserved hypothetical protein [Sta...    57   1e-07
gi|41408042|ref|NP_960878.1| hypothetical protein MAP1944c [Myco...    57   1e-07
gi|15827394|ref|NP_301657.1| conserved hypothetical protein [Myc...    57   1e-07
gi|48840775|ref|ZP_00297701.1| COG0316: Uncharacterized conserve...    57   1e-07
gi|1730750|sp|Q07184|YNIU_RHOCA Hypothetical 11.0 kDa protein in...    57   1e-07
gi|23099808|ref|NP_693274.1| hypothetical protein OB2353 [Oceano...    56   1e-07
gi|21228118|ref|NP_634040.1| HesB protein [Methanosarcina mazei ...    56   1e-07
gi|31235355|ref|XP_319229.1| ENSANGP00000019241 [Anopheles gambi...    56   1e-07
gi|50842188|ref|YP_055415.1| HesB protein, putative for nitrogen...    56   1e-07
gi|46308405|ref|ZP_00210598.1| COG0316: Uncharacterized conserve...    56   2e-07
gi|45508541|ref|ZP_00160879.1| COG0316: Uncharacterized conserve...    56   2e-07
gi|20089782|ref|NP_615857.1| HesB family protein [Methanosarcina...    55   3e-07
gi|2495211|sp|Q43895|YNIU_AZOBR HYPOTHETICAL 12.5 KD PROTEIN IN ...    55   4e-07
gi|23014568|ref|ZP_00054377.1| COG0316: Uncharacterized conserve...    55   4e-07
gi|45506119|ref|ZP_00158479.1| COG0316: Uncharacterized conserve...    55   4e-07
gi|17231833|ref|NP_488381.1| hypothetical protein [Nostoc sp. PC...    54   5e-07
gi|16332164|ref|NP_442892.1| hypothetical protein [Synechocystis...    54   7e-07
gi|23489093|gb|EAA21482.1| member hesB family [Plasmodium yoelii...    54   7e-07
gi|18414394|ref|NP_568130.1| hesB-like domain-containing protein...    54   9e-07
gi|21592451|gb|AAM64402.1| unknown [Arabidopsis thaliana]              54   9e-07
gi|11357865|pir||T48417 hypothetical protein F8F6.110 - Arabidop...    54   9e-07
gi|22298007|ref|NP_681254.1| ORF_ID:tll0464~hypothetical protein...    53   1e-06
gi|45526830|ref|ZP_00178032.1| COG0316: Uncharacterized conserve...    53   1e-06
gi|50554607|ref|XP_504712.1| hypothetical protein [Yarrowia lipo...    53   1e-06
gi|46441622|gb|EAL00918.1| hypothetical protein CaO19.14103 [Can...    52   4e-06
gi|48103587|ref|XP_395606.1| similar to CG13623-PA [Apis mellifera]    52   4e-06
gi|45526824|ref|ZP_00178026.1| COG0316: Uncharacterized conserve...    51   6e-06
gi|48856183|ref|ZP_00310341.1| COG0316: Uncharacterized conserve...    50   8e-06
gi|46111323|ref|XP_382719.1| hypothetical protein FG02543.1 [Gib...    50   1e-05
gi|28207853|emb|CAD62580.1| unnamed protein product [Homo sapiens]     49   3e-05
gi|34996487|ref|NP_919255.1| HESB like domain containing 1 [Homo...    49   3e-05
gi|12833285|dbj|BAB22467.1| unnamed protein product [Mus musculus]     48   4e-05
gi|25023734|ref|XP_203592.1| RIKEN cDNA 0710001C05 [Mus musculus]      48   4e-05
gi|34878307|ref|XP_344253.1| similar to CG13623-PA [Rattus norve...    47   7e-05
gi|16041781|gb|AAH15771.1| Similar to RIKEN cDNA 0710001C05 gene...    47   7e-05
gi|6325324|ref|NP_015392.1| Protein required for maturation of m...    47   7e-05
gi|41718430|ref|ZP_00147437.1| COG0316: Uncharacterized conserve...    47   7e-05
gi|7510208|pir||T27173 hypothetical protein Y54G11A.9 - Caenorha...    47   9e-05
gi|27904619|ref|NP_777745.1| conserved hypothetical protein [Buc...    47   9e-05
gi|34556120|emb|CAA22453.3| Hypothetical protein Y54G11A.9 [Caen...    47   9e-05
gi|50260684|gb|EAL23337.1| hypothetical protein CNBA4530 [Crypto...    46   2e-04
gi|50286103|ref|XP_445480.1| unnamed protein product [Candida gl...    45   4e-04
gi|23105397|ref|ZP_00091853.1| COG0316: Uncharacterized conserve...    44   6e-04
gi|27364312|ref|NP_759840.1| Thioredoxin-like protein [Vibrio vu...    44   7e-04
gi|37678411|ref|NP_933020.1| thioredoxin-like protein [Vibrio vu...    44   7e-04
gi|24649697|ref|NP_651267.1| CG13623-PA [Drosophila melanogaster...    44   0.001
gi|50423979|ref|XP_460574.1| unnamed protein product [Debaryomyc...    43   0.002
gi|28896920|ref|NP_796525.1| conserved hypothetical protein [Vib...    43   0.002
gi|42453252|ref|ZP_00153159.1| hypothetical protein Rick009001 [...    42   0.002
gi|45187539|ref|NP_983762.1| ADL334Cp [Eremothecium gossypii] >g...    42   0.003
gi|38106207|gb|EAA52544.1| hypothetical protein MG05236.4 [Magna...    42   0.004
gi|15642714|ref|NP_232347.1| conserved hypothetical protein [Vib...    41   0.005
gi|38637225|dbj|BAD03491.1| hypothetical protein [Oryza sativa (...    41   0.005
gi|42520553|ref|NP_966468.1| HesB/YadR/YfhF family protein [Wolb...    41   0.005
gi|46911818|emb|CAG18616.1| conserved hypothetical protein [Phot...    41   0.006
gi|16120470|ref|NP_403783.1| conserved hypothetical protein [Yer...    41   0.006
gi|17537563|ref|NP_496981.1| HesB YadR YfhF family protein like ...    40   0.008
gi|32034535|ref|ZP_00134699.1| COG0316: Uncharacterized conserve...    40   0.011
gi|15805092|ref|NP_293777.1| HesB/YadR/YfhF family protein [Dein...    40   0.011
gi|46323956|ref|ZP_00224318.1| COG0316: Uncharacterized conserve...    40   0.014
gi|50304005|ref|XP_451952.1| unnamed protein product [Kluyveromy...    39   0.018
gi|39582722|emb|CAE65928.1| Hypothetical protein CBG11101 [Caeno...    39   0.018
gi|48863131|ref|ZP_00317025.1| COG0316: Uncharacterized conserve...    39   0.024
gi|33151606|ref|NP_872959.1| transformation locus protein OrfG h...    39   0.024
gi|23467378|ref|ZP_00122960.1| COG0694: Thioredoxin-like protein...    39   0.024
gi|28869922|ref|NP_792541.1| yhgI protein [Pseudomonas syringae ...    39   0.031
gi|23472266|ref|ZP_00127593.1| COG0316: Uncharacterized conserve...    39   0.031
gi|27597162|dbj|BAC55151.1| iron-binding IscA protein homologue ...    38   0.053
gi|49082646|gb|AAT50723.1| PA1847 [synthetic construct]                37   0.069
gi|34935365|ref|XP_345706.1| similar to CG13623-PA [Rattus norve...    37   0.069
gi|37524219|ref|NP_927563.1| hypothetical protein [Photorhabdus ...    37   0.069
gi|15597044|ref|NP_250538.1| conserved hypothetical protein [Pse...    37   0.069
gi|24376092|ref|NP_720135.1| yhgI protein [Shewanella oneidensis...    37   0.090
gi|19113467|ref|NP_596675.1| conserved hypothetical protein with...    37   0.12
gi|48762993|ref|ZP_00267550.1| COG0316: Uncharacterized conserve...    36   0.15
gi|32416112|ref|XP_328534.1| hypothetical protein [Neurospora cr...    36   0.15
gi|50123054|ref|YP_052221.1| conserved hypothetical protein [Erw...    36   0.15
gi|16272381|ref|NP_438594.1| unknown protein [Haemophilus influe...    36   0.20
gi|15603422|ref|NP_246496.1| OrfG [Pasteurella multocida Pm70] >...    35   0.34
gi|48733340|ref|ZP_00267083.1| COG0316: Uncharacterized conserve...    35   0.34
gi|15803918|ref|NP_289954.1| orf, hypothetical protein [Escheric...    35   0.45
gi|16766799|ref|NP_462414.1| putative thioredoxin-like protein [...    35   0.45
gi|16762776|ref|NP_458393.1| conserved hypothetical protein [Sal...    35   0.45
gi|149000|gb|AAA25015.1| The predicted molecular weight and pI o...    34   0.59
gi|26989102|ref|NP_744527.1| yhgI protein [Pseudomonas putida KT...    34   0.77
gi|11022576|emb|CAC14234.1| hypothetical protein L7845.02 [Leish...    33   1.0
gi|38637583|dbj|BAD03865.1| hypothetical protein [Oryza sativa (...    33   1.3
gi|32398968|emb|CAD98433.1| hypothetical garp protein, possible ...    33   1.3
gi|49097260|ref|XP_410090.1| hypothetical protein AN5953.2 [Aspe...    33   1.7
gi|11357426|pir||T51397 hypothetical protein F14F8_60 - Arabidop...    32   2.2
gi|39585664|emb|CAE59866.1| Hypothetical protein CBG03342 [Caeno...    32   2.2
gi|2276138|emb|CAA74669.1| fusion protein [Avian pneumovirus]          32   2.9
gi|2276130|emb|CAA74665.1| fusion protein [Avian pneumovirus]          32   2.9
gi|2276136|emb|CAA74668.1| fusion protein [Avian pneumovirus]          32   2.9
gi|2276132|emb|CAA74666.1| fusion protein [Avian pneumovirus]          32   2.9
gi|2276134|emb|CAA74667.1| fusion protein [Avian pneumovirus]          32   2.9
gi|48839369|ref|ZP_00296301.1| COG3291: FOG: PKD repeat [Methano...    32   2.9
gi|138283|sp|P24614|VGLF_TRTV Fusion glycoprotein precursor [Con...    32   3.8
gi|7494466|pir||T28676 rhoptry protein - Plasmodium yoelii (frag...    31   5.0
gi|23479485|gb|EAA16302.1| rhoptry protein-related [Plasmodium y...    31   5.0
gi|16762997|ref|NP_458614.1| Putative acetyltransferase [Salmone...    31   5.0
gi|17538784|ref|NP_502384.1| fibronectin, type III and Protein o...    31   5.0
gi|7458799|gb|AAB41263.3| rhoptry protein [Plasmodium yoelii]          31   5.0
gi|7496505|pir||T19473 hypothetical protein C25G4.10 - Caenorhab...    31   5.0
gi|33866666|ref|NP_898225.1| conserved hypothetical protein [Syn...    31   5.0
gi|50414844|ref|XP_457436.1| unnamed protein product [Debaryomyc...    31   6.5
gi|16767568|ref|NP_463183.1| putative acetyltransferase [Salmone...    31   6.5
gi|7437386|pir||S71862 protein disulfide-isomerase (EC 5.3.4.1) ...    31   6.5
gi|17569137|ref|NP_508778.1| protein disulfide isomerase (55.1 k...    31   6.5
gi|50293955|ref|XP_449389.1| unnamed protein product [Candida gl...    30   8.5
gi|11120215|gb|AAG30838.1| fusion protein [Avian pneumovirus]          30   8.5


>gi|25146411|ref|NP_741696.1| HesB protein (5T664) [Caenorhabditis
           elegans]
 gi|11359773|pir||T45057 hypothetical protein Y39B6B.ee [imported] -
           Caenorhabditis elegans
 gi|15209351|emb|CAC51075.1| Hypothetical protein Y39B6A.3
           [Caenorhabditis elegans]
          Length = 129

 Score =  256 bits (654), Expect = 7e-68
 Identities = 129/129 (100%), Positives = 129/129 (100%)
 Frame = -1

Query: 390 MSKFGGATAKVIKGALKVRQTRAALTLTNEAVSRIRVLLAQQNDANALKIGVRQKGCNGL 211
           MSKFGGATAKVIKGALKVRQTRAALTLTNEAVSRIRVLLAQQNDANALKIGVRQKGCNGL
Sbjct: 1   MSKFGGATAKVIKGALKVRQTRAALTLTNEAVSRIRVLLAQQNDANALKIGVRQKGCNGL 60

Query: 210 TYTLEYAKDKQKFDEEVEQDGIKVWIEPKAQLSLLGSEMDYVTDKLSSEFVFRNPNIKGT 31
           TYTLEYAKDKQKFDEEVEQDGIKVWIEPKAQLSLLGSEMDYVTDKLSSEFVFRNPNIKGT
Sbjct: 61  TYTLEYAKDKQKFDEEVEQDGIKVWIEPKAQLSLLGSEMDYVTDKLSSEFVFRNPNIKGT 120

Query: 30  CGCGESFSI 4
           CGCGESFSI
Sbjct: 121 CGCGESFSI 129




[DB home][top]