Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y40B1B_3
         (372 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17509957|ref|NP_493363.1| putative nuclear protein, with a co...   154   3e-37
gi|39592455|emb|CAE63532.1| Hypothetical protein CBG08012 [Caeno...   125   2e-28
gi|47219980|emb|CAG11513.1| unnamed protein product [Tetraodon n...    49   2e-05
gi|34861621|ref|XP_215202.2| similar to hypothetical protein MGC...    49   2e-05
gi|26353800|dbj|BAC40530.1| unnamed protein product [Mus musculu...    48   5e-05
gi|38093630|ref|NP_076220.1| similar to human MGC2574 protein [M...    48   5e-05
gi|7670521|dbj|BAA95108.1| unnamed protein product [Mus musculus]      48   5e-05
gi|13129104|ref|NP_077003.1| hypothetical protein MGC2574 [Homo ...    47   7e-05
gi|50763104|ref|XP_422889.1| PREDICTED: similar to DMRT1 isoform...    42   0.003
gi|19920350|ref|NP_608328.1| CG14210-PA [Drosophila melanogaster...    34   0.60
gi|23612627|ref|NP_704188.1| hypothetical protein [Plasmodium fa...    33   1.3
gi|12855683|dbj|BAB30418.1| unnamed protein product [Mus musculus]     33   1.3
gi|28302209|gb|AAH46714.1| TCERG1 protein [Xenopus laevis]             32   3.0
gi|50755234|ref|XP_414665.1| PREDICTED: similar to transcription...    32   3.9
gi|15828596|ref|NP_325956.1| predicted coding region [Mycoplasma...    31   5.1
gi|50419517|ref|XP_458285.1| unnamed protein product [Debaryomyc...    31   5.1
gi|11641058|gb|AAG39434.1| M protein precursor [Streptococcus py...    31   5.1
gi|32416340|ref|XP_328648.1| hypothetical protein [Neurospora cr...    31   5.1
gi|32451942|gb|AAH54660.1| Unknown (protein for IMAGE:5914861) [...    31   5.1
gi|7513275|pir||T08599 probable transcription factor CA150 - hum...    31   6.7
gi|21327715|ref|NP_006697.2| transcription elongation regulator ...    31   6.7
gi|48597006|ref|NP_001001588.1| MYST histone acetyltransferase (...    31   6.7
gi|15225583|ref|NP_178704.1| hypothetical protein [Arabidopsis t...    31   6.7
gi|112598|pir||S19989 hypothetical protein 1005 - evening primro...    31   6.7
gi|401494|sp|P31563|YCF1_OENBE Hypothetical protein ycf1 (ORF 10...    31   6.7
gi|34879270|ref|XP_225983.2| similar to transcription elongation...    30   8.7
gi|32419933|ref|XP_330410.1| hypothetical protein [Neurospora cr...    30   8.7
gi|24659630|gb|AAH39185.1| Tcerg1 protein [Mus musculus]               30   8.7
gi|42781433|ref|NP_978680.1| penicillin-binding protein 1A [Baci...    30   8.7
gi|21400216|ref|NP_656201.1| Transglycosyl, Transglycosylase [Ba...    30   8.7
gi|23509412|ref|NP_702079.1| hypothetical protein [Plasmodium fa...    30   8.7
gi|30020413|ref|NP_832044.1| Multimodular transpeptidase-transgl...    30   8.7
gi|24580865|ref|NP_722705.1| CG31928-PA [Drosophila melanogaster...    30   8.7
gi|42780465|ref|NP_977712.1| conserved hypothetical protein, deg...    30   8.7
gi|23474364|ref|ZP_00129658.1| COG0835: Chemotaxis signal transd...    30   8.7
gi|33944519|ref|XP_340407.1| hypothetical protein Tb927.2.3090 [...    30   8.7
gi|25955618|gb|AAH40284.1| Tcerg1 protein [Mus musculus]               30   8.7
gi|23481341|gb|EAA17648.1| hypothetical protein [Plasmodium yoel...    30   8.7
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu...    30   8.7
gi|9506443|ref|NP_062385.1| transcription elongation regulator 1...    30   8.7
gi|49477628|ref|YP_036449.1| penicillin-binding protein 1A [Baci...    30   8.7
gi|49185194|ref|YP_028446.1| penicillin-binding protein 1A [Baci...    30   8.7
gi|50252787|dbj|BAD29021.1| hypothetical protein [Oryza sativa (...    30   8.7
gi|40716460|gb|AAR88768.1| DMRT1 isoform d [Gallus gallus]             30   8.7


>gi|17509957|ref|NP_493363.1| putative nuclear protein, with a
           coiled coil domain, of bilaterial origin (15.0 kD)
           (1O20) [Caenorhabditis elegans]
 gi|7509736|pir||T26785 hypothetical protein Y40B1B.7 -
           Caenorhabditis elegans
 gi|3880910|emb|CAA21606.1| Hypothetical protein Y40B1B.7
           [Caenorhabditis elegans]
          Length = 123

 Score =  154 bits (390), Expect = 3e-37
 Identities = 85/123 (69%), Positives = 85/123 (69%)
 Frame = -1

Query: 372 MSTGANLLVMNDTCKSNRWWKTKQEKKHSEIKKVKTLKSTWDKKMELKAKKDMVKRVQDN 193
           MSTGANLLVMNDTCKSNRWWKTKQEKKHSEIKKVKTLKSTWDKKMELKAKKDMVKRVQDN
Sbjct: 1   MSTGANLLVMNDTCKSNRWWKTKQEKKHSEIKKVKTLKSTWDKKMELKAKKDMVKRVQDN 60

Query: 192 IXXXXXXXXXXXXXXXXXXXXXRLENERKAEIVXXXXXXXXXXXXXXXXXRSIQMRDTTQ 13
           I                     RLENERKAEIV                 RSIQMRDTTQ
Sbjct: 61  IREKQVQERQEKKERKVEQEKRRLENERKAEIVQKITKIHKLKKTKKRQLRSIQMRDTTQ 120

Query: 12  VTK 4
           VTK
Sbjct: 121 VTK 123




[DB home][top]