Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y39G8B_1
(951 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17537075|ref|NP_496924.1| aldo-keto reductase family 1 member... 627 e-178
gi|17537077|ref|NP_496925.1| aldo-keto reductase family 1 member... 590 e-167
gi|39591260|emb|CAE73313.1| Hypothetical protein CBG20740 [Caeno... 546 e-154
gi|17537079|ref|NP_496926.1| aldo-keto reductase family 1 member... 303 5e-81
gi|24662785|ref|NP_729726.1| CG6084-PB [Drosophila melanogaster]... 291 1e-77
gi|13591894|ref|NP_112262.1| aldo-keto reductase family 1, membe... 291 2e-77
gi|31197517|ref|XP_307706.1| ENSANGP00000023501 [Anopheles gambi... 290 3e-77
gi|45382879|ref|NP_989960.1| aldo-keto reductase [Gallus gallus]... 290 4e-77
gi|12847939|dbj|BAB27767.1| unnamed protein product [Mus musculu... 288 1e-76
gi|24662781|ref|NP_648484.1| CG6084-PA [Drosophila melanogaster]... 288 1e-76
gi|12847479|dbj|BAB27586.1| unnamed protein product [Mus musculus] 288 2e-76
gi|10946870|ref|NP_067448.1| aldo-keto reductase family 1, membe... 288 2e-76
gi|12848322|dbj|BAB27909.1| unnamed protein product [Mus musculus] 286 4e-76
gi|39591259|emb|CAE73312.1| Hypothetical protein CBG20739 [Caeno... 286 4e-76
gi|28386164|gb|AAH46762.1| Aldo-keto reductase family 1, member ... 286 5e-76
gi|50729038|ref|XP_416400.1| PREDICTED: similar to aldose reduct... 286 5e-76
gi|12848338|dbj|BAB27915.1| unnamed protein product [Mus musculus] 285 1e-75
gi|4502049|ref|NP_001619.1| aldo-keto reductase family 1, member... 285 1e-75
gi|47496649|emb|CAG29347.1| AKR1B1 [Homo sapiens] 284 2e-75
gi|493797|pdb|1ABN| Aldose Reductase (E.C.1.1.1.21) Mutant With... 284 2e-75
gi|2981775|pdb|1AZ1| Alrestatin Bound To C298aW219Y MUTANT HUMA... 284 2e-75
gi|49457402|emb|CAG47000.1| AKR1B1 [Homo sapiens] 284 2e-75
gi|46015262|pdb|1PWL|A Chain A, Crystal Structure Of Human Aldos... 284 2e-75
gi|442618|pdb|1ADS| Aldose Reductase (E.C.1.1.1.21) Complex Wit... 283 4e-75
gi|1703235|sp|P15122|ALDR_RABIT Aldose reductase (AR) (Aldehyde ... 283 5e-75
gi|576365|pdb|2ACU| Aldose Reductase (E.C.1.1.1.21) Mutant With... 281 2e-74
gi|1633300|pdb|2ALR| Aldehyde Reductase 281 2e-74
gi|5174391|ref|NP_006057.1| aldo-keto reductase family 1, member... 281 2e-74
gi|30584269|gb|AAP36383.1| Homo sapiens aldo-keto reductase fami... 281 2e-74
gi|50729042|ref|XP_416402.1| PREDICTED: similar to aldose reduct... 280 3e-74
gi|31981909|ref|NP_033788.2| aldo-keto reductase family 1, membe... 280 3e-74
gi|13529257|gb|AAH05387.1| Aldo-keto reductase family 1, member ... 279 6e-74
gi|1351911|sp|P45376|ALDR_MOUSE Aldose reductase (AR) (Aldehyde ... 279 8e-74
gi|3046247|gb|AAC13358.1| aldose reductase [Mus musculus] 278 1e-73
gi|2117448|pir||I49484 aldehyde reductase (EC 1.1.1.21) - mouse ... 278 2e-73
gi|31198277|ref|XP_308086.1| ENSANGP00000023237 [Anopheles gambi... 276 4e-73
gi|50603905|gb|AAH77140.1| Unknown (protein for MGC:100940) [Dan... 276 5e-73
gi|2914184|pdb|1CWN| Crystal Structure Of Porcine Aldehyde Redu... 276 5e-73
gi|47522702|ref|NP_999055.1| aldehyde reductase [Sus scrofa] >gn... 276 5e-73
gi|6978491|ref|NP_036630.1| aldehyde reductase 1 (low Km aldose ... 276 5e-73
gi|49256068|gb|AAH74141.1| Unknown (protein for MGC:81878) [Xeno... 276 6e-73
gi|109150|pir||A34406 aldehyde reductase (EC 1.1.1.21) - rabbit ... 275 8e-73
gi|14277736|pdb|1HQT|A Chain A, The Crystal Structure Of An Alde... 275 8e-73
gi|50751520|ref|XP_422438.1| PREDICTED: similar to Alcohol dehyd... 275 1e-72
gi|225939|prf||1403439A aldehyde reductase 275 1e-72
gi|38014641|gb|AAH60383.1| MGC68609 protein [Xenopus laevis] 275 1e-72
gi|50764028|ref|XP_422928.1| PREDICTED: similar to aldose reduct... 273 5e-72
gi|50729040|ref|XP_416401.1| PREDICTED: similar to aldose reduct... 273 5e-72
gi|50604191|gb|AAH78366.1| Unknown (protein for IMAGE:7039050) [... 273 5e-72
gi|108513|pir||A35452 aldehyde reductase (EC 1.1.1.21) - bovine 272 7e-72
gi|113594|sp|P16116|ALDR_BOVIN Aldose reductase (AR) (Aldehyde r... 272 7e-72
gi|6753148|ref|NP_033861.1| aldo-keto reductase family 1, member... 272 9e-72
gi|265404|gb|AAB25333.1| 20 alpha-hydroxysteroid dehydrogenase; ... 271 2e-71
gi|584742|sp|P80276|ALDR_PIG Aldose reductase (AR) (Aldehyde red... 271 2e-71
gi|16758620|ref|NP_446233.1| androgen regulated vas deferens pro... 270 5e-71
gi|231525|sp|P21300|ALD1_MOUSE Aldose reductase-related protein ... 270 5e-71
gi|3114346|pdb|1AH0| Pig Aldose Reductase Complexed With Sorbinil 269 6e-71
gi|3114349|pdb|1AH3| Aldose Reductase Complexed With Tolrestat ... 269 6e-71
gi|515110|pdb|1DLA|A Chain A, Aldose Reductase (E.C.1.1.1.21) >g... 269 6e-71
gi|48374071|ref|NP_001001539.1| aldose reductase [Sus scrofa] >g... 269 8e-71
gi|50344750|ref|NP_001002048.1| zgc:86611 [Danio rerio] >gnl|BL_... 266 7e-70
gi|20127592|ref|NP_064695.2| aldo-keto reductase family 1, membe... 264 2e-69
gi|31982057|ref|NP_765986.2| RIKEN cDNA 2310005E10 [Mus musculus... 264 2e-69
gi|3493209|gb|AAC36465.1| aldo-keto reductase [Homo sapiens] 264 2e-69
gi|50400248|sp|O08782|ALD2_CRIGR Aldose reductase-related protei... 264 2e-69
gi|6980756|pdb|1C9W|A Chain A, Cho Reductase With Nadp+ 264 2e-69
gi|30584339|gb|AAP36418.1| Homo sapiens aldo-keto reductase fami... 264 2e-69
gi|27465603|ref|NP_775159.1| aldose reductase-like protein [Ratt... 262 7e-69
gi|27436418|gb|AAO13380.1| aldo-ketoreductase [Homo sapiens] 261 2e-68
gi|26349951|dbj|BAC38615.1| unnamed protein product [Mus musculus] 261 2e-68
gi|34855128|ref|XP_216117.2| similar to RIKEN cDNA 2310005E10 [R... 259 5e-68
gi|13543246|gb|AAH05789.1| Aldo-keto reductase family 1, member ... 258 1e-67
gi|6679791|ref|NP_032038.1| aldo-keto reductase family 1, member... 258 1e-67
gi|162652|gb|AAA30370.1| aldose reductase (EC 1.1.1.21) 258 2e-67
gi|1827670|pdb|1FRB| Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX 258 2e-67
gi|31197525|ref|XP_307710.1| ENSANGP00000018090 [Anopheles gambi... 256 4e-67
gi|7509716|pir||T26767 hypothetical protein Y39G8B.b - Caenorhab... 256 7e-67
gi|49522287|gb|AAH71135.1| Unknown (protein for IMAGE:4031540) [... 251 1e-65
gi|47226686|emb|CAG07845.1| unnamed protein product [Tetraodon n... 251 2e-65
gi|28277322|gb|AAH44678.1| MGC53504 protein [Xenopus laevis] 249 8e-65
gi|24663317|ref|NP_729808.1| CG10638-PA [Drosophila melanogaster... 249 8e-65
gi|30687261|ref|NP_181315.2| aldo/keto reductase family protein ... 248 2e-64
gi|21703734|ref|NP_663339.1| aldo-keto reductase family 1, membe... 247 3e-64
gi|47222089|emb|CAG12115.1| unnamed protein product [Tetraodon n... 247 3e-64
gi|19528595|gb|AAL90412.1| RH46018p [Drosophila melanogaster] 246 4e-64
gi|20531984|sp|Q9DCT1|AKE1_MOUSE Aldo-keto reductase family 1 me... 246 4e-64
gi|34908280|ref|NP_915487.1| putative aldose reductase [Oryza sa... 246 7e-64
gi|13160397|emb|CAC32834.1| aldose reductase [Digitalis purpurea] 245 9e-64
gi|25283479|pir||B84797 probable alcohol dehydrogenase [imported... 245 1e-63
gi|13160399|emb|CAC32835.1| aldose reductase [Digitalis purpurea] 245 1e-63
gi|11558038|emb|CAC17786.1| rhoB-crystallin [Lepidodactylus lugu... 244 3e-63
gi|9256562|ref|NP_061347.1| aldo-keto reductase family 1, member... 244 3e-63
gi|32450171|gb|AAH53793.1| MGC64396 protein [Xenopus laevis] 243 4e-63
gi|7431112|pir||T09670 abscisic acid activated protein - alfalfa... 243 5e-63
gi|34908276|ref|NP_915485.1| putative aldose reductase [Oryza sa... 242 8e-63
gi|50728912|ref|XP_416341.1| PREDICTED: similar to 3-oxo-5-beta-... 242 1e-62
gi|31197519|ref|XP_307707.1| ENSANGP00000024720 [Anopheles gambi... 241 1e-62
gi|23268307|gb|AAN11329.1| prostaglandin F synthase-like2 protei... 241 2e-62
gi|17564128|ref|NP_504231.1| aldo-keto reductase (37.3 kD) (5E96... 241 2e-62
gi|7431114|pir||T02543 aldehyde dehydrogenase homolog At2g37770 ... 240 4e-62
gi|30794344|ref|NP_851370.1| aldo-keto reductase family 1, membe... 240 4e-62
gi|49258555|pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha... 239 5e-62
gi|1352733|sp|P80508|PE2R_RABIT Prostaglandin-E(2) 9-reductase (... 239 5e-62
gi|34876309|ref|XP_225536.2| similar to Aldo-keto reductase fami... 239 9e-62
gi|1912051|dbj|BAA19477.1| D-xylose reductase II,III [Candida tr... 238 1e-61
gi|30584997|gb|AAP36771.1| Homo sapiens aldo-keto reductase fami... 238 1e-61
gi|21465695|pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Terna... 238 1e-61
gi|4503285|ref|NP_001345.1| aldo-keto reductase family 1, member... 238 1e-61
gi|30583841|gb|AAP36169.1| Homo sapiens aldo-keto reductase fami... 238 2e-61
gi|40788950|dbj|BAA04619.2| KIAA0119 [Homo sapiens] 238 2e-61
gi|20532372|sp|P42330|AKC3_HUMAN Aldo-keto reductase family 1 me... 238 2e-61
gi|23268305|gb|AAN11328.1| prostaglandin F synthase-like1 protei... 238 2e-61
gi|18204896|gb|AAH21607.1| Akr1c20 protein [Mus musculus] 238 2e-61
gi|24497583|ref|NP_003730.4| aldo-keto reductase family 1, membe... 238 2e-61
gi|47168966|pdb|1S1P|A Chain A, Crystal Structures Of Prostaglan... 238 2e-61
gi|1912049|dbj|BAA19476.1| D-xylose reductase I,II [Candida trop... 237 3e-61
gi|30585359|gb|AAP36952.1| Homo sapiens aldo-keto reductase fami... 237 3e-61
gi|47221904|emb|CAF98916.1| unnamed protein product [Tetraodon n... 237 3e-61
gi|2117446|pir||I53872 dihydrodiol dehydrogenase (EC 1.1.1.-) - ... 237 3e-61
gi|2117449|pir||I73676 chlordecone reductase homolog (clone HAKR... 237 3e-61
gi|37926825|pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alp... 237 3e-61
gi|1723158|gb|AAB38486.1| dihydrodiol dehydrogenase/bile acid-bi... 237 3e-61
gi|5453543|ref|NP_001344.2| aldo-keto reductase family 1, member... 237 3e-61
gi|34876322|ref|XP_341551.1| similar to protein RAKc [Rattus nor... 237 3e-61
gi|13487925|ref|NP_085114.1| aldo-keto reductase family 1, membe... 236 4e-61
gi|49670657|gb|AAH75451.1| Unknown (protein for MGC:89235) [Xeno... 236 7e-61
gi|50556354|ref|XP_505585.1| hypothetical protein [Yarrowia lipo... 236 7e-61
gi|129896|sp|P05980|PGFS_BOVIN Prostaglandin-F synthase 1 (PGF s... 236 7e-61
gi|2117447|pir||I73674 chlordecone reductase homolog (clone HAKR... 235 1e-60
gi|20302063|ref|NP_620239.1| aldo-keto reductase family 1, membe... 235 1e-60
gi|1815604|gb|AAB41916.1| 3-alpha-hydroxysteroid dehydrogenase [... 234 2e-60
gi|1730509|sp|P52897|PGF2_BOVIN Prostaglandin-F synthase 2 (PGF ... 234 2e-60
gi|15232354|ref|NP_190956.1| aldo/keto reductase family protein ... 234 2e-60
gi|49095010|ref|XP_408966.1| hypothetical protein AN4829.2 [Aspe... 234 2e-60
gi|1839262|gb|AAB47001.1| HAKRc product/3 alpha-hydroxysteroid d... 234 2e-60
gi|2117445|pir||I73675 chlordecone reductase homolog (clone HAKR... 234 2e-60
gi|28393400|gb|AAO42123.1| putative aldo/keto reductase [Arabido... 234 2e-60
gi|1839263|gb|AAB47002.1| HAKRb product/3 alpha-hydroxysteroid d... 234 3e-60
gi|10765097|gb|AAF07272.2| 3-alpha hydroxysteroid dehydrogenase ... 233 4e-60
gi|741804|prf||2008147B protein RAKc 233 4e-60
gi|39580158|emb|CAE56773.1| Hypothetical protein CBG24579 [Caeno... 233 4e-60
gi|5689216|dbj|BAA82867.1| delta4-3-oxosteroid 5beta-reductase [... 233 4e-60
gi|2117444|pir||B57407 3alpha-hydroxysteroid dehydrogenase (EC 1... 233 5e-60
gi|37959887|gb|AAP69945.1| prostaglandin F synthase [Equus cabal... 233 5e-60
gi|31198271|ref|XP_308083.1| ENSANGP00000019775 [Anopheles gambi... 233 6e-60
gi|19527839|gb|AAL90034.1| AT08919p [Drosophila melanogaster] 232 8e-60
gi|24662789|ref|NP_648485.1| CG6083-PA [Drosophila melanogaster]... 232 1e-59
gi|15208400|dbj|BAB63207.1| 3(20)alpha-hydroxysteroid/dihydrodio... 232 1e-59
gi|31197523|ref|XP_307709.1| ENSANGP00000018089 [Anopheles gambi... 231 2e-59
gi|46442500|gb|EAL01789.1| hypothetical protein CaO19.4317 [Cand... 231 2e-59
gi|5174695|ref|NP_005980.1| aldo-keto reductase family 1, member... 231 2e-59
gi|19527284|ref|NP_598827.1| aldo-keto reductase family 1, membe... 230 3e-59
gi|15208398|dbj|BAB63206.1| 3(20)alpha-hydroxysteroid/dihydrodio... 230 3e-59
gi|34876315|ref|XP_225538.2| similar to estradiol 17beta-dehydro... 229 7e-59
gi|41054333|ref|NP_956031.1| Unknown (protein for MGC:56622); wu... 229 7e-59
gi|631852|pir||JC2330 luteal 20-alpha-hydroxysteroid dehydrogena... 228 1e-58
gi|19924035|ref|NP_612519.1| 20 alpha-hydroxysteroid dehydrogena... 228 2e-58
gi|48103705|ref|XP_395626.1| similar to ENSANGP00000018090 [Apis... 228 2e-58
gi|18088446|gb|AAH20744.1| Aldo-keto reductase family 1, member ... 228 2e-58
gi|9186908|dbj|BAA99542.1| 3alpha-hydroxysteroid dehydrogenase v... 226 4e-58
gi|16797783|gb|AAL27089.1| aldehyde reductase [Coccidioides posa... 226 4e-58
gi|49075034|ref|XP_401608.1| hypothetical protein UM03993.1 [Ust... 226 6e-58
gi|22759579|dbj|BAC10971.1| 3-hydroxyhexobarbital dehydrogenase ... 226 8e-58
gi|1705823|sp|P17516|AKC4_HUMAN Aldo-keto reductase family 1 mem... 226 8e-58
gi|4103055|gb|AAD09330.1| xylose reductase [Pichia guilliermondii] 226 8e-58
gi|556518|dbj|BAA05122.1| 3 alpha-hydroxysteroid/dihydrodiol deh... 226 8e-58
gi|9255883|gb|AAF86345.1| xylose reductase [Candida shehatae] 225 1e-57
gi|24497585|ref|NP_001809.2| aldo-keto reductase family 1, membe... 225 1e-57
gi|20129731|ref|NP_610235.1| CG9436-PA [Drosophila melanogaster]... 224 2e-57
gi|24644950|ref|NP_649757.1| CG2767-PA [Drosophila melanogaster]... 224 2e-57
gi|38637654|tpg|DAA01127.1| TPA: aldo-keto reductase [Dictyostel... 224 2e-57
gi|50424685|ref|XP_460932.1| unnamed protein product [Debaryomyc... 224 2e-57
gi|31201259|ref|XP_309577.1| ENSANGP00000003966 [Anopheles gambi... 224 2e-57
gi|45553081|ref|NP_996068.1| CG10638-PB [Drosophila melanogaster... 224 2e-57
gi|21356425|ref|NP_647840.1| CG10863-PA [Drosophila melanogaster... 224 3e-57
gi|556516|dbj|BAA05121.1| dihydrodiol dehydrogenase isoform DD1 ... 224 3e-57
gi|15208402|dbj|BAB63208.1| 3(20)alpha-hydroxysteroid/dihydrodio... 223 4e-57
gi|401428|sp|P31867|XYL1_PICST NAD(P)H-dependent xylose reductas... 223 4e-57
gi|31197521|ref|XP_307708.1| ENSANGP00000002572 [Anopheles gambi... 223 5e-57
gi|31201263|ref|XP_309579.1| ENSANGP00000023298 [Anopheles gambi... 223 5e-57
gi|31198273|ref|XP_308084.1| ENSANGP00000019780 [Anopheles gambi... 223 6e-57
gi|31205485|ref|XP_311694.1| ENSANGP00000015026 [Anopheles gambi... 223 6e-57
gi|15216337|dbj|BAB63209.2| 3(20)alpha-hydroxysteroid/dihydrodio... 222 1e-56
gi|22218838|pdb|1JEZ|A Chain A, The Structure Of Xylose Reductas... 221 2e-56
gi|4753912|emb|CAB41997.1| 3-dehydroecdysone 3beta-reductase [Sp... 220 3e-56
gi|47212258|emb|CAG06342.1| unnamed protein product [Tetraodon n... 220 4e-56
gi|7229397|gb|AAF42808.1| aldo-keto reductase a [Mus musculus] >... 219 7e-56
gi|34876317|ref|XP_341550.1| similar to protein RAKb [Rattus nor... 219 9e-56
gi|7304877|ref|NP_038805.1| aldo-keto reductase family 1, member... 219 9e-56
gi|15215042|gb|AAH12643.1| Akr1c12 protein [Mus musculus] >gnl|B... 219 9e-56
gi|49093294|ref|XP_408108.1| hypothetical protein AN3971.2 [Aspe... 219 9e-56
gi|38107497|gb|EAA53661.1| hypothetical protein MG07938.4 [Magna... 218 2e-55
gi|19075108|ref|NP_586709.1| ALDOSE REDUCTASE [Encephalitozoon c... 218 2e-55
gi|179987|gb|AAA35658.1| chlordecone reductase 217 3e-55
gi|236058|gb|AAB19918.1| 3 alpha-hydroxysteroid dehydrogenase; 3... 217 4e-55
gi|27805400|sp|Q8VC28|AKCD_MOUSE Aldo-keto reductase family 1 me... 216 5e-55
gi|19924087|ref|NP_612556.1| 3-alpha-hydroxysteroid dehydrogenas... 216 6e-55
gi|2624883|pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hyd... 216 6e-55
gi|12843447|dbj|BAB25986.1| unnamed protein product [Mus musculus] 216 6e-55
gi|18314665|gb|AAH21937.1| Aldo-keto reductase family 1, member ... 216 6e-55
gi|37223063|gb|AAO91803.1| xylose reductase [Candida parapsilosis] 216 8e-55
gi|29835244|gb|AAH51128.1| 4921521F21Rik protein [Mus musculus] 215 1e-54
gi|12836985|dbj|BAB23853.1| unnamed protein product [Mus musculu... 215 1e-54
gi|49097326|ref|XP_410123.1| hypothetical protein AN5986.2 [Aspe... 215 1e-54
gi|741803|prf||2008147A protein RAKb 215 1e-54
gi|11527182|gb|AAG36923.1| prostaglandin F synthase [Ovis aries] 215 1e-54
gi|49087856|ref|XP_405816.1| hypothetical protein AN1679.2 [Aspe... 215 1e-54
gi|24657054|ref|NP_647839.1| CG12766-PA [Drosophila melanogaster... 215 1e-54
gi|38303919|gb|AAH61932.1| MGC68452 protein [Xenopus laevis] 215 1e-54
gi|19527294|ref|NP_598833.1| RIKEN cDNA 9030611N15; aldo-keto re... 214 2e-54
gi|50729298|ref|XP_425500.1| PREDICTED: similar to Aldose reduct... 214 2e-54
gi|38174605|gb|AAH61057.1| Aldo-keto reductase family 1, member ... 214 2e-54
gi|515238|pdb|1RAL| 3-Alpha-Hydroxysteroid Dehydrogenase (E.C.1... 214 2e-54
gi|14279194|gb|AAK58523.1| aldo-keto reductase loopADR [Homo sap... 214 2e-54
gi|7304879|ref|NP_038806.1| aldo-keto reductase family 1, member... 214 3e-54
gi|25396410|pir||B89027 protein T08H10.1 [imported] - Caenorhabd... 213 5e-54
gi|13899261|ref|NP_113624.1| aldo-keto reductase family 1, membe... 213 7e-54
gi|12847100|dbj|BAB27437.1| unnamed protein product [Mus musculus] 213 7e-54
gi|16330994|ref|NP_441722.1| aldehyde reductase [Synechocystis s... 213 7e-54
gi|18404526|ref|NP_565871.1| aldo/keto reductase family protein ... 212 9e-54
gi|42571107|ref|NP_973627.1| aldo/keto reductase family protein ... 212 9e-54
gi|42571105|ref|NP_973626.1| aldo/keto reductase family protein ... 212 9e-54
gi|15488797|gb|AAH13531.1| Aldo-keto reductase family 1, member ... 210 3e-53
gi|48474267|sp|O70473|AKA1_CRIGR Alcohol dehydrogenase [NADP+] (... 210 3e-53
gi|2492803|sp|P78736|XYL1_PACTA NAD(P)H-dependent xylose reducta... 209 6e-53
gi|34876589|ref|XP_225537.2| similar to aldo-keto reductase fami... 209 7e-53
gi|7407095|gb|AAF61912.1| D-xylose reductase [Aspergillus niger] 209 7e-53
gi|13386444|ref|NP_084177.1| aldo-keto reductase family 1, membe... 209 1e-52
gi|33596262|ref|NP_883905.1| probable oxidoreductase [Bordetella... 209 1e-52
gi|33592062|ref|NP_879706.1| probable oxidoreductase [Bordetella... 209 1e-52
gi|50258514|gb|EAL21201.1| hypothetical protein CNBD2580 [Crypto... 208 2e-52
gi|49084778|ref|XP_404560.1| hypothetical protein AN0423.2 [Aspe... 207 4e-52
gi|22261795|sp|P27800|ALDX_SPOSA Aldehyde reductase I (Alcohol d... 207 4e-52
gi|34876593|ref|XP_344627.1| similar to liver regeneration-relat... 207 4e-52
gi|33187771|gb|AAP97739.1| liver regeneration-related protein LR... 206 5e-52
gi|34908284|ref|NP_915489.1| putative aldose reductase [Oryza sa... 206 6e-52
gi|27805398|sp|P82809|AKCD_MESAU Aldo-keto reductase family 1 me... 206 8e-52
gi|30679355|ref|NP_195787.2| aldose reductase, putative [Arabido... 204 3e-51
gi|39581359|emb|CAE69256.1| Hypothetical protein CBG15305 [Caeno... 204 3e-51
gi|19115800|ref|NP_594888.1| probable oxidoreductase (EC 1.-.-.-... 204 3e-51
gi|4539944|gb|AAD22264.1| aldose reductase ALDRXV4 [Xerophyta vi... 203 4e-51
gi|45185581|ref|NP_983297.1| ACL107Cp [Eremothecium gossypii] >g... 203 4e-51
gi|34876585|ref|XP_225541.2| similar to protein RAKd [Rattus nor... 202 7e-51
gi|19113635|ref|NP_596843.1| probable oxidoreductase [Schizosacc... 202 9e-51
gi|17550248|ref|NP_509242.1| aldo-keto reductase family 1 member... 202 9e-51
gi|46116762|ref|XP_384399.1| hypothetical protein FG04223.1 [Gib... 202 1e-50
gi|741805|prf||2008147C protein RAKd 202 1e-50
gi|17902251|gb|AAL47846.1| aldose reductase [Candida boidinii] 201 2e-50
gi|50843567|ref|YP_056794.1| 2,5-diketo-D-gluconic acid reductas... 201 2e-50
gi|50309831|ref|XP_454929.1| XYL1_KLULA [Kluyveromyces lactis] >... 201 2e-50
gi|13386240|ref|NP_081858.1| RIKEN cDNA 4921521F21 [Mus musculus... 200 3e-50
gi|50259992|gb|EAL22655.1| hypothetical protein CNBB1050 [Crypto... 200 4e-50
gi|134153|sp|P28475|S6PD_MALDO NADP-dependent D-sorbitol-6-phosp... 200 4e-50
gi|34876583|ref|XP_344626.1| similar to Aldo-keto reductase fami... 199 8e-50
gi|32406500|ref|XP_323863.1| hypothetical protein [Neurospora cr... 199 8e-50
gi|1835701|gb|AAB97617.1| NADPH-dependent mannose 6-phosphate re... 199 1e-49
gi|45532688|ref|ZP_00183689.1| COG0656: Aldo/keto reductases, re... 199 1e-49
gi|41053022|dbj|BAD07953.1| putative NADPH-dependent mannose 6-p... 198 1e-49
gi|48096390|ref|XP_394676.1| similar to CG2767-PA [Apis mellifera] 198 1e-49
gi|50258017|gb|EAL20711.1| hypothetical protein CNBE0760 [Crypto... 198 1e-49
gi|50546136|ref|XP_500595.1| hypothetical protein [Yarrowia lipo... 198 1e-49
gi|31197515|ref|XP_307705.1| ENSANGP00000018087 [Anopheles gambi... 198 1e-49
gi|50553380|ref|XP_504101.1| hypothetical protein [Yarrowia lipo... 198 2e-49
gi|30022184|ref|NP_833815.1| 2,5-diketo-D-gluconic acid reductas... 198 2e-49
gi|46907056|ref|YP_013445.1| oxidoreductase, aldo/keto reductase... 198 2e-49
gi|50549835|ref|XP_502389.1| hypothetical protein [Yarrowia lipo... 197 2e-49
gi|46365140|ref|ZP_00227652.1| COG0656: Aldo/keto reductases, re... 197 2e-49
gi|47094831|ref|ZP_00232445.1| oxidoreductase, aldo/keto reducta... 197 2e-49
gi|50289743|ref|XP_447303.1| unnamed protein product [Candida gl... 197 3e-49
gi|16799893|ref|NP_470161.1| similar to oxydoreductases [Listeri... 197 3e-49
gi|11250961|pir||T48188 aldose reductase-like protein - Arabidop... 197 3e-49
gi|42783212|ref|NP_980459.1| oxidoreductase, aldo/keto reductase... 197 4e-49
gi|16802865|ref|NP_464350.1| similar to oxydoreductases [Listeri... 196 5e-49
gi|23097990|ref|NP_691456.1| oxidoreductase [Oceanobacillus ihey... 196 5e-49
gi|49067476|ref|XP_398028.1| hypothetical protein UM00413.1 [Ust... 196 6e-49
gi|50547451|ref|XP_501195.1| hypothetical protein [Yarrowia lipo... 196 6e-49
gi|1345830|sp|P02532|CRO_RANTE Rho crystallin 196 6e-49
gi|21402151|ref|NP_658136.1| aldo_ket_red, Aldo/keto reductase f... 196 8e-49
gi|49480331|ref|YP_038158.1| oxidoreductase, aldo/keto reductase... 196 8e-49
gi|16080393|ref|NP_391220.1| yvgN [Bacillus subtilis subsp. subt... 196 8e-49
gi|25283469|pir||JC7632 aldoketoreductase (EC 1.-.-.-) - spinych... 195 1e-48
gi|47222090|emb|CAG12116.1| unnamed protein product [Tetraodon n... 195 1e-48
gi|50304473|ref|XP_452186.1| unnamed protein product [Kluyveromy... 195 1e-48
gi|50548653|ref|XP_501796.1| hypothetical protein [Yarrowia lipo... 194 2e-48
gi|50423817|ref|XP_460493.1| unnamed protein product [Debaryomyc... 194 2e-48
gi|42784252|ref|NP_981499.1| oxidoreductase, aldo/keto reductase... 194 2e-48
gi|21401317|ref|NP_657302.1| aldo_ket_red, Aldo/keto reductase f... 194 2e-48
gi|50545143|ref|XP_500109.1| hypothetical protein [Yarrowia lipo... 194 2e-48
gi|1706132|sp|P17264|CRO_RANCA Rho crystallin 194 2e-48
gi|30023094|ref|NP_834725.1| 2,5-diketo-D-gluconic acid reductas... 194 2e-48
gi|49105361|ref|XP_411330.1| hypothetical protein AN7193.2 [Aspe... 194 2e-48
gi|49481087|ref|YP_039081.1| oxidoreductase, aldo/keto reductase... 193 4e-48
gi|30265108|ref|NP_847485.1| oxidoreductase, aldo/keto reductase... 193 4e-48
gi|39586834|emb|CAE65877.1| Hypothetical protein CBG11027 [Caeno... 193 4e-48
gi|34863389|ref|XP_234023.2| similar to Aldose reductase (AR) (A... 193 5e-48
gi|546833|gb|AAB30820.1| Rho-crystallin [Rana temporaria] 193 5e-48
gi|15226502|ref|NP_179722.1| mannose 6-phosphate reductase (NADP... 192 7e-48
gi|21282394|ref|NP_645482.1| ORFID:MW0665~hypothetical protein, ... 192 9e-48
gi|18479021|gb|AAL73387.1| 3-dehydrecdysone 3b-reductase [Tricho... 192 9e-48
gi|47093895|ref|ZP_00231636.1| oxidoreductase, aldo/keto reducta... 192 9e-48
gi|15226489|ref|NP_179721.1| mannose 6-phosphate reductase (NADP... 192 1e-47
gi|38109962|gb|EAA55753.1| hypothetical protein MG01404.4 [Magna... 192 1e-47
gi|31321885|gb|AAK55762.1| aldose reductase [Magnaporthe grisea]... 192 1e-47
gi|26249577|ref|NP_755617.1| 2,5-diketo-D-gluconic acid reductas... 192 1e-47
gi|32417904|ref|XP_329430.1| hypothetical protein [Neurospora cr... 192 1e-47
gi|31197183|ref|XP_307539.1| ENSANGP00000015335 [Anopheles gambi... 191 2e-47
gi|50550135|ref|XP_502540.1| hypothetical protein [Yarrowia lipo... 191 2e-47
gi|14279174|gb|AAK58518.1| aldo/keto reductase [Trypanosoma cruzi] 191 2e-47
gi|50555387|ref|XP_505102.1| hypothetical protein [Yarrowia lipo... 191 2e-47
gi|41149254|ref|XP_291723.3| similar to protein RAKc [Homo sapiens] 191 2e-47
gi|46441569|gb|EAL00865.1| hypothetical protein CaO19.14050 [Can... 191 2e-47
gi|30679359|ref|NP_850750.1| aldose reductase, putative [Arabido... 191 3e-47
gi|15923693|ref|NP_371227.1| hypothetical protein SAV0703 [Staph... 190 4e-47
gi|30021496|ref|NP_833127.1| 2,5-diketo-D-gluconic acid reductas... 190 4e-47
gi|49482959|ref|YP_040183.1| aldo/keto reductase family protein ... 190 4e-47
gi|46441568|gb|EAL00864.1| hypothetical protein CaO19.14049 [Can... 190 4e-47
gi|24114318|ref|NP_708828.1| orf, conserved hypothetical protein... 190 4e-47
gi|3916039|sp|Q46857|DKGA_ECOLI 2,5-diketo-D-gluconic acid reduc... 190 4e-47
gi|11127591|dbj|BAB17681.1| prostaglandin F synthase [Trypanosom... 190 4e-47
gi|38492451|pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At... 190 4e-47
gi|29247596|gb|EAA39154.1| GLP_302_44328_45269 [Giardia lamblia ... 190 5e-47
gi|6324694|ref|NP_014763.1| Putative NADP(+) coupled glycerol de... 190 5e-47
gi|10334991|gb|AAG15839.2| NADPH-dependent mannose 6-phosphate r... 189 8e-47
gi|21554266|gb|AAM63341.1| putative NADPH dependent mannose 6-ph... 189 8e-47
gi|38704137|ref|NP_311923.2| 2,5-diketo-D-gluconate reductase [E... 189 8e-47
gi|46363174|ref|ZP_00225952.1| COG0656: Aldo/keto reductases, re... 189 8e-47
gi|1363921|pir||JC4280 carbonyl reductase (NADPH2) (EC 1.1.1.184... 189 8e-47
gi|41407005|ref|NP_959841.1| hypothetical protein MAP0907 [Mycob... 189 8e-47
gi|32417236|ref|XP_329096.1| hypothetical protein [Neurospora cr... 189 8e-47
gi|2792295|gb|AAB97005.1| unknown [Fragaria x ananassa] 189 1e-46
gi|50380153|gb|AAT76306.1| aldo-keto reductase [Fragaria x anana... 189 1e-46
gi|29828391|ref|NP_823025.1| putative oxidoreductase [Streptomyc... 188 1e-46
gi|21592829|gb|AAM64779.1| putative NADPH dependent mannose 6-ph... 188 1e-46
gi|2130022|pir||S61421 aldose reductase homolog - wild oat >gnl|... 188 2e-46
gi|47568155|ref|ZP_00238859.1| oxidoreductase, aldo/keto reducta... 188 2e-46
gi|30018454|ref|NP_830085.1| 2,5-diketo-D-gluconic acid reductas... 187 2e-46
gi|21398152|ref|NP_654137.1| aldo_ket_red, Aldo/keto reductase f... 187 2e-46
gi|38048431|gb|AAR10118.1| similar to Drosophila melanogaster CG... 187 2e-46
gi|28394460|gb|AAM66765.1| D-xylose reductase [Hypocrea jecorina] 187 2e-46
gi|2506173|sp|Q02198|MORA_PSEPU Morphine 6-dehydrogenase (Naloxo... 187 2e-46
gi|113595|sp|P23901|ALDR_HORVU Aldose reductase (AR) (Aldehyde r... 187 2e-46
gi|47215491|emb|CAG01599.1| unnamed protein product [Tetraodon n... 187 2e-46
gi|42779297|ref|NP_976544.1| oxidoreductase, aldo/keto reductase... 187 3e-46
gi|49479174|ref|YP_034539.1| aldo/keto reductase family; possibl... 187 3e-46
gi|47567427|ref|ZP_00238139.1| oxidoreductase, aldo/keto reducta... 187 3e-46
gi|22537619|ref|NP_688470.1| oxidoreductase, aldo/keto reductase... 187 3e-46
gi|25011584|ref|NP_735979.1| Unknown [Streptococcus agalactiae N... 187 3e-46
gi|42519632|ref|NP_965562.1| probable reductase [Lactobacillus j... 187 3e-46
gi|728592|emb|CAA88322.1| aldose reductase [Hordeum vulgare] 187 3e-46
gi|47567305|ref|ZP_00238018.1| oxidoreductase, aldo/keto reducta... 187 4e-46
gi|27468374|ref|NP_765011.1| plant metabolite dehydrogenase-like... 187 4e-46
gi|6320576|ref|NP_010656.1| 2-methylbutyraldehyde reductase, may... 187 4e-46
gi|16079957|ref|NP_390783.1| ytbE [Bacillus subtilis subsp. subt... 187 4e-46
gi|38105654|gb|EAA52053.1| hypothetical protein MG03648.4 [Magna... 187 4e-46
gi|15241832|ref|NP_201048.1| aldo/keto reductase family protein ... 186 5e-46
gi|16766465|ref|NP_462080.1| 2,5-diketo-D-gluconate reductase A ... 186 5e-46
gi|45530852|ref|ZP_00181955.1| COG0656: Aldo/keto reductases, re... 186 5e-46
gi|42569711|ref|NP_181313.3| aldo/keto reductase family protein ... 186 5e-46
gi|420840|pir||S30383 morphine 6-dehydrogenase (EC 1.1.1.218) - ... 186 7e-46
gi|22128348|dbj|BAC07250.1| Prostaglandin F2-alpha synthase [Lei... 186 7e-46
gi|102057|pir||A32950 probable aldehyde reductase (EC 1.1.1.-) -... 186 7e-46
gi|1171949|sp|P22045|P100_LEIMA Probable reductase >gnl|BL_ORD_I... 186 7e-46
gi|20137748|sp|P58744|DKGA_SALTI 2,5-diketo-D-gluconic acid redu... 186 7e-46
gi|16588366|gb|AAL26780.1| probable reductase [Leishmania donovani] 186 7e-46
gi|24379292|ref|NP_721247.1| putative reductase [Streptococcus m... 186 7e-46
gi|37527801|ref|NP_931146.1| 2,5-diketo-D-gluconic acid reductas... 186 9e-46
gi|27381367|ref|NP_772896.1| bll6256 [Bradyrhizobium japonicum U... 186 9e-46
gi|46109282|ref|XP_381699.1| hypothetical protein FG01523.1 [Gib... 185 1e-45
gi|40781599|gb|AAR89809.1| reductase 1 [Hydrangea macrophylla] >... 185 1e-45
gi|50417275|ref|XP_457647.1| unnamed protein product [Debaryomyc... 185 1e-45
gi|49086784|ref|XP_405411.1| hypothetical protein AN1274.2 [Aspe... 185 1e-45
gi|45191002|ref|NP_985256.1| AER401Wp [Eremothecium gossypii] >g... 185 1e-45
gi|9884632|dbj|BAB11960.2| glycerol dehydrogenase [Zygosaccharom... 185 1e-45
gi|15614721|ref|NP_243024.1| plant-metabolite dehydrogenase [Bac... 185 1e-45
gi|7510761|pir||T27575 hypothetical protein ZC443.1 - Caenorhabd... 184 2e-45
gi|9857613|dbj|BAB11959.1| glycerol dehydrogenase [Zygosaccharom... 184 2e-45
gi|17566692|ref|NP_506205.1| mannose reductase (5N288) [Caenorha... 184 2e-45
gi|21224853|ref|NP_630632.1| putative oxidoreductase [Streptomyc... 184 3e-45
gi|27467393|ref|NP_764030.1| plant-metabolite dehydrogenases [St... 184 3e-45
gi|48824168|ref|ZP_00285584.1| COG0656: Aldo/keto reductases, re... 184 3e-45
gi|13471810|ref|NP_103377.1| probable oxidoreductase [Mesorhizob... 184 3e-45
gi|24940570|dbj|BAC23127.1| prostaglandin F2alpha synthase [Crit... 184 3e-45
gi|38101484|gb|EAA48439.1| hypothetical protein MG00097.4 [Magna... 183 4e-45
gi|6478216|gb|AAF13742.1| putative NADPH-dependent oxidoreductas... 183 4e-45
gi|21397543|ref|NP_653528.1| aldo_ket_red, Aldo/keto reductase f... 183 4e-45
gi|16120999|ref|NP_404312.1| putative aldo/keto reductase family... 183 6e-45
gi|38233387|ref|NP_939154.1| Putative oxidoreductase [Corynebact... 183 6e-45
gi|6321896|ref|NP_011972.1| Aldose reductase involved in methylg... 183 6e-45
gi|49077330|ref|XP_402537.1| hypothetical protein UM04922.1 [Ust... 183 6e-45
gi|17979639|gb|AAL50338.1| aldo/keto reductase-like protein [Lac... 183 6e-45
gi|48870271|ref|ZP_00322996.1| COG0656: Aldo/keto reductases, re... 182 7e-45
gi|28492983|ref|NP_787144.1| 2,5-diketo-D-gluconic acid reductas... 182 7e-45
gi|16905111|ref|NP_473421.1| aldo-keto reductase family 1, membe... 182 7e-45
gi|50255362|gb|EAL18097.1| hypothetical protein CNBK1180 [Crypto... 182 1e-44
gi|40781598|gb|AAR89808.1| reductase 2 [Hydrangea macrophylla] >... 182 1e-44
gi|28572191|ref|NP_788971.1| 2,5-diketo-D-gluconic acid reductas... 182 1e-44
gi|543632|pir||JQ2253 aldehyde reductase (EC 1.1.1.21), NADPH-de... 182 1e-44
gi|24215871|ref|NP_713352.1| aldehyde reductase [Leptospira inte... 182 1e-44
gi|15616411|ref|NP_244716.1| plant-metabolite dehydrogenase [Bac... 182 1e-44
gi|42519084|ref|NP_965014.1| probable reductase [Lactobacillus j... 182 1e-44
gi|15673856|ref|NP_268031.1| oxidoreductase [Lactococcus lactis ... 182 1e-44
gi|23002687|ref|ZP_00046361.1| COG0656: Aldo/keto reductases, re... 182 1e-44
gi|2792155|emb|CAA11226.1| chalcone reductase [Sesbania rostrata] 182 1e-44
gi|20147510|gb|AAM12529.1| chalcone reductase [Pueraria montana ... 182 1e-44
gi|25027464|ref|NP_737518.1| putative oxidoreductase [Corynebact... 181 2e-44
gi|50289741|ref|XP_447302.1| unnamed protein product [Candida gl... 181 2e-44
gi|32407531|ref|XP_324280.1| hypothetical protein [Neurospora cr... 181 3e-44
gi|25283477|pir||G96623 probable Aldo/keto reductase F23H11.26 [... 181 3e-44
gi|46116388|ref|XP_384212.1| hypothetical protein FG04036.1 [Gib... 181 3e-44
gi|15218958|ref|NP_176203.1| aldo/keto reductase, putative [Arab... 181 3e-44
gi|1215788|dbj|BAA12084.1| polyketide reductase [Glycyrrhiza ech... 180 4e-44
gi|1514979|dbj|BAA13113.1| polyketide reductase (GGPKR1) [Glycyr... 180 4e-44
gi|1514981|dbj|BAA13114.1| polyketide reductase (GGPKR2) [Glycyr... 180 4e-44
gi|23499945|ref|NP_699385.1| oxidoreductase, aldo/keto reductase... 180 4e-44
gi|15672250|ref|NP_266424.1| oxidoreductase [Lactococcus lactis ... 180 4e-44
gi|34921499|sp|Q01213|DTDH_MUCMU 4-dihydromethyl-trisporate dehy... 180 4e-44
gi|49096480|ref|XP_409700.1| hypothetical protein AN5563.2 [Aspe... 180 4e-44
gi|15672315|ref|NP_266489.1| oxidoreductase [Lactococcus lactis ... 180 4e-44
gi|46363432|ref|ZP_00226180.1| COG0656: Aldo/keto reductases, re... 180 5e-44
gi|50410798|ref|XP_456992.1| unnamed protein product [Debaryomyc... 179 6e-44
gi|23100119|ref|NP_693585.1| plant-metabolite dehydrogenase [Oce... 179 6e-44
gi|29375714|ref|NP_814868.1| oxidoreductase, aldo/keto reductase... 179 6e-44
gi|15924778|ref|NP_372312.1| plant metabolite dehydrogenase homo... 179 1e-43
gi|21283455|ref|NP_646543.1| ORFID:MW1726~plant metabolite dehyd... 179 1e-43
gi|17989405|ref|NP_542038.1| 2,5-DIKETO-D-GLUCONIC ACID REDUCTAS... 179 1e-43
gi|25028824|ref|NP_738878.1| putative 2,5-diketo-D-gluconic acid... 179 1e-43
gi|34876320|ref|XP_225544.2| similar to aldo-keto reductase fami... 178 1e-43
gi|46130674|ref|XP_389117.1| hypothetical protein FG08941.1 [Gib... 178 1e-43
gi|50284921|ref|XP_444888.1| unnamed protein product [Candida gl... 178 2e-43
gi|112837|sp|P26690|6DCS_SOYBN NAD(P)H dependent 6'-deoxychalcon... 178 2e-43
gi|45915213|ref|ZP_00193776.2| COG0656: Aldo/keto reductases, re... 177 2e-43
gi|27380360|ref|NP_771889.1| oxidoreductase [Bradyrhizobium japo... 177 2e-43
gi|38639649|ref|NP_943418.1| unknown [Klebsiella pneumoniae] >gn... 177 3e-43
gi|50307065|ref|XP_453511.1| unnamed protein product [Kluyveromy... 177 3e-43
gi|49484030|ref|YP_041254.1| aldo/keto reductase family protein ... 177 4e-43
gi|629623|pir||S48850 chalcone reductase (EC 1.-.-.-) - alfalfa ... 177 4e-43
gi|537298|gb|AAB41556.1| chalcone reductase >gnl|BL_ORD_ID|82326... 177 4e-43
gi|29375231|ref|NP_814384.1| oxidoreductase, aldo/keto reductase... 176 7e-43
gi|19552570|ref|NP_600572.1| aldo/keto reductase [Corynebacteriu... 176 7e-43
gi|15218960|ref|NP_176204.1| aldo/keto reductase, putative [Arab... 176 9e-43
gi|629624|pir||S48851 chalcone reductase (EC 1.-.-.-) - alfalfa ... 176 9e-43
gi|17546219|ref|NP_519621.1| PUTATIVE OXIDOREDUCTASE PROTEIN [Ra... 175 1e-42
gi|23002477|ref|ZP_00046153.1| COG0656: Aldo/keto reductases, re... 175 2e-42
gi|28379285|ref|NP_786177.1| oxidoreductase [Lactobacillus plant... 175 2e-42
gi|23308931|ref|NP_601560.2| aldo/keto reductase [Corynebacteriu... 174 2e-42
gi|41326542|emb|CAF21024.1| 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE... 174 2e-42
gi|28144501|dbj|BAC56099.1| reductase-like protein [Aspergillus ... 174 2e-42
gi|15643767|ref|NP_228815.1| oxidoreductase, aldo/keto reductase... 174 3e-42
gi|38344824|emb|CAD40878.2| OSJNBa0064H22.5 [Oryza sativa (japon... 174 3e-42
gi|31544640|ref|NP_853218.1| ARA1 [Mycoplasma gallisepticum R] >... 174 3e-42
gi|39583912|emb|CAE64002.1| Hypothetical protein CBG08596 [Caeno... 174 3e-42
gi|50119308|ref|YP_048475.1| 2,5-diketo-D-gluconic acid reductas... 174 3e-42
gi|26324550|dbj|BAC26029.1| unnamed protein product [Mus musculus] 173 4e-42
gi|112735|sp|P15339|DKGB_CORSS 2,5-diketo-D-gluconic acid reduct... 173 4e-42
gi|17561298|ref|NP_506322.1| aldo keto reductase family member (... 173 4e-42
gi|50423819|ref|XP_460494.1| unnamed protein product [Debaryomyc... 172 8e-42
gi|4699594|pdb|1A80| Native 2,5-Diketo-D-Gluconic Acid Reductas... 172 1e-41
gi|48870127|ref|ZP_00322856.1| COG0656: Aldo/keto reductases, re... 172 1e-41
gi|16127658|ref|NP_422222.1| oxidoreductase, aldo/keto reductase... 172 1e-41
gi|20137723|sp|P06632|DKGA_CORSC 2,5-diketo-D-gluconic acid redu... 172 1e-41
gi|629622|pir||S48849 chalcone reductase (EC 1.-.-.-) - alfalfa ... 172 1e-41
gi|19746602|ref|NP_607738.1| putative reductase / dehydrogenase ... 172 1e-41
gi|15675551|ref|NP_269725.1| putative reductase / dehydrogenase ... 171 2e-41
gi|29346793|ref|NP_810296.1| oxidoreductase, aldo/keto reductase... 171 2e-41
gi|8572245|gb|AAF77062.1| putative aldo-keto reductase [Trichomo... 171 2e-41
gi|49072208|ref|XP_400393.1| hypothetical protein UM02778.1 [Ust... 171 2e-41
gi|32266970|ref|NP_861002.1| aldo-keto reductase [Helicobacter h... 171 2e-41
gi|49072863|ref|XP_400708.1| hypothetical protein UM03093.1 [Ust... 170 4e-41
gi|49176300|ref|NP_417485.3| 2,5-diketo-D-gluconate reductase A ... 170 5e-41
gi|30064366|ref|NP_838537.1| hypothetical protein S3260 [Shigell... 170 5e-41
gi|537296|gb|AAB41555.1| chalcone reductase >gnl|BL_ORD_ID|26174... 170 5e-41
gi|38344822|emb|CAD40880.2| OSJNBa0064H22.3 [Oryza sativa (japon... 170 5e-41
gi|19310930|gb|AAL86681.1| NADP dependent sorbitol 6-phosphate d... 169 6e-41
gi|42519093|ref|NP_965023.1| probable reductase [Lactobacillus j... 169 6e-41
gi|48837370|ref|ZP_00294365.1| COG0656: Aldo/keto reductases, re... 169 6e-41
gi|31194771|ref|XP_306333.1| ENSANGP00000001964 [Anopheles gambi... 169 8e-41
gi|21911010|ref|NP_665278.1| putative reductase/dehydrogenase, a... 169 1e-40
gi|28379735|ref|NP_786627.1| oxidoreductase [Lactobacillus plant... 169 1e-40
gi|48870339|ref|ZP_00323063.1| COG0656: Aldo/keto reductases, re... 169 1e-40
gi|15803556|ref|NP_289589.1| putative enzyme [Escherichia coli O... 169 1e-40
gi|23024727|ref|ZP_00063925.1| COG0656: Aldo/keto reductases, re... 169 1e-40
gi|6319625|ref|NP_009707.1| Large subunit of NADP+ dependent ara... 169 1e-40
gi|15901328|ref|NP_345932.1| oxidoreductase, aldo/keto reductase... 168 1e-40
gi|46366981|ref|ZP_00229108.1| COG0656: Aldo/keto reductases, re... 168 2e-40
gi|34810626|pdb|1M9H|A Chain A, Corynebacterium 2,5-Dkgr A And P... 168 2e-40
gi|50310415|ref|XP_455227.1| unnamed protein product [Kluyveromy... 168 2e-40
gi|49070158|ref|XP_399368.1| hypothetical protein UM01753.1 [Ust... 167 2e-40
gi|50405033|ref|YP_054125.1| Oxidoreductase, putative [Parameciu... 167 2e-40
gi|32266533|ref|NP_860565.1| conserved hypothetical protein [Hel... 166 5e-40
gi|39592991|emb|CAE62605.1| Hypothetical protein CBG06721 [Caeno... 166 5e-40
gi|15895230|ref|NP_348579.1| Predicted aldo/keto reductase, YTBE... 166 5e-40
gi|46366982|ref|ZP_00229109.1| COG0656: Aldo/keto reductases, re... 166 5e-40
gi|19310928|gb|AAL86680.1| NADP dependent sorbitol 6-phosphate d... 166 7e-40
gi|44971070|gb|AAS49642.1| Gld1 [Trichoderma atroviride] 166 7e-40
gi|49114952|ref|XP_412068.1| hypothetical protein AN7931.2 [Aspe... 166 7e-40
gi|23023463|ref|ZP_00062698.1| COG0656: Aldo/keto reductases, re... 166 9e-40
gi|23465854|ref|NP_696457.1| morphine 6-dehydrogenase [Bifidobac... 166 9e-40
gi|21225630|ref|NP_631409.1| oxidoreductase. [Streptomyces coeli... 166 9e-40
gi|38091329|ref|XP_126090.2| similar to Aldo-keto reductase fami... 166 9e-40
gi|6478210|gb|AAF13739.1| NADPH-dependent codeinone reductase [P... 166 9e-40
>gi|17537075|ref|NP_496924.1| aldo-keto reductase family 1 member
(2O262) [Caenorhabditis elegans]
gi|6425257|emb|CAB60335.1| Hypothetical protein Y39G8B.1b
[Caenorhabditis elegans]
Length = 316
Score = 627 bits (1616), Expect = e-178
Identities = 307/316 (97%), Positives = 307/316 (97%)
Frame = -1
Query: 951 MVQSLKLNSGYSIPAIGLGTWQSKPGEVXXXXXXXXXAGYRHIDCAHVYQNQKEVGEALK 772
MVQSLKLNSGYSIPAIGLGTWQSKPGEV AGYRHIDCAHVYQNQKEVGEALK
Sbjct: 1 MVQSLKLNSGYSIPAIGLGTWQSKPGEVAAAIKTAVAAGYRHIDCAHVYQNQKEVGEALK 60
Query: 771 EILDEGKVKREELFITSKVWNTFHSEAKAHENIDIILSDLQLSYVDLMLIHWPQGYAEGA 592
EILDEGKVKREELFITSKVWNTFHSEAKAHENIDIILSDLQLSYVDLMLIHWPQGYAEGA
Sbjct: 61 EILDEGKVKREELFITSKVWNTFHSEAKAHENIDIILSDLQLSYVDLMLIHWPQGYAEGA 120
Query: 591 ELFPAGENGKMRYSDVDYLETWKAFEAAQKAGKCRSIGLSNFTHSQIQRVWDAAEVKPAC 412
ELFPAGENGKMRYSDVDYLETWKAFEAAQKAGKCRSIGLSNFTHSQIQRVWDAAEVKPAC
Sbjct: 121 ELFPAGENGKMRYSDVDYLETWKAFEAAQKAGKCRSIGLSNFTHSQIQRVWDAAEVKPAC 180
Query: 411 LQVELHPYFTQVKLREFCKEKGIVVVGYSPLGNPGSAFFRKDGDPNVLTNEVVAGIAKAH 232
LQVELHPYFTQVKLREFCKEKGIVVVGYSPLGNPGSAFFRKDGDPNVLTNEVVAGIAKAH
Sbjct: 181 LQVELHPYFTQVKLREFCKEKGIVVVGYSPLGNPGSAFFRKDGDPNVLTNEVVAGIAKAH 240
Query: 231 GKTPAQIILRWFVDSGLSAIPKSVTPQRIIENISVIDFQLSAEEIQAIDGVNRGWRLVDP 52
GKTPAQIILRWFVDSGLSAIPKSVTPQRIIENISVIDFQLSAEEIQAIDGVNRGWRLVDP
Sbjct: 241 GKTPAQIILRWFVDSGLSAIPKSVTPQRIIENISVIDFQLSAEEIQAIDGVNRGWRLVDP 300
Query: 51 SPRDGDHKYFGFNEEF 4
SPRDGDHKYFGFNEEF
Sbjct: 301 SPRDGDHKYFGFNEEF 316