Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y41E3_10
         (858 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17543344|ref|NP_502816.1| elongation factor 1 (4P803) [Caenor...   474   e-132
gi|39587380|emb|CAE75034.1| Hypothetical protein CBG22942 [Caeno...   198   1e-49
gi|17553634|ref|NP_498737.1| elongation factor 1 (22.7 kD) (3J62...   197   3e-49
gi|39579469|emb|CAE56114.1| Hypothetical protein CBG23720 [Caeno...   195   1e-48
gi|47939938|gb|AAH72139.1| Unknown (protein for MGC:80004) [Xeno...   158   1e-37
gi|232036|sp|P29693|EF1D_XENLA Elongation factor 1-delta (EF-1-d...   158   1e-37
gi|1362677|pir||S57631 translation elongation factor eEF-1 delta...   158   2e-37
gi|45934557|gb|AAS79338.1| elongation factor 1 beta [Aedes aegypti]   151   2e-35
gi|12328436|dbj|BAB21109.1| elongation factor 1 delta [Bombyx mori]   149   6e-35
gi|31211205|ref|XP_314575.1| ENSANGP00000017979 [Anopheles gambi...   147   2e-34
gi|461993|sp|P32192|EF1D_ARTSA Elongation factor 1-delta (EF-1-d...   147   3e-34
gi|49532904|dbj|BAD26687.1| elongation factor 1 beta' [Plutella ...   145   8e-34
gi|119162|sp|P12262|EF1B_ARTSA Elongation factor 1-beta (EF-1-be...   144   2e-33
gi|14043783|gb|AAH07847.1| EEF1D protein [Homo sapiens] >gnl|BL_...   142   1e-32
gi|25453474|ref|NP_115754.2| eukaryotic translation elongation f...   142   1e-32
gi|232030|sp|P29522|EF1B_BOMMO Elongation factor 1-beta' >gnl|BL...   142   1e-32
gi|1085404|pir||S34626 translation elongation factor eEF-1 delta...   142   1e-32
gi|25453472|ref|NP_001951.2| eukaryotic translation elongation f...   142   1e-32
gi|38014351|gb|AAH00678.2| EEF1D protein [Homo sapiens]               142   1e-32
gi|30584927|gb|AAP36729.1| Homo sapiens eukaryotic translation e...   142   1e-32
gi|27662108|ref|XP_216967.1| similar to eukaryotic translation e...   141   2e-32
gi|232034|sp|P30151|EF1B_XENLA Elongation factor 1-beta (EF-1-be...   139   6e-32
gi|47971191|dbj|BAD22537.1| elongation factor 1 beta [Antheraea ...   139   8e-32
gi|10801150|gb|AAG23402.1| elongation factor 1 beta [Dictyosteli...   138   1e-31
gi|50750236|ref|XP_429257.1| PREDICTED: peptide elongation facto...   138   2e-31
gi|12845723|dbj|BAB26870.1| unnamed protein product [Mus musculu...   138   2e-31
gi|12856949|dbj|BAB30841.1| unnamed protein product [Mus musculus]    138   2e-31
gi|15341784|gb|AAH13059.1| Eef1d protein [Mus musculus]               138   2e-31
gi|30585035|gb|AAP36790.1| Homo sapiens eukaryotic translation e...   137   3e-31
gi|13124189|sp|O96827|EF1B_DROME Probable elongation factor 1-be...   137   3e-31
gi|45549259|ref|NP_524808.2| CG6341-PA [Drosophila melanogaster]...   137   3e-31
gi|46048866|ref|NP_990232.1| peptide elongation factor 1-beta [G...   137   3e-31
gi|4503477|ref|NP_001950.1| eukaryotic translation elongation fa...   137   3e-31
gi|28317131|gb|AAD46929.2| LD24492p [Drosophila melanogaster]         137   3e-31
gi|34876714|ref|XP_343581.1| similar to eukaryotic translation e...   137   4e-31
gi|31980922|ref|NP_061266.2| eukaryotic translation elongation f...   137   4e-31
gi|12849707|dbj|BAB28447.1| unnamed protein product [Mus musculus]    137   4e-31
gi|24586721|gb|AAH39635.1| eukaryotic translation elongation fac...   137   4e-31
gi|33416927|gb|AAH55643.1| Unknown (protein for MGC:66406) [Dani...   136   5e-31
gi|50369207|gb|AAH77005.1| Unknown (protein for MGC:89655) [Xeno...   136   5e-31
gi|5902663|gb|AAC13264.2| elongation factor 1-beta homolog [Mus ...   136   5e-31
gi|47224828|emb|CAG06398.1| unnamed protein product [Tetraodon n...   136   7e-31
gi|1706587|sp|P53787|EF1D_RABIT Elongation factor 1-delta (EF-1-...   136   7e-31
gi|1203894|gb|AAA89167.1| elongation factor 1 delta                   136   7e-31
gi|12963597|ref|NP_075729.1| eukaryotic translation elongation f...   136   7e-31
gi|3116218|dbj|BAA25924.1| elongation factor 1b [Dictyostelium d...   136   7e-31
gi|461991|sp|P34826|EF1B_RABIT Elongation factor 1-beta (EF-1-be...   136   7e-31
gi|2137027|pir||S62693 translation elongation factor eEF-1 beta ...   136   7e-31
gi|47215292|emb|CAF98101.1| unnamed protein product [Tetraodon n...   135   9e-31
gi|2266755|emb|CAA74624.1| elongation factor-1d [Sphaerechinus g...   135   9e-31
gi|41148136|ref|XP_374526.1| similar to eukaryotic translation e...   135   1e-30
gi|47940399|gb|AAH71464.1| Unknown (protein for MGC:86802) [Dani...   134   2e-30
gi|41053941|ref|NP_956243.1| eukaryotic translation elongation f...   134   2e-30
gi|10436857|dbj|BAB14925.1| unnamed protein product [Homo sapiens]    134   3e-30
gi|42661985|ref|XP_058967.9| similar to Elongation factor 1-delt...   133   6e-30
gi|47214267|emb|CAG01324.1| unnamed protein product [Tetraodon n...   133   6e-30
gi|24583273|ref|NP_723536.1| CG4912-PA [Drosophila melanogaster]...   131   2e-29
gi|19921046|ref|NP_609361.1| CG4912-PB [Drosophila melanogaster]...   131   2e-29
gi|27820011|gb|AAO25038.1| LD01705p [Drosophila melanogaster]         131   2e-29
gi|31208365|ref|XP_313149.1| ENSANGP00000013448 [Anopheles gambi...   129   6e-29
gi|49069030|ref|XP_398804.1| hypothetical protein UM01189.1 [Ust...   129   6e-29
gi|46108252|ref|XP_381184.1| hypothetical protein FG01008.1 [Gib...   127   3e-28
gi|5107465|pdb|1B64|  Solution Structure Of The Guanine Nucleoti...   126   5e-28
gi|47215873|emb|CAG12265.1| unnamed protein product [Tetraodon n...   125   1e-27
gi|32410819|ref|XP_325890.1| hypothetical protein [Neurospora cr...   125   1e-27
gi|38092069|ref|XP_109770.2| similar to eukaryotic translation e...   124   2e-27
gi|27764296|emb|CAD60576.1| unnamed protein product [Podospora a...   123   4e-27
gi|4585704|emb|CAB40840.1| elongation factor 1 beta [Oryzias lat...   122   1e-26
gi|50419295|ref|XP_458172.1| unnamed protein product [Debaryomyc...   120   4e-26
gi|33333168|gb|AAQ11745.1| translational elongation factor 1 del...   120   5e-26
gi|28629051|gb|AAO49454.1| elongation factor 1 beta subunit [Lep...   120   5e-26
gi|38104056|gb|EAA50677.1| hypothetical protein MG04436.4 [Magna...   119   6e-26
gi|6319315|ref|NP_009398.1| Translation elongation factor 1 beta...   119   6e-26
gi|416932|sp|P32471|EF1B_YEAST Elongation factor 1-beta (EF-1-be...   119   8e-26
gi|49086520|ref|XP_405299.1| hypothetical protein AN1162.2 [Aspe...   119   1e-25
gi|50882147|ref|NP_910927.2| putative translation elongation fac...   117   4e-25
gi|50287821|ref|XP_446340.1| unnamed protein product [Candida gl...   117   4e-25
gi|45454236|gb|AAS65797.1| translation elongation factor [Balanu...   116   5e-25
gi|48209911|gb|AAT40505.1| putative elongation factor [Solanum d...   116   5e-25
gi|45198521|ref|NP_985550.1| AFR003Cp [Eremothecium gossypii] >g...   116   5e-25
gi|29841129|gb|AAP06142.1| similar to GenBank Accession Number A...   116   7e-25
gi|6015064|sp|P93447|EF1B_PIMBR ELONGATION FACTOR 1-BETA (EF-1-B...   115   2e-24
gi|38232568|gb|AAR15081.1| translational elongation factor 1 sub...   114   2e-24
gi|6166140|sp|Q40680|EF1B_ORYSA ELONGATION FACTOR 1-BETA (EF-1-B...   114   3e-24
gi|3894214|dbj|BAA34598.1| elongation factor 1 beta 2 [Oryza sat...   114   4e-24
gi|11277742|pir||T43285 translation elongation factor eEF-1 beta...   113   5e-24
gi|19075803|ref|NP_588303.1| elongation factor 1 beta [Schizosac...   113   5e-24
gi|2494267|sp|P78590|EF1B_CANAL Elongation factor 1-beta (EF-1-b...   112   8e-24
gi|46438945|gb|EAK98269.1| hypothetical protein CaO19.3838 [Cand...   112   8e-24
gi|42655907|ref|XP_377558.1| similar to elongation factor 1 delt...   112   8e-24
gi|25299531|pir||E86426 probable elongation factor 1-beta [impor...   112   1e-23
gi|50306123|ref|XP_453023.1| unnamed protein product [Kluyveromy...   112   1e-23
gi|30691619|ref|NP_174314.2| elongation factor 1-beta / EF-1-bet...   112   1e-23
gi|14277981|pdb|1IJE|B Chain B, Nucleotide Exchange Intermediate...   112   1e-23
gi|9256878|pdb|1F60|B Chain B, Crystal Structure Of The Yeast El...   112   1e-23
gi|6048571|gb|AAF02297.1| EF-1 [Echinococcus granulosus]              112   1e-23
gi|50259569|gb|EAL22242.1| hypothetical protein CNBC3800 [Crypto...   111   2e-23
gi|15224107|ref|NP_179402.1| elongation factor 1-beta, putative ...   111   2e-23
gi|21593028|gb|AAM64977.1| putative  elongation factor beta-1 [A...   111   2e-23
gi|480620|pir||S37103 translation elongation factor eEF-1 beta-A...   111   2e-23
gi|50555620|ref|XP_505218.1| hypothetical protein [Yarrowia lipo...   111   2e-23
gi|7578954|gb|AAF64192.1| EF-1 [Echinococcus granulosus]              111   2e-23
gi|7711024|emb|CAB90214.1| putative elongation factor 1 beta [Ho...   110   3e-23
gi|15239877|ref|NP_196772.1| elongation factor 1B alpha-subunit ...   110   3e-23
gi|27754711|gb|AAO22799.1| putative elongation factor 1B alpha-s...   110   3e-23
gi|232031|sp|P29545|EF1D_ORYSA ELONGATION FACTOR 1-BETA' (EF-1-B...   110   5e-23
gi|2119929|pir||JC4777 translation elongation factor eEF-1 beta ...   108   1e-22
gi|30687350|ref|NP_568375.2| elongation factor 1B alpha-subunit ...   107   3e-22
gi|38047767|gb|AAR09786.1| similar to Drosophila melanogaster eE...   107   3e-22
gi|232033|sp|P29546|EF1D_WHEAT Elongation factor 1-beta' (EF-1-b...   106   6e-22
gi|6015063|sp|O81918|EF1B_BETVU ELONGATION FACTOR 1-BETA (EF-1-B...   106   6e-22
gi|310944|gb|AAA30183.1| elongation factor                            106   6e-22
gi|33341656|gb|AAQ15199.1| FP1047 [Homo sapiens]                      105   1e-21
gi|38048351|gb|AAR10078.1| similar to Drosophila melanogaster Ef...   103   4e-21
gi|461992|sp|P34827|EF1B_TRYCR 25 KD ELONGATION FACTOR 1-BETA (E...   103   6e-21
gi|12733950|emb|CAC28942.1| translation elongation factor 1-delt...    97   4e-19
gi|232032|sp|P29412|EF1B_PIG Elongation factor 1-beta (EF-1-beta)      93   6e-18
gi|38048507|gb|AAR10156.1| similar to Drosophila melanogaster eE...    91   3e-17
gi|47201195|emb|CAF87981.1| unnamed protein product [Tetraodon n...    90   7e-17
gi|12231300|gb|AAG49034.1| ripening regulated protein DDTFR10 [L...    88   2e-16
gi|2350976|dbj|BAA22014.1| elongation factor 1 beta [Entamoeba h...    86   1e-15
gi|48096918|ref|XP_394807.1| similar to CG13298-PA [Apis mellifera]    85   2e-15
gi|31208367|ref|XP_313150.1| ENSANGP00000025017 [Anopheles gambi...    82   2e-14
gi|29246187|gb|EAA37794.1| GLP_549_31237_30575 [Giardia lamblia ...    79   1e-13
gi|23957766|ref|NP_473308.2| elongation factor 1 (EF-1); putativ...    73   9e-12
gi|627709|pir||A61442 translation elongation factor eEF-1 beta c...    71   3e-11
gi|32816838|gb|AAO61467.1| translation elongation factor 1 beta ...    68   2e-10
gi|34862605|ref|XP_342044.1| similar to Ac2-067 [Rattus norvegic...    66   8e-10
gi|1084456|pir||JC4144 translation elongation factor eEF-1 beta'...    66   1e-09
gi|46227719|gb|EAK88639.1| putative translation elongation facto...    64   5e-09
gi|31208369|ref|XP_313151.1| ENSANGP00000022899 [Anopheles gambi...    64   5e-09
gi|32816840|gb|AAO61468.1| translation elongation factor 1 beta ...    62   2e-08
gi|4929319|gb|AAD33950.1| translation elongation factor 1-delta ...    59   2e-07
gi|461073|gb|AAB29234.1| elongation factor 1 beta, EF-1 beta {in...    49   1e-04
gi|23613651|ref|NP_704672.1| EF-1B [Plasmodium falciparum 3D7] >...    47   4e-04
gi|11498182|ref|NP_069408.1| translation elongation factor EF-1,...    42   0.017
gi|14601572|ref|NP_148112.1| hypothetical protein APE1708 [Aerop...    37   0.42
gi|50547419|ref|XP_501179.1| hypothetical protein [Yarrowia lipo...    37   0.55
gi|9634042|ref|NP_052116.1| internal virion protein D [Bacteriop...    36   0.94
gi|20799602|gb|AAM28564.1| glyceraldehyde-3-phosphate dehydrogen...    35   2.1
gi|23482301|gb|EAA18321.1| translation elongation factor 1 beta-...    35   2.1
gi|6321196|ref|NP_011273.1| Karyopherin, responsible for nuclear...    34   4.7
gi|20178591|ref|NP_620029.1| hypothetical protein [Peanut clump ...    34   4.7
gi|50120047|ref|YP_049214.1| exonuclease [Erwinia carotovora sub...    33   6.1
gi|20799590|gb|AAM28558.1| glyceraldehyde-3-phosphate dehydrogen...    33   6.1
gi|7514815|pir||G72153 E1L protein - variola minor virus (strain...    33   6.1
gi|18033717|gb|AAL57222.1| Aer-like protein [Burkholderia sp. (G...    33   6.1
gi|24660036|ref|NP_648111.1| CG8583-PA [Drosophila melanogaster]...    33   8.0
gi|41718672|ref|ZP_00147646.1| COG2092: Translation elongation f...    33   8.0
gi|46134205|ref|XP_389418.1| predicted protein [Gibberella zeae ...    33   8.0
gi|17565382|ref|NP_503525.1| inversin (5C377) [Caenorhabditis el...    33   8.0
gi|50744526|ref|XP_419763.1| PREDICTED: similar to chromosome 6 ...    33   8.0
gi|47229599|emb|CAG06795.1| unnamed protein product [Tetraodon n...    33   8.0


>gi|17543344|ref|NP_502816.1| elongation factor 1 (4P803)
           [Caenorhabditis elegans]
 gi|6580281|emb|CAB63360.1| Hypothetical protein Y41E3.10
           [Caenorhabditis elegans]
          Length = 285

 Score =  474 bits (1220), Expect = e-132
 Identities = 244/285 (85%), Positives = 244/285 (85%)
 Frame = +1

Query: 1   MEIHSAWVSPRRVACEEILGKTMSVEGLLSEVKHFNAHHLDAALGEQLFYGGKRVFSDVK 180
           MEIHSAWVSPRRVACEEILGKTMSVEGLLSEVKHFNAHHLDAALGEQLFYGGKRVFSDVK
Sbjct: 1   MEIHSAWVSPRRVACEEILGKTMSVEGLLSEVKHFNAHHLDAALGEQLFYGGKRVFSDVK 60

Query: 181 PGTSSGGDHGCKGGKSELKGAIHNAKHAADKALNKEGGEDVSKLREEHSALAKKVDDLAS 360
           PGTSSGGDHGCKGGKSELKGAIHNAKHAADKALNKEGGEDVSKLREEHSALAKKVDDLAS
Sbjct: 61  PGTSSGGDHGCKGGKSELKGAIHNAKHAADKALNKEGGEDVSKLREEHSALAKKVDDLAS 120

Query: 361 LVAELQLQLSTLRQGQTSSVXXXXXXXXXXXXXXXGDDDFDLFGSXXXXXXXXXXXXXXX 540
           LVAELQLQLSTLRQGQTSSV               GDDDFDLFGS
Sbjct: 121 LVAELQLQLSTLRQGQTSSVAAPAAAPAAAKEEAAGDDDFDLFGSEDEEEDEEKKKVVEE 180

Query: 541 RLXXXXXXXXXXXGPIAKSSVILDVKPWDDETDLGEMEKLVRSIEMDGLVWGGAKLIPIG 720
           RL           GPIAKSSVILDVKPWDDETDLGEMEKLVRSIEMDGLVWGGAKLIPIG
Sbjct: 181 RLAAYAAKKATKAGPIAKSSVILDVKPWDDETDLGEMEKLVRSIEMDGLVWGGAKLIPIG 240

Query: 721 YGIKKLQIITVIEDLKVSVDDLIEKITGDFEDHVQSVDIVAFNKI 855
           YGIKKLQIITVIEDLKVSVDDLIEKITGDFEDHVQSVDIVAFNKI
Sbjct: 241 YGIKKLQIITVIEDLKVSVDDLIEKITGDFEDHVQSVDIVAFNKI 285




[DB home][top]