Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y39G10AL_3
         (993 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|25145738|ref|NP_490952.2| Cyclin-Dependent Kinase (38.4 kD) (...   679   0.0
gi|39595255|emb|CAE60292.1| Hypothetical protein CBG03876 [Caeno...   588   e-167
gi|4502743|ref|NP_001790.1| cyclin-dependent kinase 7; cyclin-de...   379   e-104
gi|33304107|gb|AAQ02561.1| cyclin-dependent kinase 7 [synthetic ...   379   e-104
gi|2125816|emb|CAA73587.1| serine/threonine protein kinase [Homo...   379   e-104
gi|13529020|gb|AAH05298.1| Cyclin-dependent kinase 7 [Homo sapiens]   379   e-104
gi|31206629|ref|XP_312281.1| ENSANGP00000002848 [Anopheles gambi...   371   e-101
gi|1705723|sp|Q03147|CDK7_MOUSE Cell division protein kinase 7 (...   370   e-101
gi|34853514|ref|XP_215467.2| cyclin-dependent kinase 7 (MO15 hom...   369   e-101
gi|47226698|emb|CAG07857.1| unnamed protein product [Tetraodon n...   368   e-100
gi|1083627|pir||S51085 CdK-activating kinase Cdk7 - rat (fragmen...   363   2e-99
gi|1705724|sp|P51952|CDK7_RAT Cell division protein kinase 7 (CD...   363   2e-99
gi|104169|pir||S12091 protein kinase (EC 2.7.1.-) 40K - African ...   362   6e-99
gi|125413|sp|P20911|CDK7_XENLA Cell division protein kinase 7 (4...   362   6e-99
gi|33859522|ref|NP_034004.1| cyclin-dependent kinase 7 (homolog ...   357   3e-97
gi|17530793|ref|NP_511044.1| CG3319-PA [Drosophila melanogaster]...   355   1e-96
gi|1705720|sp|P51953|CDK7_CARAU Cell division protein kinase 7 (...   351   2e-95
gi|26333031|dbj|BAC30233.1| unnamed protein product [Mus musculus]    331   1e-89
gi|50761553|ref|XP_424761.1| PREDICTED: similar to Cell division...   324   2e-87
gi|13435472|gb|AAH04605.1| Cdk7 protein [Mus musculus]                307   3e-82
gi|47085739|ref|NP_998126.1| hypothetical protein zgc:85821 [Dan...   301   2e-80
gi|15219730|ref|NP_176847.1| cell division protein kinase, putat...   297   3e-79
gi|266410|sp|P29620|KC47_ORYSA CDC2+/CDC28-related protein kinas...   295   8e-79
gi|15220917|ref|NP_173244.1| cell division protein kinase, putat...   295   8e-79
gi|15419985|gb|AAK97227.1| CDK-activating kinase [Medicago sativ...   293   5e-78
gi|15219522|ref|NP_177510.1| cell division protein kinase, putat...   291   1e-77
gi|915406|gb|AAA73577.1| cdk7 gene product                            284   3e-75
gi|49077282|ref|XP_402517.1| hypothetical protein UM04902.1 [Ust...   282   7e-75
gi|19113141|ref|NP_596349.1| cdk-activating kinase [Schizosaccha...   274   3e-72
gi|1705721|sp|P54685|CDK7_DICDI Cell division protein kinase 7 (...   271   2e-71
gi|1098032|prf||2115201A Mo15 kinase-related protein                  270   4e-71
gi|50811836|ref|NP_998571.1| cyclin-dependent kinase 2 [Danio re...   256   4e-67
gi|19112421|ref|NP_595629.1| cell division control protein 2 [Sc...   256   4e-67
gi|4096103|gb|AAD10483.1| p34cdc2 [Triticum aestivum]                 256   7e-67
gi|2564703|gb|AAC06329.1| Cdc2 cyclin-dependent kinase [Pneumocy...   255   1e-66
gi|2564701|gb|AAD05577.1| Cdc2 cyclin-dependent kinase [Pneumocy...   255   1e-66
gi|50427707|ref|XP_462466.1| unnamed protein product [Debaryomyc...   254   2e-66
gi|33112022|gb|AAP94021.1| cyclin-dependent kinase 1 [Ustilago m...   254   2e-66
gi|46440529|gb|EAK99834.1| hypothetical protein CaO19.13619 [Can...   254   2e-66
gi|1420882|emb|CAA67342.1| cdec2-related kinase [Theileria parva]     253   4e-66
gi|1835258|emb|CAA99991.1| cdc2 kinase homologue [Sesbania rostr...   253   4e-66
gi|46227268|gb|EAK88218.1| Cdc2-like CDK2/CDC28 like protein kin...   253   5e-66
gi|24636266|sp|Q41639|CDC2_VIGAC Cell division control protein 2...   253   6e-66
gi|6320095|ref|NP_010175.1| serine-threonine kinase, subunit of ...   252   8e-66
gi|1168865|sp|P43450|CDK2_CARAU Cell division protein kinase 2 >...   252   8e-66
gi|13249052|gb|AAK16652.1| CDC2 homolog [Populus tremula x Popul...   252   8e-66
gi|231706|sp|P29618|CC21_ORYSA Cell division control protein 2 h...   252   8e-66
gi|8671339|emb|CAA56815.2| cdc2Pnc [Pinus contorta]                   252   8e-66
gi|1705676|sp|P52389|CDC2_VIGUN Cell division control protein 2 ...   252   8e-66
gi|541800|pir||S42049 protein kinase (EC 2.7.1.37) cdc2 - Norway...   252   8e-66
gi|2117788|pir||S57928 protein kinase (EC 2.7.1.37) cdc2 homolog...   252   1e-65
gi|1419310|emb|CAA67306.1| cdc2-like kinase [Theileria annulata]      251   1e-65
gi|33324533|gb|AAQ08004.1| Cdk1 protein kinase [Cryptococcus neo...   251   1e-65
gi|34902408|ref|NP_912550.1| Putative CELL DIVISION CONTROL PROT...   251   1e-65
gi|4557439|ref|NP_001249.1| cyclin-dependent kinase 3 [Homo sapi...   251   1e-65
gi|7489305|pir||T17115 protein kinase cdc2a (EC 2.7.1.-), cyclin...   251   2e-65
gi|1236190|gb|AAA92823.1| cyclin dependent protein kinase homolo...   251   2e-65
gi|3123616|emb|CAA76701.1| cyclin-dependent protein kinase p34cd...   251   2e-65
gi|5921443|sp|Q38772|CC2A_ANTMA Cell division control protein 2 ...   251   2e-65
gi|2956719|emb|CAA12223.1| cyclin dependent kinase 2 [Sphaerechi...   250   3e-65
gi|17224978|gb|AAL37195.1| cyclin dependent kinase [Helianthus a...   250   3e-65
gi|3329529|gb|AAC26878.1| cdc2-like protein kinase [Cryptosporid...   250   4e-65
gi|3123614|emb|CAA76700.1| cyclin-dependent protein kinase p34cd...   250   4e-65
gi|25989351|gb|AAL47481.1| cyclin-dependent kinase [Helianthus t...   250   4e-65
gi|100915|pir||A40444 protein kinase (EC 2.7.1.37) cdc2 homolog ...   249   5e-65
gi|115923|sp|P23111|CDC2_MAIZE Cell division control protein 2 h...   249   5e-65
gi|50309219|ref|XP_454616.1| unnamed protein product [Kluyveromy...   249   5e-65
gi|50254590|gb|EAL17339.1| hypothetical protein CNBN1650 [Crypto...   249   7e-65
gi|115924|sp|P24923|CC21_MEDSA Cell division control protein 2 h...   249   7e-65
gi|100916|pir||B40444 protein kinase (EC 2.7.1.37) cdc2 homolog ...   249   9e-65
gi|3608177|dbj|BAA33152.1| cdc2 [Pisum sativum]                       249   9e-65
gi|45187590|ref|NP_983813.1| ADL283Wp [Eremothecium gossypii] >g...   248   1e-64
gi|41053019|dbj|BAD07950.1| putative p34cdc2 [Oryza sativa (japo...   248   2e-64
gi|461706|sp|P34112|CDC2_DICDI Cell division control protein 2 h...   248   2e-64
gi|24636265|sp|P93101|CDC2_CHERU Cell division control protein 2...   248   2e-64
gi|9885803|gb|AAG01534.1| cyclin-dependent kinase A:4 [Nicotiana...   248   2e-64
gi|50773534|ref|XP_427196.1| PREDICTED: similar to Cell division...   248   2e-64
gi|849068|dbj|BAA09369.1| cdc2 homolog [Nicotiana tabacum]            248   2e-64
gi|20068275|emb|CAD29319.1| cyclin-dependent kinase [Juglans nig...   247   3e-64
gi|231707|sp|P29619|CC22_ORYSA Cell division control protein 2 h...   247   3e-64
gi|104008|pir||A37871 protein kinase (EC 2.7.1.37) cdk2 - Africa...   247   3e-64
gi|50289629|ref|XP_447246.1| unnamed protein product [Candida gl...   247   3e-64
gi|1168866|sp|P23437|CDK2_XENLA Cell division protein kinase 2 (...   247   3e-64
gi|22266163|emb|CAD43850.1| cell division cycle protein 2 [Daucu...   247   3e-64
gi|18408696|ref|NP_566911.1| cell division control protein 2 hom...   247   3e-64
gi|50546527|ref|XP_500733.1| hypothetical protein [Yarrowia lipo...   246   4e-64
gi|4761616|gb|AAD29423.1| protein kinase Crk2 [Plasmodium vivax]      246   6e-64
gi|461702|sp|Q05006|CC22_MEDSA Cell division control protein 2 h...   246   8e-64
gi|461704|sp|P34117|CC2H_DICDI CDC2-like serine/threonine-protei...   245   1e-63
gi|47682830|gb|AAH70640.1| MGC81499 protein [Xenopus laevis]          245   1e-63
gi|1196796|gb|AAC41680.1| protein kinase p34cdc2                      245   1e-63
gi|1377888|gb|AAB02567.1| cdc2 gene product                           245   1e-63
gi|2289782|dbj|BAA21673.1| cdc2 kinase [Allium cepa]                  245   1e-63
gi|16716469|ref|NP_444410.1| cell cycle related kinase; CDK-rela...   244   2e-63
gi|2589145|dbj|BAA23218.1| p34cdc2 [Hemicentrotus pulcherrimus]       244   2e-63
gi|50514017|pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH P...   244   3e-63
gi|11259538|pir||T49271 CELL DIVISION CONTROL PROTEIN 2 HOMOLOG ...   244   3e-63
gi|50549857|ref|XP_502400.1| hypothetical protein [Yarrowia lipo...   244   3e-63
gi|2408133|emb|CAA04520.1| putative 34kDa cdc2-related protein k...   243   4e-63
gi|2791887|gb|AAB96975.1| CDC2-like protein kinase TPK2 [Toxopla...   243   4e-63
gi|34873735|ref|XP_344564.1| similar to CDK-related protein kina...   243   4e-63
gi|34809870|pdb|1OIT|A Chain A, Imidazopyridines: A Potent And S...   243   4e-63
gi|29849|emb|CAA43807.1| CDK2 [Homo sapiens]                          243   4e-63
gi|5921709|sp|O55076|CDK2_CRIGR Cell division protein kinase 2 >...   243   4e-63
gi|6166046|sp|Q63699|CDK2_RAT Cell division protein kinase 2 >gn...   243   4e-63
gi|23619490|ref|NP_705452.1| cell division control protein 2 hom...   243   5e-63
gi|4139569|pdb|1B38|A Chain A, Human Cyclin-Dependent Kinase 2 >...   243   5e-63
gi|33356961|pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 ...   243   5e-63
gi|30583821|gb|AAP36159.1| Homo sapiens cyclin-dependent kinase ...   243   5e-63
gi|40889309|pdb|1PF8|A Chain A, Crystal Structure Of Human Cycli...   243   5e-63
gi|7949020|ref|NP_058036.1| cyclin-dependent kinase 2 isoform 2 ...   243   5e-63
gi|16936528|ref|NP_001789.2| cyclin-dependent kinase 2 isoform 1...   243   5e-63
gi|42543186|pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5...   243   6e-63
gi|3776100|emb|CAA11852.1| cdc2-related kinase 2 [Plasmodium kno...   243   6e-63
gi|48104548|ref|XP_395800.1| similar to ENSANGP00000002848 [Apis...   243   6e-63
gi|47169418|pdb|1V0B|A Chain A, Crystal Structure Of The T198a M...   242   8e-63
gi|50304029|ref|XP_451964.1| unnamed protein product [Kluyveromy...   242   1e-62
gi|19699294|gb|AAL91258.1| AT3g48750/T21J18_20 [Arabidopsis thal...   241   1e-62
gi|6730495|pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Sub...   241   2e-62
gi|2960352|emb|CAA12343.1| cyclin dependent kinase 1 [Sphaerechi...   241   2e-62
gi|312803|emb|CAA43985.1| cdk2 [Homo sapiens]                         241   2e-62
gi|1942625|pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent K...   241   2e-62
gi|1345715|sp|P48963|CDK2_MESAU Cell division protein kinase 2 >...   241   2e-62
gi|34810054|pdb|1OGU|A Chain A, Structure Of Human Thr160-Phosph...   241   2e-62
gi|16975317|pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2 - Hu...   241   2e-62
gi|24158643|pdb|1H1P|A Chain A, Structure Of Human Thr160-Phosph...   241   2e-62
gi|34809869|pdb|1OIR|A Chain A, Imidazopyridines: A Potent And S...   241   2e-62
gi|34809859|pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstit...   241   2e-62
gi|45187931|ref|NP_984154.1| ADR058Cp [Eremothecium gossypii] >g...   240   4e-62
gi|3776086|emb|CAA11849.1| cdc2-related kinase 2 [Plasmodium ber...   240   4e-62
gi|18655411|pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 ...   239   5e-62
gi|5921445|sp|Q38773|CC2B_ANTMA Cell division control protein 2 ...   239   7e-62
gi|23489870|gb|EAA21777.1| cdc2-related kinase 2 [Plasmodium yoe...   239   9e-62
gi|17064846|gb|AAL32577.1| putative protein kinase [Arabidopsis ...   238   1e-61
gi|15220477|ref|NP_176925.1| protein kinase family protein [Arab...   238   1e-61
gi|4096105|gb|AAD10484.1| p34cdc2 [Triticum aestivum]                 238   1e-61
gi|32414773|ref|XP_327866.1| hypothetical protein ( (AF116453) c...   238   2e-61
gi|50426821|ref|XP_462008.1| unnamed protein product [Debaryomyc...   238   2e-61
gi|5670015|gb|AAD46564.1| cyclin-dependent protein kinase homolo...   238   2e-61
gi|4836599|gb|AAD30494.1| cell division control protein 2 [Phase...   237   3e-61
gi|7434290|pir||T02922 protein kinase (EC 2.7.1.37) cdc2 homolog...   237   4e-61
gi|29245850|gb|EAA37469.1| GLP_576_19385_20311 [Giardia lamblia ...   237   4e-61
gi|1658064|gb|AAC48318.1| cdc2-related protein kinase 1 [Trypano...   236   6e-61
gi|23344742|gb|AAN28684.1| cell cycle related kinase [Homo sapiens]   236   6e-61
gi|19075421|ref|NP_587921.1| cyclin-dependent protein kinase pho...   236   6e-61
gi|45384336|ref|NP_990645.1| cell division cycle 2 [Gallus gallu...   236   6e-61
gi|29409213|gb|AAM14635.1| Cdc2 [Giardia intestinalis]                236   8e-61
gi|1127039|dbj|BAA11477.1| cdc2 [Asterina pectinifera]                235   1e-60
gi|6319636|ref|NP_009718.1| Catalytic subunit of the main cell c...   235   1e-60
gi|46122031|ref|XP_385569.1| hypothetical protein FG05393.1 [Gib...   235   1e-60
gi|21304629|gb|AAM45437.1| cyclin-dependent kinase 1 [Axinella c...   235   1e-60
gi|38109914|gb|EAA55711.1| hypothetical protein MG01362.4 [Magna...   235   1e-60
gi|1168810|sp|P43063|CC28_CANAL Cell division control protein 28...   234   2e-60
gi|33772776|gb|AAQ54757.1| cyclin-dependent protein kinase PHOB ...   234   2e-60
gi|49077338|ref|XP_402540.1| hypothetical protein UM04925.1 [Ust...   234   3e-60
gi|48926653|gb|AAT47442.1| putative cdc2 protein kinase [Oryza s...   234   3e-60
gi|1705671|sp|P54664|CC21_TRYCO Cell division control protein 2 ...   233   4e-60
gi|2190494|emb|CAA73997.1| cyclin dependent kinase [Petunia x hy...   233   4e-60
gi|27806699|ref|NP_776441.1| cell division cycle 2, G1 to S and ...   233   4e-60
gi|28172866|emb|CAD56245.1| putative cyclin dependent kinase A [...   233   4e-60
gi|50289387|ref|XP_447125.1| unnamed protein product [Candida gl...   233   5e-60
gi|37496992|dbj|BAC98412.1| Cdc2 homologue [Halocynthia roretzi]      233   5e-60
gi|7488728|pir||T09572 cdc2-like protein kinase cdc2MsC - alfalf...   233   5e-60
gi|1705674|sp|P54119|CDC2_AJECA Cell division control protein 2 ...   233   7e-60
gi|49088338|ref|XP_406004.1| hypothetical protein AN1867.2 [Aspe...   233   7e-60
gi|9506475|ref|NP_062169.1| cell division cycle 2 homolog A; Cel...   233   7e-60
gi|1575290|gb|AAB09465.1| p34 cdc2 kinase [Mus musculus]              233   7e-60
gi|40804978|gb|AAR91747.1| cyclin-dependent serine/threonine pro...   232   9e-60
gi|30584091|gb|AAP36294.1| Homo sapiens cell division cycle 2, G...   232   9e-60
gi|4502709|ref|NP_001777.1| cell division cycle 2 protein isofor...   232   9e-60
gi|17738075|ref|NP_524420.1| CG10498-PB [Drosophila melanogaster...   232   9e-60
gi|38344237|emb|CAD41330.2| OJ991113_30.14 [Oryza sativa (japoni...   232   1e-59
gi|1705675|sp|P51958|CDC2_CARAU Cell division control protein 2 ...   232   1e-59
gi|31542366|ref|NP_031685.2| cell division cycle 2 homolog A; ce...   232   1e-59
gi|13542826|gb|AAH05614.1| Cdc2a protein [Mus musculus]               231   1e-59
gi|23200128|pdb|1H4L|A Chain A, Structure And Regulation Of The ...   231   1e-59
gi|4826675|ref|NP_004926.1| cyclin-dependent kinase 5 [Homo sapi...   231   2e-59
gi|7434324|pir||JE0374 cyclin-dependent kinase 5 (EC 2.7.-.-) - ...   231   2e-59
gi|30584911|gb|AAP36712.1| Homo sapiens cyclin-dependent kinase ...   231   2e-59
gi|47086901|ref|NP_997729.1| cell division cycle 2 [Danio rerio]...   231   2e-59
gi|47208706|emb|CAF90431.1| unnamed protein product [Tetraodon n...   231   2e-59
gi|4959457|gb|AAD34354.1| cyclin-dependent protein kinase Cdk2 [...   231   3e-59
gi|461718|sp|Q02399|CDK5_BOVIN Cell division protein kinase 5 (T...   231   3e-59
gi|18266682|ref|NP_543161.1| cyclin-dependent kinase 5 [Rattus n...   231   3e-59
gi|50360|emb|CAA34481.1| unnamed protein product [Mus musculus]       231   3e-59
gi|5081691|gb|AAD39491.1| cyclin-dependent protein kinase [Sporo...   230   3e-59
gi|29248279|gb|EAA39817.1| GLP_512_31909_31034 [Giardia lamblia ...   230   3e-59
gi|6680908|ref|NP_031694.1| cyclin-dependent kinase 5 [Mus muscu...   230   4e-59
gi|543963|sp|P35567|CC21_XENLA Cell division control protein 2 h...   230   4e-59
gi|91217|pir||A36074 protein kinase (EC 2.7.1.37) cdc2 [validate...   230   4e-59
gi|7769677|gb|AAF69500.1| cyclin-dependent protein kinase CDC2 [...   229   6e-59
gi|34905748|ref|NP_914221.1| cell division cycle 2-like protein ...   229   7e-59
gi|31197861|ref|XP_307878.1| ENSANGP00000018666 [Anopheles gambi...   229   7e-59
gi|49093716|ref|XP_408319.1| CDC2_EMENI Cell division control pr...   229   1e-58
gi|4170|emb|CAA68774.1| PHO85 [Saccharomyces cerevisiae]              229   1e-58
gi|115928|sp|P24033|CC22_XENLA Cell division control protein 2 h...   229   1e-58
gi|4808831|gb|AAD29956.1| cyclin-dependent protein kinase PHOSs ...   228   1e-58
gi|2257629|dbj|BAA21483.1| Bm cdc2 [Bombyx mori]                      228   1e-58
gi|48146199|emb|CAG33322.1| CDK5 [Homo sapiens]                       228   1e-58
gi|740281|prf||2005165A cdc2 protein                                  228   1e-58
gi|11034748|dbj|BAB17220.1| serine/threonine kinase cdc2 [Oryzia...   228   1e-58
gi|295932|emb|CAA68773.1| PHO85 [Saccharomyces cerevisiae]            228   1e-58
gi|45360475|ref|NP_988908.1| hypothetical protein MGC76203 [Xeno...   228   2e-58
gi|15238114|ref|NP_196589.1| cyclin-dependent kinase, putative /...   228   2e-58
gi|2134385|pir||I50463 protein kinase - chicken >gnl|BL_ORD_ID|1...   228   2e-58
gi|1082288|pir||F54024 protein kinase (EC 2.7.1.37) cdc2-related...   228   2e-58
gi|50759209|ref|XP_417568.1| PREDICTED: similar to protein kinas...   228   2e-58
gi|2144418|pir||OKBY85 protein kinase PHO85 (EC 2.7.1.-) - yeast...   228   2e-58
gi|420022|pir||S23386 protein kinase (EC 2.7.1.37) cdc2-related ...   228   2e-58
gi|50551579|ref|XP_503264.1| hypothetical protein [Yarrowia lipo...   228   2e-58
gi|284345|pir||A42823 cell division control-related protein kina...   227   3e-58
gi|38110770|gb|EAA56442.1| hypothetical protein MG06413.4 [Magna...   227   3e-58
gi|1082285|pir||H54024 protein kinase (EC 2.7.1.37) cdc2-related...   227   3e-58
gi|21263457|sp|Q9DGD3|CDC2_ORYLA Cell division control protein 2...   227   3e-58
gi|6325226|ref|NP_015294.1| Cyclin-dependent kinase, with ten cy...   227   3e-58
gi|9955398|dbj|BAB12209.1| negative regulator of PHO system CaPh...   227   3e-58
gi|4007434|gb|AAC95298.1| PITSLRE protein kinase beta SV6 isofor...   227   4e-58
gi|15680223|gb|AAH14464.1| Unknown (protein for IMAGE:4899488) [...   227   4e-58
gi|15526337|emb|CAA04648.2| cdc2-related kinase 3 [Leishmania me...   227   4e-58
gi|4185262|gb|AAD08994.1| cdc2-related kinase [Leishmania major]      227   4e-58
gi|18076013|emb|CAD20058.1| cdc2-related kinase 3 [Leishmania do...   227   4e-58
gi|4140321|emb|CAA20348.1| dJ283E3.3.1 (variant beta 1) [Homo sa...   227   4e-58
gi|16357486|ref|NP_277073.1| cell division cycle 2-like 2 isofor...   227   4e-58
gi|34922255|sp|Q9UQ88|CDL2_HUMAN PITSLRE serine/threonine-protei...   227   4e-58
gi|16357480|ref|NP_277069.1| cell division cycle 2-like 2 isofor...   227   4e-58
gi|4007433|gb|AAC95297.1| PITSLRE protein kinase beta SV2 isofor...   227   4e-58
gi|16357498|ref|NP_076916.1| cell division cycle 2-like 2 isofor...   227   4e-58
gi|4140322|emb|CAA20349.1| dJ283E3.3.2 (variant beta 2-2) [Homo ...   227   4e-58
gi|28828850|gb|AAO51445.1| similar to Arabidopsis thaliana (Mous...   227   4e-58
gi|16357482|ref|NP_277070.1| cell division cycle 2-like 2 isofor...   227   4e-58
gi|15215944|emb|CAC51391.1| cyclin dependent kinase C [Lycopersi...   227   4e-58
gi|1705719|sp|P51166|CDK5_XENLA Cell division protein kinase 5 (...   227   4e-58
gi|4007436|gb|AAC95300.1| PITSLRE protein kinase beta SV3 isofor...   227   4e-58
gi|21263450|sp|Q9DG98|CDC2_ORYLU Cell division control protein 2...   227   4e-58
gi|38104313|gb|EAA50901.1| hypothetical protein MG04660.4 [Magna...   227   4e-58
gi|4140323|emb|CAA20350.1| dJ283E3.3.3 (variant beta 2-1) [Homo ...   227   4e-58
gi|4007435|gb|AAC95299.1| PITSLRE protein kinase beta SV1 isofor...   227   4e-58
gi|16357484|ref|NP_277071.1| cell division cycle 2-like 2 isofor...   227   4e-58
gi|4096112|gb|AAC99804.1| CTD kinase largest subunit [Kluyveromy...   226   5e-58
gi|1082283|pir||E54024 protein kinase (EC 2.7.1.37) cdc2-related...   226   5e-58
gi|4100184|gb|AAD00773.1| CDC2PTB [Paramecium tetraurelia]            226   5e-58
gi|15242731|ref|NP_201142.1| protein kinase family protein [Arab...   226   5e-58
gi|50256586|gb|EAL19311.1| hypothetical protein CNBH4100 [Crypto...   226   5e-58
gi|17136606|ref|NP_476797.1| CG5363-PA [Drosophila melanogaster]...   226   5e-58
gi|432558|gb|AAB28422.1| Cdc2216 product {P element-induced A to...   226   5e-58
gi|50420991|ref|XP_459038.1| unnamed protein product [Debaryomyc...   226   5e-58
gi|1082287|pir||A54024 protein kinase (EC 2.7.1.37) cdc2-related...   226   5e-58
gi|1082284|pir||B54024 protein kinase (EC 2.7.1.37) cdc2-related...   226   6e-58
gi|50732998|ref|XP_418864.1| PREDICTED: similar to cell division...   226   6e-58
gi|50414818|gb|AAH77321.1| Unknown (protein for MGC:80275) [Xeno...   226   6e-58
gi|32450029|gb|AAH54146.1| Cdc2a-prov protein [Xenopus laevis]        226   6e-58
gi|21263456|sp|Q9DGA5|CDC2_ORYCU Cell division control protein 2...   226   6e-58
gi|21263453|sp|Q9DGA2|CDC2_ORYJA Cell division control protein 2...   226   6e-58
gi|107255|pir||A38282 p58 galactosyltransferase-associated prote...   226   6e-58
gi|39590768|emb|CAE65141.1| Hypothetical protein CBG10007 [Caeno...   226   6e-58
gi|50308983|ref|XP_454497.1| unnamed protein product [Kluyveromy...   226   8e-58
gi|7446377|pir||T09568 protein kinase p58 (EC 2.7.1.-) - human >...   226   8e-58
gi|507168|gb|AAA19586.1| PITSLRE alpha 2-1                            225   1e-57
gi|33695123|ref|NP_031687.2| cell division cycle 2 homolog (S. p...   225   1e-57
gi|1083273|pir||A55817 cyclin-dependent kinase p130-PITSLRE - mo...   225   1e-57
gi|189481|gb|AAA36406.1| p58/GTA protein kinase [Homo sapiens]        225   1e-57
gi|16332370|ref|NP_277027.1| cell division cycle 2-like 1 (PITSL...   225   1e-57
gi|14110390|ref|NP_112557.1| cell division cycle 2-like 5 isofor...   225   1e-57
gi|507160|gb|AAA19582.1| PITSLRE alpha 2-2                            225   1e-57
gi|16332362|ref|NP_277023.1| cell division cycle 2-like 1 (PITSL...   225   1e-57
gi|31324936|gb|AAH52920.1| Cdc2l2 protein [Mus musculus]              225   1e-57
gi|507164|gb|AAA19584.1| PITSLRE alpha 2-4                            225   1e-57
gi|38566288|gb|AAH62579.1| Unknown (protein for IMAGE:5199576) [...   225   1e-57
gi|14110387|ref|NP_003709.2| cell division cycle 2-like 5 isofor...   225   1e-57
gi|50345282|gb|AAT74623.1| cell division cycle 2-like 5 (choline...   225   1e-57
gi|16332358|ref|NP_277021.1| cell division cycle 2-like 1 (PITSL...   225   1e-57
gi|3978440|gb|AAC83663.1| PITSLRE protein kinase alpha SV5 isofo...   225   1e-57
gi|507162|gb|AAA19583.1| PITSLRE alpha 2-3                            225   1e-57
gi|3978441|gb|AAC83664.1| PITSLRE protein kinase alpha SV9 isofo...   225   1e-57
gi|432560|gb|AAB28424.1| Cdc2E10 product {P element-induced L to...   225   1e-57
gi|507158|gb|AAA19581.1| PITSLRE alpha 1                              225   1e-57
gi|29835136|gb|AAH51012.1| Cdc2l2 protein [Mus musculus]              225   1e-57
gi|10835055|ref|NP_001778.1| cell division cycle 2-like 1 (PITSL...   225   1e-57
gi|21619822|gb|AAH33069.1| Similar to cell division cycle 2-like...   225   1e-57
gi|16332372|ref|NP_277028.1| cell division cycle 2-like 1 (PITSL...   225   1e-57
gi|16332366|ref|NP_277025.1| cell division cycle 2-like 1 (PITSL...   225   1e-57
gi|16332364|ref|NP_277024.1| cell division cycle 2-like 1 (PITSL...   225   1e-57
gi|19263603|gb|AAH25058.1| Cdc2l2 protein [Mus musculus]              225   1e-57
gi|16332360|ref|NP_277022.1| cell division cycle 2-like 1 (PITSL...   225   1e-57
gi|26330694|dbj|BAC29077.1| unnamed protein product [Mus musculus]    225   1e-57
gi|34879827|ref|XP_235722.2| similar to cell division cycle 2 ho...   225   1e-57
gi|432563|gb|AAB28427.1| Cdc2E1-23 product {P element-induced G ...   225   1e-57
gi|34876196|ref|XP_225404.2| similar to cell division cycle 2-li...   225   1e-57
gi|34899282|ref|NP_910987.1| putative CRK1 protein(cdc2-related ...   224   2e-57
gi|17554940|ref|NP_499153.1| Cyclin-Dependent Kinase, cell divis...   224   2e-57
gi|46128181|ref|XP_388644.1| CDC2_AJECA Cell division control pr...   224   2e-57
gi|50511115|dbj|BAD32543.1| mKIAA1791 protein [Mus musculus]          224   2e-57
gi|18858401|ref|NP_571794.1| cyclin-dependent protein kinase 5 [...   224   2e-57
gi|32419969|ref|XP_330428.1| CELL DIVISION CONTROL PROTEIN 2 (CY...   224   3e-57
gi|432561|gb|AAB28425.1| Cdc2E1-24 product {P element-induced E ...   224   3e-57
gi|432557|gb|AAB28421.1| Cdc2E1-4 product {P element-induced G t...   224   3e-57
gi|507166|gb|AAA19585.1| PITSLRE beta 1                               223   4e-57
gi|19173516|ref|NP_597319.1| CDK2-LIKE CELL CYCLE PROTEIN KINASE...   223   4e-57
gi|16357492|ref|NP_284922.1| cell division cycle 2-like 2 isofor...   223   4e-57
gi|507427|gb|AAA19594.1| PITSLRE isoform PBETA21                      223   4e-57
gi|16357494|ref|NP_284923.1| cell division cycle 2-like 2 isofor...   223   4e-57
gi|507429|gb|AAA19595.1| PITSLRE isoform PBETA22                      223   4e-57
gi|17373575|sp|Q9W739|CDC2_RANDY Cell division control protein 2...   223   4e-57
gi|432562|gb|AAB28426.1| Cdc2E1-9 product {P element-induced P t...   223   4e-57
gi|432559|gb|AAB28423.1| Cdc2D57 product {P element-induced G to...   223   4e-57
gi|539821|pir||A53227 galactosyltransferase-associated protein k...   223   4e-57
gi|125381|sp|P24788|CDL1_MOUSE PITSLRE serine/threonine protein ...   223   4e-57
gi|1654379|gb|AAC48317.1| cdc2-related protein kinase 3 [Trypano...   223   5e-57
gi|10719935|sp|Q14004|CDL5_HUMAN Cell division cycle 2-like prot...   223   5e-57
gi|31228322|ref|XP_318036.1| ENSANGP00000010689 [Anopheles gambi...   223   5e-57
gi|1362556|pir||S53538 protein kinase (EC 2.7.1.37) cdc2 homolog...   223   5e-57
gi|21955152|ref|NP_665709.1| cell division cycle 2 homolog (S.po...   223   7e-57
gi|1170682|sp|P46892|CDL1_RAT PITSLRE serine/threonine protein k...   223   7e-57
gi|47497299|dbj|BAD19341.1| putative PITSLRE alpha 2-1 [Oryza sa...   222   9e-57
gi|50426089|ref|XP_461641.1| unnamed protein product [Debaryomyc...   222   9e-57
gi|729073|sp|P38973|CC21_TRYBB Cell division control protein 2 h...   222   1e-56
gi|7706549|ref|NP_057591.1| CDC2-related protein kinase 7 [Homo ...   222   1e-56
gi|17064746|gb|AAL32527.1| cdc2-like protein kinase [Arabidopsis...   222   1e-56
gi|20521690|dbj|BAA74927.2| KIAA0904 protein [Homo sapiens]           222   1e-56
gi|807197|gb|AAC60520.1| p34cdc2 kinase [Caenorhabditis elegans]      221   2e-56
gi|20302121|ref|NP_620271.1| protein kinase for splicing compone...   221   2e-56
gi|37360138|dbj|BAC98047.1| mKIAA0904 protein [Mus musculus]          221   2e-56
gi|15238314|ref|NP_201301.1| cyclin-dependent kinase, putative /...   221   2e-56
gi|50753975|ref|XP_414201.1| PREDICTED: similar to Cell division...   221   2e-56
gi|1705673|sp|P54666|CC23_TRYBB Cell division control protein 2 ...   221   3e-56
gi|49121170|ref|XP_412398.1| hypothetical protein AN8261.2 [Aspe...   220   3e-56
gi|284039|pir||A38197 protein kinase (EC 2.7.1.37) cdc2-like - h...   220   3e-56
gi|50293797|ref|XP_449310.1| unnamed protein product [Candida gl...   220   3e-56
gi|3643645|gb|AAC42260.1| cyclin-dependent protein kinase PHOA(M...   220   3e-56
gi|32416216|ref|XP_328586.1| hypothetical protein [Neurospora cr...   220   4e-56
gi|34914694|ref|NP_918694.1| putative CRK1 protein [Oryza sativa...   220   4e-56
gi|50307235|ref|XP_453596.1| unnamed protein product [Kluyveromy...   220   4e-56
gi|7108917|gb|AAF36538.1| GR AF-1 coactivator 3 [Homo sapiens]        219   6e-56
gi|727249|gb|AAA79977.1| CDC2                                         219   8e-56
gi|542589|pir||JX0296 protein kinase (EC 2.7.1.37) cdc2-related ...   219   8e-56
gi|17647247|ref|NP_523674.1| CG1362-PA [Drosophila melanogaster]...   219   8e-56
gi|26190145|emb|CAD21952.1| putative cyclin dependent kinase [Ph...   219   1e-55
gi|6226784|sp|Q15131|CDKA_HUMAN Cell division protein kinase 10 ...   218   1e-55
gi|38106974|gb|EAA53208.1| hypothetical protein MG07485.4 [Magna...   218   1e-55
gi|50286145|ref|XP_445501.1| unnamed protein product [Candida gl...   218   1e-55
gi|30794424|ref|NP_081228.1| CDC2-related protein kinase 7; prot...   218   1e-55
gi|19112531|ref|NP_595739.1| putative galactosyltransferase asso...   218   1e-55
gi|2499590|sp|Q92241|PH85_KLULA Negative regulator of the PHO sy...   218   1e-55
gi|32528263|ref|NP_003665.2| cyclin-dependent kinase 10 isoform ...   218   1e-55
gi|46122057|ref|XP_385582.1| hypothetical protein FG05406.1 [Gib...   218   1e-55
gi|37595744|ref|NP_919428.1| cyclin-dependent kinase 10 isoform ...   218   2e-55
gi|50551393|ref|XP_503170.1| hypothetical protein [Yarrowia lipo...   218   2e-55
gi|37595740|ref|NP_919426.1| cyclin-dependent kinase 10 isoform ...   218   2e-55
gi|31213957|ref|XP_315787.1| ENSANGP00000018692 [Anopheles gambi...   217   3e-55
gi|34851866|ref|XP_341713.1| similar to PISSLRE [Rattus norvegicus]   217   3e-55
gi|24583171|ref|NP_723501.1| CG31711-PA [Drosophila melanogaster...   217   4e-55
gi|31377445|gb|AAC79672.3| putative cdc2-related kinase [Haemato...   217   4e-55
gi|17137070|ref|NP_477080.1| CG8203-PA [Drosophila melanogaster]...   217   4e-55
gi|47270748|gb|AAC17568.2| Hypothetical protein K03E5.3a [Caenor...   216   6e-55
gi|31198265|ref|XP_308080.1| ENSANGP00000003083 [Anopheles gambi...   216   6e-55
gi|45200855|ref|NP_986425.1| AGL242Cp [Eremothecium gossypii] >g...   216   6e-55
gi|9857049|emb|CAC04006.1| probable cell division protein kinase...   216   8e-55
gi|585007|sp|Q06309|CRK1_LEIME Cell division protein kinase 2 ho...   216   8e-55
gi|50255163|gb|EAL17901.1| hypothetical protein CNBL0280 [Crypto...   216   8e-55
gi|39591648|emb|CAE71225.1| Hypothetical protein CBG18089 [Caeno...   216   8e-55
gi|2117791|pir||S51008 protein kinase (EC 2.7.1.37) cdk5 homolog...   216   8e-55
gi|10443347|emb|CAC10445.1| CDC2L5 protein kinase [Sphaerechinus...   215   1e-54
gi|47221167|emb|CAG05488.1| unnamed protein product [Tetraodon n...   215   1e-54
gi|6322710|ref|NP_012783.1| Catalytic (alpha) subunit of C-termi...   215   1e-54
gi|50744866|ref|XP_419912.1| PREDICTED: similar to intestinal ce...   215   1e-54
gi|7671528|emb|CAB89490.1| CRK1 protein [Beta vulgaris subsp. vu...   214   2e-54
gi|17531375|ref|NP_495617.1| cell division cycle 2-like 1 (83.6 ...   214   2e-54
gi|19074064|ref|NP_584670.1| similarity to SER/THR CYCLIN-DEPEND...   214   2e-54
gi|50260614|gb|EAL23267.1| hypothetical protein CNBA3830 [Crypto...   214   2e-54
gi|47222760|emb|CAG01727.1| unnamed protein product [Tetraodon n...   214   3e-54
gi|19115305|ref|NP_594393.1| putative cell division protein kina...   214   3e-54
gi|42570106|ref|NP_683519.2| protein kinase family protein [Arab...   214   3e-54
gi|42408357|dbj|BAD09509.1| putative CRK1 protein [Oryza sativa ...   214   3e-54
gi|1705672|sp|P54665|CC22_TRYBB Cell division control protein 2 ...   213   4e-54
gi|16950647|ref|NP_443713.1| cyclin-dependent kinase 10 isoform ...   213   4e-54
gi|24667662|ref|NP_649251.2| CG4268-PA [Drosophila melanogaster]...   213   5e-54
gi|1524006|emb|CAA67863.1| protein kinase [Drosophila melanogaster]   213   5e-54
gi|39586564|emb|CAE73691.1| Hypothetical protein CBG21202 [Caeno...   213   5e-54
gi|32404696|ref|XP_322961.1| probable cyclin-dependent ser/thr p...   213   5e-54
gi|21711655|gb|AAM75018.1| GH14923p [Drosophila melanogaster]         213   5e-54
gi|23507945|ref|NP_700615.1| cdk7, putative [Plasmodium falcipar...   213   7e-54
gi|1695919|gb|AAC72269.1| MO15-related protein kinase Pfmrk [Pla...   213   7e-54
gi|46443499|gb|EAL02780.1| hypothetical protein CaO19.9187 [Cand...   213   7e-54
gi|17862948|gb|AAL39951.1| SD04681p [Drosophila melanogaster]         212   9e-54
gi|24668137|ref|NP_649325.2| CG7597-PA [Drosophila melanogaster]...   212   9e-54
gi|5911414|gb|AAD55782.1| MO15-related protein kinase Pfmrk [Pla...   212   9e-54
gi|48428266|sp|Q9JKV2|ICK_MOUSE Serine/threonine kinase ICK (Int...   212   1e-53
gi|9910288|ref|NP_064371.1| intestinal cell kinase [Mus musculus...   212   1e-53
gi|31214677|ref|XP_315879.1| ENSANGP00000017398 [Anopheles gambi...   212   1e-53
gi|48097336|ref|XP_391878.1| similar to ENSANGP00000018692 [Apis...   211   2e-53
gi|48104195|ref|XP_392924.1| similar to intestinal cell kinase; ...   211   2e-53
gi|49903483|gb|AAH76915.1| Unknown (protein for MGC:89093) [Xeno...   211   2e-53
gi|17552716|ref|NP_499783.1| Cyclin-Dependent Kinase (33.1 kD) (...   211   2e-53
gi|20302067|ref|NP_620241.1| intestinal cell kinase; heart serin...   211   2e-53
gi|39595977|emb|CAE67480.1| Hypothetical protein CBG12984 [Caeno...   211   2e-53
gi|16768328|gb|AAL28383.1| GM01879p [Drosophila melanogaster]         211   2e-53
gi|48104762|ref|XP_392973.1| similar to cdc2-related kinase [Api...   211   3e-53
gi|710417|gb|AAA63754.1| CDK5 homolog                                 211   3e-53
gi|47224444|emb|CAG08694.1| unnamed protein product [Tetraodon n...   210   4e-53
gi|15221868|ref|NP_175862.1| protein kinase family protein [Arab...   210   4e-53
gi|34903662|ref|NP_913178.1| putative CRK1 protein [Oryza sativa...   210   4e-53
gi|40788990|dbj|BAA76780.2| KIAA0936 protein [Homo sapiens]           210   5e-53
gi|7662388|ref|NP_055735.1| intestinal cell kinase; MAK-related ...   210   5e-53
gi|17508383|ref|NP_492493.1| predicted CDS, intestinal cell kina...   210   5e-53
gi|46114580|ref|XP_383308.1| hypothetical protein FG03132.1 [Gib...   209   1e-52
gi|39589418|emb|CAE74447.1| Hypothetical protein CBG22182 [Caeno...   209   1e-52
gi|26449319|dbj|BAC41787.1| putative cyclin-dependent protein ki...   209   1e-52
gi|15241289|ref|NP_199899.1| protein kinase family protein [Arab...   209   1e-52
gi|11125683|emb|CAC15503.1| B1-type cyclin dependent kinase [Lyc...   209   1e-52
gi|31442141|emb|CAD92448.1| cyclin-dependent kinase C [Oryza sat...   208   1e-52
gi|25989353|gb|AAL47482.1| cyclin-dependent kinase [Helianthus t...   208   1e-52
gi|25143958|ref|NP_497873.2| protein kinase (3F429) [Caenorhabdi...   208   2e-52
gi|32187089|gb|AAP73784.1| cyclin-dependent kinase [Populus trem...   208   2e-52
gi|27542763|gb|AAO16696.1| cyclin-dependent kinase-like protein ...   208   2e-52
gi|50415356|gb|AAH78026.1| Unknown (protein for MGC:82717) [Xeno...   207   2e-52
gi|8132347|gb|AAF73257.1| MAP kinase PsMAPK2 [Pisum sativum]          207   2e-52
gi|17508033|ref|NP_491157.1| cell division control protein 2 hom...   207   3e-52
gi|15219169|ref|NP_175713.1| protein kinase family protein [Arab...   207   4e-52
gi|42362295|gb|AAS13369.1| cyclin-dependent kinases CDKB [Glycin...   207   4e-52
gi|39598279|emb|CAE68971.1| Hypothetical protein CBG14952 [Caeno...   206   5e-52
gi|24652305|ref|NP_724876.1| CG1362-PB [Drosophila melanogaster]...   206   5e-52
gi|34907628|ref|NP_915161.1| putative cyclin-dependent kinase B1...   206   5e-52
gi|32412982|ref|XP_326971.1| hypothetical protein [Neurospora cr...   206   5e-52
gi|18032144|gb|AAL56635.1| cyclin-dependent kinase CDC2C [Arabid...   206   5e-52
gi|22327464|ref|NP_198758.2| protein kinase family protein [Arab...   206   5e-52
gi|7494824|pir||T18697 hypothetical protein B0285.1 - Caenorhabd...   206   7e-52
gi|33146814|dbj|BAC79804.1| putative cyclin-dependent kinase CDC...   206   7e-52
gi|543971|sp|Q04770|CDK2_ENTHI Cell division protein kinase 2 ho...   206   7e-52
gi|15221219|ref|NP_177573.1| protein kinase, putative [Arabidops...   206   7e-52
gi|15011928|ref|NP_148979.1| PCTAIRE protein kinase 1 isoform b;...   206   9e-52
gi|30583875|gb|AAP36186.1| Homo sapiens PCTAIRE protein kinase 1...   206   9e-52
gi|5453860|ref|NP_006192.1| PCTAIRE protein kinase 1 isoform a; ...   206   9e-52
gi|23480605|gb|EAA17120.1| MO15-related protein kinase Pfmrk [Pl...   206   9e-52
gi|13812042|ref|NP_113173.1| putative cdc2 kinase [Guillardia th...   206   9e-52
gi|39645248|gb|AAH09852.2| PCTK1 protein [Homo sapiens]               206   9e-52
gi|28393523|gb|AAO42182.1| putative cell division-related protei...   205   1e-51
gi|11125685|emb|CAC15504.1| B2-type cyclin dependent kinase [Lyc...   205   1e-51
gi|15218072|ref|NP_173517.1| cell division control protein, puta...   205   1e-51
gi|21536682|gb|AAM61014.1| putative cell division control protei...   205   1e-51
gi|49121535|ref|XP_412422.1| hypothetical protein AN8285.2 [Aspe...   205   1e-51
gi|49120049|ref|XP_412327.1| hypothetical protein AN8190.2 [Aspe...   204   2e-51
gi|7434293|pir||T08065 protein kinase (EC 2.7.1.37) cdc2 - green...   204   2e-51
gi|2257631|dbj|BAA21484.1| cdc2-related kinase [Bombyx mori]          204   3e-51
gi|50728526|ref|XP_416161.1| PREDICTED: similar to PCTAIRE prote...   204   3e-51
gi|15217643|ref|NP_174637.1| protein kinase family protein [Arab...   204   3e-51
gi|12240252|gb|AAG49589.1| putative MAP kinase [Trypanosoma brucei]   204   3e-51
gi|7141298|gb|AAF37278.1| intestinal cell kinase [Homo sapiens]       204   3e-51
gi|15217565|ref|NP_172431.1| protein kinase family protein [Arab...   204   3e-51
gi|15489103|gb|AAH13663.1| PCTAIRE-motif protein kinase 1 [Mus m...   204   3e-51
gi|7242173|ref|NP_035179.1| PCTAIRE-motif protein kinase 1 [Mus ...   204   3e-51
gi|14906243|gb|AAK72509.1| cyclin-dependent kinase-related kinas...   204   3e-51
gi|6678786|ref|NP_032573.1| male germ cell-associated kinase [Mu...   204   3e-51
gi|14488071|gb|AAK63856.1| At1g76540/F14G6_14 [Arabidopsis thali...   204   3e-51
gi|29477134|gb|AAH50009.1| Mak protein [Mus musculus]                 204   3e-51
gi|7434327|pir||T09591 probable cdc2-like protein kinase cdc2MsF...   204   3e-51
gi|24981044|gb|AAH39825.1| MAK protein [Homo sapiens]                 204   3e-51
gi|575365|emb|CAA56732.1| cdc2-related protein kinase 1 [Plasmod...   204   3e-51
gi|25402555|pir||G86229 hypothetical protein [imported] - Arabid...   204   3e-51
gi|11496279|ref|NP_005897.1| male germ cell-associated kinase; s...   204   3e-51
gi|23510162|ref|NP_702828.1| cdc2-related protein kinase 1 [Plas...   204   3e-51
gi|47227405|emb|CAF96954.1| unnamed protein product [Tetraodon n...   203   4e-51
gi|9885801|gb|AAG01533.1| cyclin-dependent kinase B1-2 [Nicotian...   203   4e-51
gi|31235604|ref|XP_319268.1| ENSANGP00000012552 [Anopheles gambi...   203   4e-51
gi|15223081|ref|NP_177780.1| cell division control protein, puta...   203   6e-51
gi|37537198|ref|NP_922902.1| putative serine/threonine kinase [O...   203   6e-51
gi|45198723|ref|NP_985752.1| AFR205Cp [Eremothecium gossypii] >g...   203   6e-51
gi|23273510|gb|AAH35807.1| ICK protein [Homo sapiens]                 203   6e-51
gi|25012563|gb|AAN71382.1| RE37740p [Drosophila melanogaster]         203   6e-51
gi|19112408|ref|NP_595616.1| cdc2 kinase homologue [Schizosaccha...   203   6e-51
gi|21537217|gb|AAM61558.1| putative cell division control protei...   203   6e-51
gi|6981176|ref|NP_037268.1| male germ cell-associated kinase [Ra...   202   7e-51
gi|33304143|gb|AAQ02579.1| PCTAIRE protein kinase 2 [synthetic c...   202   7e-51
gi|37813142|gb|AAR04351.1| putative MAPK [Tetrahymena thermophila]    202   7e-51
gi|37595545|ref|NP_002586.2| PCTAIRE protein kinase 2; serine/th...   202   7e-51
gi|22122813|ref|NP_666351.1| PCTAIRE-motif protein kinase 2 [Mus...   202   1e-50
gi|20865556|ref|XP_137290.1| similar to SERINE/THREONINE-PROTEIN...   202   1e-50
gi|46126091|ref|XP_387599.1| hypothetical protein FG07423.1 [Gib...   202   1e-50
gi|420021|pir||S23384 protein kinase (EC 2.7.1.37) cdc2-related ...   202   1e-50
gi|49036088|sp|Q8K0D0|KPT2_MOUSE Serine/threonine-protein kinase...   202   1e-50
gi|34864751|ref|XP_235049.2| similar to SERINE/THREONINE-PROTEIN...   202   1e-50
gi|630465|pir||S47042 protein kinase (EC 2.7.1.37) cdc2-related ...   202   1e-50
gi|6016451|sp|O35831|KPT2_RAT Serine/threonine-protein kinase PC...   202   1e-50
gi|46390992|dbj|BAD16526.1| putative CRK1 protein [Oryza sativa ...   201   2e-50
gi|22077127|emb|CAD43177.1| putative cyclin dependent kinase [Co...   201   2e-50
gi|50733688|ref|XP_418948.1| PREDICTED: similar to male germ cel...   201   2e-50
gi|31213674|ref|XP_315744.1| ENSANGP00000015862 [Anopheles gambi...   201   2e-50
gi|23598949|ref|XP_127221.2| cell division cycle 2-like 5 (choli...   201   2e-50
gi|46390991|dbj|BAD16525.1| putative CRK1 protein [Oryza sativa ...   201   2e-50
gi|41053945|ref|NP_956240.1| intestinal cell kinase; wu:fj04c02 ...   201   2e-50
gi|49097442|ref|XP_410181.1| hypothetical protein AN6044.2 [Aspe...   201   2e-50
gi|27696254|gb|AAH43763.1| Pctk2-prov protein [Xenopus laevis]        201   2e-50
gi|7434326|pir||T09586 probable cdc2-like protein kinase cdc2MsD...   201   3e-50
gi|9885799|gb|AAG01532.1| cyclin-dependent kinase B1-1 [Nicotian...   201   3e-50
gi|266426|sp|Q00537|KPT2_HUMAN Serine/threonine-protein kinase P...   201   3e-50
gi|30185634|gb|AAH51599.1| MGC52574 protein [Xenopus laevis]          200   4e-50
gi|5921711|sp|Q91727|CDK4_XENLA Cell division protein kinase 4 (...   200   4e-50
gi|15229881|ref|NP_187156.1| protein kinase family protein [Arab...   200   4e-50
gi|7489567|pir||T04109 protein kinase cdc2 homolog - rice >gnl|B...   200   4e-50
gi|15241455|ref|NP_199242.1| protein kinase family protein [Arab...   200   5e-50
gi|50547511|ref|XP_501225.1| hypothetical protein [Yarrowia lipo...   200   5e-50


>gi|25145738|ref|NP_490952.2| Cyclin-Dependent Kinase (38.4 kD)
           (cdk-7) [Caenorhabditis elegans]
 gi|5031478|gb|AAD38186.1| cyclin-dependent kinase 7 homolog
           [Caenorhabditis elegans]
 gi|21166344|gb|AAK68887.2| Cyclin-dependent kinase family protein 7
           [Caenorhabditis elegans]
          Length = 330

 Score =  679 bits (1753), Expect = 0.0
 Identities = 330/330 (100%), Positives = 330/330 (100%)
 Frame = -1

Query: 993 MSRRYDTIKHLGEGQFANVYLAQDLESGECVAIKKIKLGSREEAKDGINRTAIREIKLLK 814
           MSRRYDTIKHLGEGQFANVYLAQDLESGECVAIKKIKLGSREEAKDGINRTAIREIKLLK
Sbjct: 1   MSRRYDTIKHLGEGQFANVYLAQDLESGECVAIKKIKLGSREEAKDGINRTAIREIKLLK 60

Query: 813 EIHHDNIIGLRDVIGHRTSIQLVFDFMDTDLEHVIKDKEIILMPAHIKNITMQMLLGLEF 634
           EIHHDNIIGLRDVIGHRTSIQLVFDFMDTDLEHVIKDKEIILMPAHIKNITMQMLLGLEF
Sbjct: 61  EIHHDNIIGLRDVIGHRTSIQLVFDFMDTDLEHVIKDKEIILMPAHIKNITMQMLLGLEF 120

Query: 633 LHVHWILHRDLKPNNLLMNKMGRVKLTDFGLARFFGSPNRNYTHQVVTRWYRAPELLFGA 454
           LHVHWILHRDLKPNNLLMNKMGRVKLTDFGLARFFGSPNRNYTHQVVTRWYRAPELLFGA
Sbjct: 121 LHVHWILHRDLKPNNLLMNKMGRVKLTDFGLARFFGSPNRNYTHQVVTRWYRAPELLFGA 180

Query: 453 RSYGVGIDIWSVGCIIAELLLRNPIFPGESDIDQLVKIFNILGCPTPETWPNMTEMNSYV 274
           RSYGVGIDIWSVGCIIAELLLRNPIFPGESDIDQLVKIFNILGCPTPETWPNMTEMNSYV
Sbjct: 181 RSYGVGIDIWSVGCIIAELLLRNPIFPGESDIDQLVKIFNILGCPTPETWPNMTEMNSYV 240

Query: 273 IIKPQTEYMALNYYFSAAPQDLLDLMAGMWTFDPIKRLTCTQSLQMEYFRTQPFCCLDEE 94
           IIKPQTEYMALNYYFSAAPQDLLDLMAGMWTFDPIKRLTCTQSLQMEYFRTQPFCCLDEE
Sbjct: 241 IIKPQTEYMALNYYFSAAPQDLLDLMAGMWTFDPIKRLTCTQSLQMEYFRTQPFCCLDEE 300

Query: 93  LPLPKKQQPQKRSRRLDDDGTRPVRRLNFD 4
           LPLPKKQQPQKRSRRLDDDGTRPVRRLNFD
Sbjct: 301 LPLPKKQQPQKRSRRLDDDGTRPVRRLNFD 330




[DB home][top]