Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y41E3_10
(858 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17543344|ref|NP_502816.1| elongation factor 1 (4P803) [Caenor... 474 e-132
gi|39587380|emb|CAE75034.1| Hypothetical protein CBG22942 [Caeno... 198 1e-49
gi|17553634|ref|NP_498737.1| elongation factor 1 (22.7 kD) (3J62... 197 3e-49
gi|39579469|emb|CAE56114.1| Hypothetical protein CBG23720 [Caeno... 195 1e-48
gi|47939938|gb|AAH72139.1| Unknown (protein for MGC:80004) [Xeno... 158 1e-37
gi|232036|sp|P29693|EF1D_XENLA Elongation factor 1-delta (EF-1-d... 158 1e-37
gi|1362677|pir||S57631 translation elongation factor eEF-1 delta... 158 2e-37
gi|45934557|gb|AAS79338.1| elongation factor 1 beta [Aedes aegypti] 151 2e-35
gi|12328436|dbj|BAB21109.1| elongation factor 1 delta [Bombyx mori] 149 6e-35
gi|31211205|ref|XP_314575.1| ENSANGP00000017979 [Anopheles gambi... 147 2e-34
gi|461993|sp|P32192|EF1D_ARTSA Elongation factor 1-delta (EF-1-d... 147 3e-34
gi|49532904|dbj|BAD26687.1| elongation factor 1 beta' [Plutella ... 145 8e-34
gi|119162|sp|P12262|EF1B_ARTSA Elongation factor 1-beta (EF-1-be... 144 2e-33
gi|14043783|gb|AAH07847.1| EEF1D protein [Homo sapiens] >gnl|BL_... 142 1e-32
gi|25453474|ref|NP_115754.2| eukaryotic translation elongation f... 142 1e-32
gi|232030|sp|P29522|EF1B_BOMMO Elongation factor 1-beta' >gnl|BL... 142 1e-32
gi|1085404|pir||S34626 translation elongation factor eEF-1 delta... 142 1e-32
gi|25453472|ref|NP_001951.2| eukaryotic translation elongation f... 142 1e-32
gi|38014351|gb|AAH00678.2| EEF1D protein [Homo sapiens] 142 1e-32
gi|30584927|gb|AAP36729.1| Homo sapiens eukaryotic translation e... 142 1e-32
gi|27662108|ref|XP_216967.1| similar to eukaryotic translation e... 141 2e-32
gi|232034|sp|P30151|EF1B_XENLA Elongation factor 1-beta (EF-1-be... 139 6e-32
gi|47971191|dbj|BAD22537.1| elongation factor 1 beta [Antheraea ... 139 8e-32
gi|10801150|gb|AAG23402.1| elongation factor 1 beta [Dictyosteli... 138 1e-31
gi|50750236|ref|XP_429257.1| PREDICTED: peptide elongation facto... 138 2e-31
gi|12845723|dbj|BAB26870.1| unnamed protein product [Mus musculu... 138 2e-31
gi|12856949|dbj|BAB30841.1| unnamed protein product [Mus musculus] 138 2e-31
gi|15341784|gb|AAH13059.1| Eef1d protein [Mus musculus] 138 2e-31
gi|30585035|gb|AAP36790.1| Homo sapiens eukaryotic translation e... 137 3e-31
gi|13124189|sp|O96827|EF1B_DROME Probable elongation factor 1-be... 137 3e-31
gi|45549259|ref|NP_524808.2| CG6341-PA [Drosophila melanogaster]... 137 3e-31
gi|46048866|ref|NP_990232.1| peptide elongation factor 1-beta [G... 137 3e-31
gi|4503477|ref|NP_001950.1| eukaryotic translation elongation fa... 137 3e-31
gi|28317131|gb|AAD46929.2| LD24492p [Drosophila melanogaster] 137 3e-31
gi|34876714|ref|XP_343581.1| similar to eukaryotic translation e... 137 4e-31
gi|31980922|ref|NP_061266.2| eukaryotic translation elongation f... 137 4e-31
gi|12849707|dbj|BAB28447.1| unnamed protein product [Mus musculus] 137 4e-31
gi|24586721|gb|AAH39635.1| eukaryotic translation elongation fac... 137 4e-31
gi|33416927|gb|AAH55643.1| Unknown (protein for MGC:66406) [Dani... 136 5e-31
gi|50369207|gb|AAH77005.1| Unknown (protein for MGC:89655) [Xeno... 136 5e-31
gi|5902663|gb|AAC13264.2| elongation factor 1-beta homolog [Mus ... 136 5e-31
gi|47224828|emb|CAG06398.1| unnamed protein product [Tetraodon n... 136 7e-31
gi|1706587|sp|P53787|EF1D_RABIT Elongation factor 1-delta (EF-1-... 136 7e-31
gi|1203894|gb|AAA89167.1| elongation factor 1 delta 136 7e-31
gi|12963597|ref|NP_075729.1| eukaryotic translation elongation f... 136 7e-31
gi|3116218|dbj|BAA25924.1| elongation factor 1b [Dictyostelium d... 136 7e-31
gi|461991|sp|P34826|EF1B_RABIT Elongation factor 1-beta (EF-1-be... 136 7e-31
gi|2137027|pir||S62693 translation elongation factor eEF-1 beta ... 136 7e-31
gi|47215292|emb|CAF98101.1| unnamed protein product [Tetraodon n... 135 9e-31
gi|2266755|emb|CAA74624.1| elongation factor-1d [Sphaerechinus g... 135 9e-31
gi|41148136|ref|XP_374526.1| similar to eukaryotic translation e... 135 1e-30
gi|47940399|gb|AAH71464.1| Unknown (protein for MGC:86802) [Dani... 134 2e-30
gi|41053941|ref|NP_956243.1| eukaryotic translation elongation f... 134 2e-30
gi|10436857|dbj|BAB14925.1| unnamed protein product [Homo sapiens] 134 3e-30
gi|42661985|ref|XP_058967.9| similar to Elongation factor 1-delt... 133 6e-30
gi|47214267|emb|CAG01324.1| unnamed protein product [Tetraodon n... 133 6e-30
gi|24583273|ref|NP_723536.1| CG4912-PA [Drosophila melanogaster]... 131 2e-29
gi|19921046|ref|NP_609361.1| CG4912-PB [Drosophila melanogaster]... 131 2e-29
gi|27820011|gb|AAO25038.1| LD01705p [Drosophila melanogaster] 131 2e-29
gi|31208365|ref|XP_313149.1| ENSANGP00000013448 [Anopheles gambi... 129 6e-29
gi|49069030|ref|XP_398804.1| hypothetical protein UM01189.1 [Ust... 129 6e-29
gi|46108252|ref|XP_381184.1| hypothetical protein FG01008.1 [Gib... 127 3e-28
gi|5107465|pdb|1B64| Solution Structure Of The Guanine Nucleoti... 126 5e-28
gi|47215873|emb|CAG12265.1| unnamed protein product [Tetraodon n... 125 1e-27
gi|32410819|ref|XP_325890.1| hypothetical protein [Neurospora cr... 125 1e-27
gi|38092069|ref|XP_109770.2| similar to eukaryotic translation e... 124 2e-27
gi|27764296|emb|CAD60576.1| unnamed protein product [Podospora a... 123 4e-27
gi|4585704|emb|CAB40840.1| elongation factor 1 beta [Oryzias lat... 122 1e-26
gi|50419295|ref|XP_458172.1| unnamed protein product [Debaryomyc... 120 4e-26
gi|33333168|gb|AAQ11745.1| translational elongation factor 1 del... 120 5e-26
gi|28629051|gb|AAO49454.1| elongation factor 1 beta subunit [Lep... 120 5e-26
gi|38104056|gb|EAA50677.1| hypothetical protein MG04436.4 [Magna... 119 6e-26
gi|6319315|ref|NP_009398.1| Translation elongation factor 1 beta... 119 6e-26
gi|416932|sp|P32471|EF1B_YEAST Elongation factor 1-beta (EF-1-be... 119 8e-26
gi|49086520|ref|XP_405299.1| hypothetical protein AN1162.2 [Aspe... 119 1e-25
gi|50882147|ref|NP_910927.2| putative translation elongation fac... 117 4e-25
gi|50287821|ref|XP_446340.1| unnamed protein product [Candida gl... 117 4e-25
gi|45454236|gb|AAS65797.1| translation elongation factor [Balanu... 116 5e-25
gi|48209911|gb|AAT40505.1| putative elongation factor [Solanum d... 116 5e-25
gi|45198521|ref|NP_985550.1| AFR003Cp [Eremothecium gossypii] >g... 116 5e-25
gi|29841129|gb|AAP06142.1| similar to GenBank Accession Number A... 116 7e-25
gi|6015064|sp|P93447|EF1B_PIMBR ELONGATION FACTOR 1-BETA (EF-1-B... 115 2e-24
gi|38232568|gb|AAR15081.1| translational elongation factor 1 sub... 114 2e-24
gi|6166140|sp|Q40680|EF1B_ORYSA ELONGATION FACTOR 1-BETA (EF-1-B... 114 3e-24
gi|3894214|dbj|BAA34598.1| elongation factor 1 beta 2 [Oryza sat... 114 4e-24
gi|11277742|pir||T43285 translation elongation factor eEF-1 beta... 113 5e-24
gi|19075803|ref|NP_588303.1| elongation factor 1 beta [Schizosac... 113 5e-24
gi|2494267|sp|P78590|EF1B_CANAL Elongation factor 1-beta (EF-1-b... 112 8e-24
gi|46438945|gb|EAK98269.1| hypothetical protein CaO19.3838 [Cand... 112 8e-24
gi|42655907|ref|XP_377558.1| similar to elongation factor 1 delt... 112 8e-24
gi|25299531|pir||E86426 probable elongation factor 1-beta [impor... 112 1e-23
gi|50306123|ref|XP_453023.1| unnamed protein product [Kluyveromy... 112 1e-23
gi|30691619|ref|NP_174314.2| elongation factor 1-beta / EF-1-bet... 112 1e-23
gi|14277981|pdb|1IJE|B Chain B, Nucleotide Exchange Intermediate... 112 1e-23
gi|9256878|pdb|1F60|B Chain B, Crystal Structure Of The Yeast El... 112 1e-23
gi|6048571|gb|AAF02297.1| EF-1 [Echinococcus granulosus] 112 1e-23
gi|50259569|gb|EAL22242.1| hypothetical protein CNBC3800 [Crypto... 111 2e-23
gi|15224107|ref|NP_179402.1| elongation factor 1-beta, putative ... 111 2e-23
gi|21593028|gb|AAM64977.1| putative elongation factor beta-1 [A... 111 2e-23
gi|480620|pir||S37103 translation elongation factor eEF-1 beta-A... 111 2e-23
gi|50555620|ref|XP_505218.1| hypothetical protein [Yarrowia lipo... 111 2e-23
gi|7578954|gb|AAF64192.1| EF-1 [Echinococcus granulosus] 111 2e-23
gi|7711024|emb|CAB90214.1| putative elongation factor 1 beta [Ho... 110 3e-23
gi|15239877|ref|NP_196772.1| elongation factor 1B alpha-subunit ... 110 3e-23
gi|27754711|gb|AAO22799.1| putative elongation factor 1B alpha-s... 110 3e-23
gi|232031|sp|P29545|EF1D_ORYSA ELONGATION FACTOR 1-BETA' (EF-1-B... 110 5e-23
gi|2119929|pir||JC4777 translation elongation factor eEF-1 beta ... 108 1e-22
gi|30687350|ref|NP_568375.2| elongation factor 1B alpha-subunit ... 107 3e-22
gi|38047767|gb|AAR09786.1| similar to Drosophila melanogaster eE... 107 3e-22
gi|232033|sp|P29546|EF1D_WHEAT Elongation factor 1-beta' (EF-1-b... 106 6e-22
gi|6015063|sp|O81918|EF1B_BETVU ELONGATION FACTOR 1-BETA (EF-1-B... 106 6e-22
gi|310944|gb|AAA30183.1| elongation factor 106 6e-22
gi|33341656|gb|AAQ15199.1| FP1047 [Homo sapiens] 105 1e-21
gi|38048351|gb|AAR10078.1| similar to Drosophila melanogaster Ef... 103 4e-21
gi|461992|sp|P34827|EF1B_TRYCR 25 KD ELONGATION FACTOR 1-BETA (E... 103 6e-21
gi|12733950|emb|CAC28942.1| translation elongation factor 1-delt... 97 4e-19
gi|232032|sp|P29412|EF1B_PIG Elongation factor 1-beta (EF-1-beta) 93 6e-18
gi|38048507|gb|AAR10156.1| similar to Drosophila melanogaster eE... 91 3e-17
gi|47201195|emb|CAF87981.1| unnamed protein product [Tetraodon n... 90 7e-17
gi|12231300|gb|AAG49034.1| ripening regulated protein DDTFR10 [L... 88 2e-16
gi|2350976|dbj|BAA22014.1| elongation factor 1 beta [Entamoeba h... 86 1e-15
gi|48096918|ref|XP_394807.1| similar to CG13298-PA [Apis mellifera] 85 2e-15
gi|31208367|ref|XP_313150.1| ENSANGP00000025017 [Anopheles gambi... 82 2e-14
gi|29246187|gb|EAA37794.1| GLP_549_31237_30575 [Giardia lamblia ... 79 1e-13
gi|23957766|ref|NP_473308.2| elongation factor 1 (EF-1); putativ... 73 9e-12
gi|627709|pir||A61442 translation elongation factor eEF-1 beta c... 71 3e-11
gi|32816838|gb|AAO61467.1| translation elongation factor 1 beta ... 68 2e-10
gi|34862605|ref|XP_342044.1| similar to Ac2-067 [Rattus norvegic... 66 8e-10
gi|1084456|pir||JC4144 translation elongation factor eEF-1 beta'... 66 1e-09
gi|46227719|gb|EAK88639.1| putative translation elongation facto... 64 5e-09
gi|31208369|ref|XP_313151.1| ENSANGP00000022899 [Anopheles gambi... 64 5e-09
gi|32816840|gb|AAO61468.1| translation elongation factor 1 beta ... 62 2e-08
gi|4929319|gb|AAD33950.1| translation elongation factor 1-delta ... 59 2e-07
gi|461073|gb|AAB29234.1| elongation factor 1 beta, EF-1 beta {in... 49 1e-04
gi|23613651|ref|NP_704672.1| EF-1B [Plasmodium falciparum 3D7] >... 47 4e-04
gi|11498182|ref|NP_069408.1| translation elongation factor EF-1,... 42 0.017
gi|14601572|ref|NP_148112.1| hypothetical protein APE1708 [Aerop... 37 0.42
gi|50547419|ref|XP_501179.1| hypothetical protein [Yarrowia lipo... 37 0.55
gi|9634042|ref|NP_052116.1| internal virion protein D [Bacteriop... 36 0.94
gi|20799602|gb|AAM28564.1| glyceraldehyde-3-phosphate dehydrogen... 35 2.1
gi|23482301|gb|EAA18321.1| translation elongation factor 1 beta-... 35 2.1
gi|6321196|ref|NP_011273.1| Karyopherin, responsible for nuclear... 34 4.7
gi|20178591|ref|NP_620029.1| hypothetical protein [Peanut clump ... 34 4.7
gi|50120047|ref|YP_049214.1| exonuclease [Erwinia carotovora sub... 33 6.1
gi|20799590|gb|AAM28558.1| glyceraldehyde-3-phosphate dehydrogen... 33 6.1
gi|7514815|pir||G72153 E1L protein - variola minor virus (strain... 33 6.1
gi|18033717|gb|AAL57222.1| Aer-like protein [Burkholderia sp. (G... 33 6.1
gi|24660036|ref|NP_648111.1| CG8583-PA [Drosophila melanogaster]... 33 8.0
gi|41718672|ref|ZP_00147646.1| COG2092: Translation elongation f... 33 8.0
gi|46134205|ref|XP_389418.1| predicted protein [Gibberella zeae ... 33 8.0
gi|17565382|ref|NP_503525.1| inversin (5C377) [Caenorhabditis el... 33 8.0
gi|50744526|ref|XP_419763.1| PREDICTED: similar to chromosome 6 ... 33 8.0
gi|47229599|emb|CAG06795.1| unnamed protein product [Tetraodon n... 33 8.0
>gi|17543344|ref|NP_502816.1| elongation factor 1 (4P803)
[Caenorhabditis elegans]
gi|6580281|emb|CAB63360.1| Hypothetical protein Y41E3.10
[Caenorhabditis elegans]
Length = 285
Score = 474 bits (1220), Expect = e-132
Identities = 244/285 (85%), Positives = 244/285 (85%)
Frame = +1
Query: 1 MEIHSAWVSPRRVACEEILGKTMSVEGLLSEVKHFNAHHLDAALGEQLFYGGKRVFSDVK 180
MEIHSAWVSPRRVACEEILGKTMSVEGLLSEVKHFNAHHLDAALGEQLFYGGKRVFSDVK
Sbjct: 1 MEIHSAWVSPRRVACEEILGKTMSVEGLLSEVKHFNAHHLDAALGEQLFYGGKRVFSDVK 60
Query: 181 PGTSSGGDHGCKGGKSELKGAIHNAKHAADKALNKEGGEDVSKLREEHSALAKKVDDLAS 360
PGTSSGGDHGCKGGKSELKGAIHNAKHAADKALNKEGGEDVSKLREEHSALAKKVDDLAS
Sbjct: 61 PGTSSGGDHGCKGGKSELKGAIHNAKHAADKALNKEGGEDVSKLREEHSALAKKVDDLAS 120
Query: 361 LVAELQLQLSTLRQGQTSSVXXXXXXXXXXXXXXXGDDDFDLFGSXXXXXXXXXXXXXXX 540
LVAELQLQLSTLRQGQTSSV GDDDFDLFGS
Sbjct: 121 LVAELQLQLSTLRQGQTSSVAAPAAAPAAAKEEAAGDDDFDLFGSEDEEEDEEKKKVVEE 180
Query: 541 RLXXXXXXXXXXXGPIAKSSVILDVKPWDDETDLGEMEKLVRSIEMDGLVWGGAKLIPIG 720
RL GPIAKSSVILDVKPWDDETDLGEMEKLVRSIEMDGLVWGGAKLIPIG
Sbjct: 181 RLAAYAAKKATKAGPIAKSSVILDVKPWDDETDLGEMEKLVRSIEMDGLVWGGAKLIPIG 240
Query: 721 YGIKKLQIITVIEDLKVSVDDLIEKITGDFEDHVQSVDIVAFNKI 855
YGIKKLQIITVIEDLKVSVDDLIEKITGDFEDHVQSVDIVAFNKI
Sbjct: 241 YGIKKLQIITVIEDLKVSVDDLIEKITGDFEDHVQSVDIVAFNKI 285