Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y43E12A_2
(954 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17543416|ref|NP_502047.1| cyclin B (36.0 kD) (cyb-2.1) [Caeno... 600 e-170
gi|7509780|pir||T26832 hypothetical protein Y43E12A.1 - Caenorha... 590 e-167
gi|17507963|ref|NP_491297.1| cyclin B (38.6 kD) (cyb-2.2) [Caeno... 552 e-156
gi|17544486|ref|NP_501987.1| cyclin B (40.5 kD) (cyb-1) [Caenorh... 408 e-113
gi|39594991|emb|CAE70859.1| Hypothetical protein CBG17647 [Caeno... 372 e-102
gi|3608418|gb|AAC35952.1| cyclin B [Dreissena polymorpha] 159 7e-38
gi|12313577|emb|CAC24492.1| cyclin B4 [Xenopus laevis] 158 1e-37
gi|47717990|gb|AAH71014.1| LOC398163 protein [Xenopus laevis] 158 1e-37
gi|12313579|emb|CAC24493.1| cyclin B5 [Xenopus laevis] 157 3e-37
gi|3510285|dbj|BAA32562.1| cyclin B1 [Rana japonica] 157 3e-37
gi|116179|sp|P24862|CG2B_PATVU G2/mitotic-specific cyclin B >gnl... 157 3e-37
gi|1705774|sp|P51987|CG2B_CHLVR G2/MITOTIC-SPECIFIC CYCLIN B >gn... 155 1e-36
gi|1705775|sp|P51988|CG2B_HYDAT G2/MITOTIC-SPECIFIC CYCLIN B >gn... 154 3e-36
gi|14327896|ref|NP_114172.1| cyclin B1; G2/mitotic-specific cycl... 153 6e-36
gi|21263448|sp|Q9DG96|CGB2_ORYLU G2/mitotic-specific cyclin B2 >... 152 1e-35
gi|116180|sp|P13952|CG2B_SPISO G2/mitotic-specific cyclin B >gnl... 152 1e-35
gi|47213256|emb|CAF92917.1| unnamed protein product [Tetraodon n... 151 2e-35
gi|116163|sp|P13351|CGB2_XENLA G2/mitotic-specific cyclin B2 >gn... 150 3e-35
gi|21263458|sp|Q9IBG0|CGB2_ORYLA G2/mitotic-specific cyclin B2 >... 150 3e-35
gi|6729192|dbj|BAA89700.1| cyclin B2 [Oryzias latipes] 150 3e-35
gi|25294193|pir||JC7665 cyclin B - starfish (Asterina pectinifer... 150 4e-35
gi|38014678|gb|AAH60466.1| MGC68601 protein [Xenopus laevis] 149 9e-35
gi|21263455|sp|Q9DGA4|CGB1_ORYCU G2/mitotic-specific cyclin B1 >... 149 9e-35
gi|5921732|sp|O93229|CGB2_RANJA G2/mitotic-specific cyclin B2 >g... 148 2e-34
gi|13605768|gb|AAK32876.1| cyclin B2 [Rana dybowskii] 148 2e-34
gi|584912|sp|P37882|CGB1_MESAU G2/mitotic-specific cyclin B1 >gn... 148 2e-34
gi|50752869|ref|XP_413784.1| PREDICTED: similar to cyclin B2 [Ga... 148 2e-34
gi|21263454|sp|Q9DGA3|CGB2_ORYCU G2/mitotic-specific cyclin B2 >... 148 2e-34
gi|2118513|pir||I48316 cyclin B1 - mouse >gnl|BL_ORD_ID|1045669 ... 147 3e-34
gi|28195398|ref|NP_758505.2| cyclin B1; cyclin B1, related seque... 147 3e-34
gi|38156578|gb|AAR12911.1| cyclin B2 [Bufo gargarizans] 147 4e-34
gi|1552713|emb|CAA69278.1| cyclin B [Sphaerechinus granularis] 146 8e-34
gi|584911|sp|Q08301|CGB1_CRILO G2/mitotic-specific cyclin B1 >gn... 146 8e-34
gi|116173|sp|P07818|CG2B_ARBPU G2/mitotic-specific cyclin B >gnl... 145 1e-33
gi|29423697|gb|AAO73601.1| cyclin B [Lytechinus variegatus] 145 2e-33
gi|21263451|sp|Q9DG99|CGB2_ORYJA G2/mitotic-specific cyclin B2 >... 145 2e-33
gi|90411|pir||JH0509 cyclin B - mouse >gnl|BL_ORD_ID|787360 gi|5... 145 2e-33
gi|25282457|ref|NP_741988.1| cyclin B1 [Rattus norvegicus] >gnl|... 144 2e-33
gi|4757930|ref|NP_004692.1| cyclin B2 [Homo sapiens] >gnl|BL_ORD... 143 5e-33
gi|14198371|gb|AAH08247.1| Cyclin B2 [Mus musculus] >gnl|BL_ORD_... 143 6e-33
gi|116177|sp|P15206|CG2B_MARGL G2/mitotic-specific cyclin B >gnl... 143 6e-33
gi|13605766|gb|AAK32875.1| cyclin B1 [Rana dybowskii] 142 1e-32
gi|21263452|sp|Q9DGA0|CGB1_ORYJA G2/mitotic-specific cyclin B1 >... 142 1e-32
gi|3510293|dbj|BAA32566.1| cyclin B1 [Cynops pyrrhogaster] 141 2e-32
gi|28278382|gb|AAH45492.1| Cyclin B1 [Danio rerio] >gnl|BL_ORD_I... 141 2e-32
gi|20373137|ref|NP_571588.1| cyclin B1; etID61116.5 [Danio rerio... 141 2e-32
gi|21263449|sp|Q9DG97|CGB1_ORYLU G2/mitotic-specific cyclin B1 >... 141 2e-32
gi|12850600|dbj|BAB28785.1| unnamed protein product [Mus musculus] 141 2e-32
gi|34864309|ref|XP_343420.1| similar to cyclin B2 [Rattus norveg... 140 3e-32
gi|116158|sp|P13350|CGB1_XENLA G2/mitotic-specific cyclin B1 >gn... 140 3e-32
gi|6680866|ref|NP_031656.1| cyclin B2 [Mus musculus] >gnl|BL_ORD... 140 3e-32
gi|27806267|ref|NP_776689.1| cyclin B2 [Bos taurus] >gnl|BL_ORD_... 140 4e-32
gi|584914|sp|P37883|CGB2_MESAU G2/mitotic-specific cyclin B2 >gn... 140 5e-32
gi|2494008|sp|Q92162|CG2B_CARAU G2/mitotic-specific cyclin B >gn... 139 7e-32
gi|21263459|sp|Q9IBG1|CGB1_ORYLA G2/mitotic-specific cyclin B1 >... 139 7e-32
gi|9082249|gb|AAF82780.1| cyclin B [Carassius auratus] 139 9e-32
gi|9082247|gb|AAF82779.1| cyclin B [Carassius auratus gibelio] 139 1e-31
gi|34852945|ref|XP_220119.2| similar to cyclin B2 [Rattus norveg... 138 2e-31
gi|27735397|gb|AAH41302.1| Ccnb1-prov protein [Xenopus laevis] 137 3e-31
gi|33150658|gb|AAP97207.1| mitotic specific cyclin B2 [Homo sapi... 137 3e-31
gi|1552711|emb|CAA69279.1| cyclin B [Sphaerechinus granularis] 137 3e-31
gi|9502284|gb|AAF88072.1| cyclin [Cicer arietinum] 137 4e-31
gi|2578820|dbj|BAA23156.1| cyclin B [Danio rerio] 137 5e-31
gi|461725|sp|P34800|CG21_ANTMA G2/mitotic-specific cyclin 1 >gnl... 137 5e-31
gi|40786525|ref|NP_955462.1| cyclin B2 [Danio rerio] >gnl|BL_ORD... 137 5e-31
gi|38108912|gb|EAA54855.1| hypothetical protein MG05646.4 [Magna... 137 5e-31
gi|7785|emb|CAA39148.1| cyclin B [Drosophila melanogaster] 135 1e-30
gi|5420274|emb|CAB46641.1| cyclin A1 [Lycopersicon esculentum] 135 1e-30
gi|23955551|gb|AAN40513.1| cyclin B [Oncorhynchus mykiss] 135 1e-30
gi|4185170|gb|AAD08960.1| mitotic cyclin-CYC2 [Paramecium tetrau... 135 2e-30
gi|50405137|ref|YP_054229.1| Mitotic cyclin, CYC2 [Paramecium te... 135 2e-30
gi|45360891|ref|NP_989121.1| cyclin B1 [Xenopus tropicalis] >gnl... 134 2e-30
gi|46108818|ref|XP_381467.1| hypothetical protein FG01291.1 [Gib... 134 2e-30
gi|31212151|ref|XP_315060.1| ENSANGP00000011452 [Anopheles gambi... 134 2e-30
gi|7438494|pir||T02967 cyclin A-type (clone30) - common tobacco ... 134 3e-30
gi|32423039|ref|XP_331957.1| hypothetical protein [Neurospora cr... 134 3e-30
gi|7438493|pir||T02966 cyclin A-type (clone 19) - common tobacco... 133 5e-30
gi|7438495|pir||T03606 cyclin, A-type - common tobacco >gnl|BL_O... 133 5e-30
gi|24658583|ref|NP_726246.1| CG3510-PB [Drosophila melanogaster]... 133 5e-30
gi|1076620|pir||S49904 cyclin - common tobacco 133 5e-30
gi|34909050|ref|NP_915872.1| putative cyclin Ia [Oryza sativa (j... 133 5e-30
gi|24658593|ref|NP_726247.1| CG3510-PC [Drosophila melanogaster]... 133 5e-30
gi|7271222|emb|CAB81558.1| cyclin B1 [Nicotiana tabacum] 133 5e-30
gi|24658567|ref|NP_726244.1| CG3510-PA [Drosophila melanogaster]... 133 5e-30
gi|116175|sp|P20439|CG2B_DROME G2/mitotic-specific cyclin B >gnl... 133 5e-30
gi|1705771|sp|P51986|CG2A_CHLVR G2/mitotic-specific cyclin A >gn... 133 5e-30
gi|31212149|ref|XP_315059.1| ENSANGP00000010772 [Anopheles gambi... 132 9e-30
gi|49092648|ref|XP_407785.1| CG21_EMENI G2/mitotic-specific cycl... 132 9e-30
gi|1665741|dbj|BAA11560.1| cyclin [Adiantum capillus-veneris] 131 2e-29
gi|7438496|pir||T02746 cyclin A-like protein CYCZM2W - maize >gn... 131 3e-29
gi|24415064|emb|CAD55604.1| Cyclin B [Marthasterias glacialis] 130 3e-29
gi|7438516|pir||T09962 cyclin A-type - Madagascar periwinkle >gn... 130 4e-29
gi|12275262|emb|CAC22297.1| cyclin B5 [Silurana tropicalis] 130 6e-29
gi|16975318|pdb|1E9H|B Chain B, Thr 160 Phosphorylated Cdk2 - Hu... 129 7e-29
gi|3510291|dbj|BAA32565.1| cyclin B [Bufo japonicus] 129 1e-28
gi|1942626|pdb|1JST|B Chain B, Phosphorylated Cyclin-Dependent K... 129 1e-28
gi|50514018|pdb|1VYW|B Chain B, Structure Of Cdk2CYCLIN A WITH P... 129 1e-28
gi|4502613|ref|NP_001228.1| cyclin A [Homo sapiens] >gnl|BL_ORD_... 129 1e-28
gi|47115321|emb|CAG28620.1| CCNA2 [Homo sapiens] 129 1e-28
gi|6730496|pdb|1QMZ|B Chain B, Phosphorylated Cdk2-Cyclyin A-Sub... 129 1e-28
gi|1942428|pdb|1FIN|B Chain B, Cyclin A - Cyclin-Dependent Kinas... 129 1e-28
gi|34810055|pdb|1OGU|B Chain B, Structure Of Human Thr160-Phosph... 129 1e-28
gi|461726|sp|P34801|CG22_ANTMA G2/mitotic-specific cyclin 2 >gnl... 129 1e-28
gi|12275259|emb|CAC22296.1| cyclin B4 [Silurana tropicalis] 129 1e-28
gi|15225784|ref|NP_180244.1| cyclin, putative [Arabidopsis thali... 129 1e-28
gi|50405559|ref|XP_456415.1| unnamed protein product [Debaryomyc... 128 2e-28
gi|2130121|pir||C57742 cyclin II - maize >gnl|BL_ORD_ID|643167 g... 128 2e-28
gi|6753308|ref|NP_033958.1| cyclin A2 [Mus musculus] >gnl|BL_ORD... 127 3e-28
gi|26336921|dbj|BAC32144.1| unnamed protein product [Mus musculu... 127 3e-28
gi|481354|pir||S38501 cyclin A2 - mouse >gnl|BL_ORD_ID|736378 gi... 127 3e-28
gi|48686577|gb|AAT46044.1| cyclin A2 variant [Rattus norvegicus] 127 3e-28
gi|116167|sp|P25010|CG2A_DAUCA G2/MITOTIC-SPECIFIC CYCLIN C13-1 ... 127 3e-28
gi|7438486|pir||T03611 cyclin, B-type - common tobacco >gnl|BL_O... 127 3e-28
gi|48686579|gb|AAT46045.1| cyclin A2 variant [Rattus norvegicus] 127 3e-28
gi|7438488|pir||T07676 cyclin b1-type, mitosis-specific - soybea... 127 4e-28
gi|1827726|pdb|1VIN| Bovine Cyclin A3 127 5e-28
gi|34856833|ref|XP_342230.1| cyclin A2 [Rattus norvegicus] 127 5e-28
gi|47550945|ref|NP_999646.1| cyclin A [Strongylocentrotus purpur... 126 6e-28
gi|2570145|dbj|BAA22991.1| cyclin A [Hemicentrotus pulcherrimus] 126 6e-28
gi|15219350|ref|NP_175077.1| cyclin, putative [Arabidopsis thali... 126 6e-28
gi|34904366|ref|NP_913530.1| unnamed protein product [Oryza sati... 126 8e-28
gi|45382585|ref|NP_990575.1| cyclin A [Gallus gallus] >gnl|BL_OR... 126 8e-28
gi|1865641|dbj|BAA12669.1| cyclin B homolog [Bombyx mori] 126 8e-28
gi|49523176|gb|AAH75562.1| Unknown (protein for MGC:89518) [Xeno... 125 1e-27
gi|584909|sp|P37881|CGA2_MESAU Cyclin A2 (Cyclin A) >gnl|BL_ORD_... 125 1e-27
gi|231734|sp|P30274|CGA2_BOVIN Cyclin A2 (Cyclin A) >gnl|BL_ORD_... 125 1e-27
gi|28208266|dbj|BAC56853.1| cyclin A1 [Silene latifolia] 125 1e-27
gi|25012581|gb|AAN71390.1| RE38818p [Drosophila melanogaster] 125 1e-27
gi|1752809|dbj|BAA14010.1| cyclin A [Asterina pectinifera] 125 1e-27
gi|5420276|emb|CAB46642.1| cyclin A2 [Lycopersicon esculentum] 125 1e-27
gi|28278486|gb|AAH45840.1| Ccna2 protein [Danio rerio] 125 2e-27
gi|46249949|gb|AAH68323.1| Ccna2 protein [Danio rerio] 125 2e-27
gi|157157|gb|AAA28435.1| cyclin A 125 2e-27
gi|23308637|ref|NP_694481.1| cyclin A2 [Danio rerio] >gnl|BL_ORD... 125 2e-27
gi|7438513|pir||T02968 cyclin A-type (clone 59) - common tobacco... 124 2e-27
gi|24662966|ref|NP_729756.1| CG5940-PB [Drosophila melanogaster]... 124 2e-27
gi|24662962|ref|NP_524030.2| CG5940-PA [Drosophila melanogaster]... 124 2e-27
gi|320143|pir||JC1390 cyclin A - fruit fly (Drosophila melanogas... 124 2e-27
gi|391659|dbj|BAA01629.1| cyclin A [Drosophila melanogaster] 124 2e-27
gi|1019642|gb|AAA79269.1| cyclin B 124 2e-27
gi|1076445|pir||S53004 mitosis-specific cyclin CYC2 - rape >gnl|... 124 2e-27
gi|50417440|gb|AAH77260.1| LOC397933 protein [Xenopus laevis] 124 3e-27
gi|1345741|sp|P47827|CGA2_XENLA Cyclin A2 >gnl|BL_ORD_ID|299701 ... 124 3e-27
gi|3929290|gb|AAC79857.1| B-type cyclin [Candida albicans] 124 3e-27
gi|116157|sp|P25011|CG21_SOYBN G2/mitotic-specific cyclin S13-6 ... 124 3e-27
gi|46436848|gb|EAK96204.1| hypothetical protein CaO19.7186 [Cand... 124 3e-27
gi|40538955|gb|AAR87212.1| putative A-type cyclin [Oryza sativa ... 124 4e-27
gi|6729108|dbj|BAA89699.1| cyclin B1 [Oryzias latipes] 124 4e-27
gi|4103566|gb|AAD01794.1| cyclin B2 [Paramecium tetraurelia] >gn... 123 5e-27
gi|6093215|emb|CAB58998.1| CYCB1-1 protein [Petunia x hybrida] 123 5e-27
gi|280633|pir||A37350 cyclin B - starfish (Asterina pectinifera)... 123 5e-27
gi|12275256|emb|CAC22295.1| cyclin B2 [Silurana tropicalis] 123 5e-27
gi|7438497|pir||T07675 cyclin a2-type, mitosis-specific - soybea... 123 5e-27
gi|4185164|gb|AAD08957.1| mitotic cyclin-CYC1a [Paramecium tetra... 123 7e-27
gi|7438492|pir||T03609 cyclin, A-type - common tobacco >gnl|BL_O... 123 7e-27
gi|45725019|emb|CAG23923.1| cyclin A protein [Sphaerechinus gran... 123 7e-27
gi|9082245|gb|AAF82778.1| cyclin A2 [Carassius auratus] 122 9e-27
gi|7438507|pir||T09960 mitosis-specific cyclin 1 - red goosefoot... 122 9e-27
gi|2183079|gb|AAB60863.1| cyclin A1 [Homo sapiens] 122 1e-26
gi|23271353|gb|AAH36346.1| Cyclin A1 [Homo sapiens] 122 1e-26
gi|4502611|ref|NP_003905.1| cyclin A1 [Homo sapiens] >gnl|BL_ORD... 122 1e-26
gi|38081576|ref|XP_132481.3| similar to G2/mitotic-specific cycl... 122 2e-26
gi|6680864|ref|NP_031654.1| cyclin A1 [Mus musculus] >gnl|BL_ORD... 121 2e-26
gi|22830757|dbj|BAC15746.1| B1 type cyclin [Daucus carota] 121 2e-26
gi|7438502|pir||T10527 cyclin B1d-ll - yellow lupine >gnl|BL_ORD... 121 3e-26
gi|26345936|dbj|BAC36619.1| unnamed protein product [Mus musculus] 121 3e-26
gi|471308|emb|CAA81232.1| cyclin [Glycine max] 121 3e-26
gi|50730955|ref|XP_417097.1| PREDICTED: similar to Cyclin A1 [Ga... 121 3e-26
gi|19114801|ref|NP_593889.1| g2/mitotic-specific cyclin cig2/cyc... 120 3e-26
gi|3608420|gb|AAC35953.1| cyclin A [Dreissena polymorpha] 120 3e-26
gi|116162|sp|P25012|CG22_SOYBN G2/mitotic-specific cyclin S13-7 ... 120 3e-26
gi|166684|gb|AAA32781.1| cyclin >gnl|BL_ORD_ID|1827263 gi|908816... 120 3e-26
gi|15235573|ref|NP_195465.1| G2/mitotic-specific cyclin (CYC1) /... 120 3e-26
gi|9082243|gb|AAF82777.1| cyclin A2 [Carassius auratus gibelio] 120 3e-26
gi|116170|sp|P24861|CG2A_PATVU G2/mitotic-specific cyclin A >gnl... 120 5e-26
gi|7438485|pir||T03021 mitosis-specific cyclin CYM, B-type - com... 120 5e-26
gi|50080319|gb|AAT69653.1| hypothetical protein [Oryza sativa (j... 120 5e-26
gi|25294191|pir||T52009 B-type cyclin, Cig2 - fission yeast (Sch... 120 6e-26
gi|34903378|ref|NP_913036.1| putative mitosis-specific cyclin 1 ... 120 6e-26
gi|584910|sp|P18063|CG2B_ASTPE G2/mitotic-specific cyclin B 119 1e-25
gi|50289943|ref|XP_447403.1| unnamed protein product [Candida gl... 119 1e-25
gi|4099510|gb|AAD03791.1| cyclin [Paramecium tetraurelia] 119 1e-25
gi|7438505|pir||T04104 B-type cyclin homolog - maize >gnl|BL_ORD... 119 1e-25
gi|15239938|ref|NP_196233.1| cyclin 1b (CYC1b) [Arabidopsis thal... 118 2e-25
gi|45187941|ref|NP_984164.1| ADR068Wp [Eremothecium gossypii] >g... 118 2e-25
gi|2130119|pir||A57742 cyclin Ia - maize 118 2e-25
gi|1835260|emb|CAA99990.1| mitotic cyclin [Sesbania rostrata] 118 2e-25
gi|22330995|ref|NP_187759.2| cyclin, putative (CYC2) [Arabidopsi... 117 3e-25
gi|2130120|pir||B57742 cyclin Ib - maize >gnl|BL_ORD_ID|1043248 ... 117 3e-25
gi|2146728|pir||S65734 mitosis-specific cyclin 1b - Arabidopsis ... 117 3e-25
gi|2960362|emb|CAA12275.1| Cyclin A [Sphaerechinus granularis] 117 3e-25
gi|12322897|gb|AAG51435.1| putative cyclin; 69674-68010 [Arabido... 117 3e-25
gi|6325377|ref|NP_015445.1| role in DNA replication during S pha... 117 3e-25
gi|50547241|ref|XP_501090.1| hypothetical protein [Yarrowia lipo... 117 3e-25
gi|7438506|pir||T09963 mitosis-specific cyclin B-type - Madagasc... 117 4e-25
gi|25294187|pir||A96803 probable mitotic cyclin a2-type [importe... 117 4e-25
gi|22330698|ref|NP_177863.2| cyclin, putative [Arabidopsis thali... 117 4e-25
gi|6320046|ref|NP_010126.1| Involved in mitotic induction and pe... 117 4e-25
gi|416787|sp|P24870|CG23_YEAST G2/mitotic-specific cyclin 3 >gnl... 117 4e-25
gi|516554|gb|AAA20239.1| cyclin IaZm 117 4e-25
gi|12583565|emb|CAC27333.1| putative A-like cyclin [Picea abies] 117 5e-25
gi|6331704|dbj|BAA86629.1| cyclin [Oryza sativa] 117 5e-25
gi|38345935|emb|CAE01925.2| OSJNBb0078D11.10 [Oryza sativa (japo... 117 5e-25
gi|49071828|ref|XP_400203.1| hypothetical protein UM02588.1 [Ust... 116 7e-25
gi|7438514|pir||T07669 cyclin a1-type, mitosis-specific - soybea... 116 7e-25
gi|509425|emb|CAA83460.1| cyclin 3a [Arabidopsis thaliana] 116 7e-25
gi|82796|pir||A34948 cyclin-related cell division control protei... 116 8e-25
gi|19111963|ref|NP_595171.1| g2/mitotic-specific cyclin [Schizos... 116 8e-25
gi|33112020|gb|AAP94020.1| B-type cyclin 2 [Ustilago maydis] 116 8e-25
gi|6323239|ref|NP_013311.1| Involved in mitotic induction; Clb4p... 116 8e-25
gi|7438491|pir||T07672 cyclin a2-type, mitosis-specific - soybea... 115 1e-24
gi|2982281|gb|AAC32126.1| probable G2/mitotic-specific cyclin [P... 115 1e-24
gi|3253101|gb|AAC24244.1| cyclin [Lupinus luteus] >gnl|BL_ORD_ID... 115 1e-24
gi|784946|emb|CAA83277.1| cyclin 3b [Arabidopsis thaliana] 115 1e-24
gi|5420278|emb|CAB46643.1| cyclin A3 [Lycopersicon esculentum] 115 1e-24
gi|2190263|dbj|BAA20412.1| A-type cyclin [Catharanthus roseus] 115 1e-24
gi|7438499|pir||T14916 mitosis-specific cyclin - parsley >gnl|BL... 115 1e-24
gi|3608181|dbj|BAA33154.1| cyclin B [Pisum sativum] 115 2e-24
gi|50305949|ref|XP_452935.1| unnamed protein product [Kluyveromy... 115 2e-24
gi|12275254|emb|CAC22294.1| cyclin B1 [Silurana tropicalis] 115 2e-24
gi|50291319|ref|XP_448092.1| unnamed protein product [Candida gl... 115 2e-24
gi|50427953|ref|XP_462589.1| unnamed protein product [Debaryomyc... 114 2e-24
gi|5420280|emb|CAB46644.1| cyclin B1 [Lycopersicon esculentum] 114 2e-24
gi|3901362|gb|AAC78639.1| cyclin B [Pneumocystis carinii] 114 2e-24
gi|3860081|gb|AAC72972.1| cell division cycle protein Cdc13 [Pne... 114 2e-24
gi|39585116|emb|CAE62767.1| Hypothetical protein CBG06936 [Caeno... 114 2e-24
gi|477103|pir||A48100 B-type cyclin, Cig2 - fission yeast (Schiz... 114 3e-24
gi|22326727|ref|NP_568248.2| cyclin, putative (CYC3b) [Arabidops... 114 3e-24
gi|6434203|emb|CAB60839.1| B-type cyclin [Lycopersicon esculentum] 114 3e-24
gi|46444327|gb|EAL03602.1| hypothetical protein CaO19.9021 [Cand... 114 3e-24
gi|31239457|ref|XP_320142.1| ENSANGP00000011682 [Anopheles gambi... 114 4e-24
gi|45184923|ref|NP_982641.1| AAR100Cp [Eremothecium gossypii] >g... 114 4e-24
gi|22327058|ref|NP_197920.2| cyclin 3a (CYC3a) [Arabidopsis thal... 113 6e-24
gi|7438508|pir||T03025 mitosis-specific cyclin CYS, A-type - com... 113 6e-24
gi|4063736|gb|AAC98445.1| cyclin 3a [Arabidopsis thaliana] 113 6e-24
gi|7438500|pir||T10525 cyclin B1b-ll - yellow lupine >gnl|BL_ORD... 113 6e-24
gi|425705|gb|AAA16138.1| cyclin A 113 7e-24
gi|116171|sp|P04962|CG2A_SPISO G2/mitotic-specific cyclin A >gnl... 113 7e-24
gi|1362054|pir||S56679 mitosis-specific cyclin CycIII - alfalfa ... 113 7e-24
gi|1168893|sp|P46277|CG1B_MEDVA G2/mitotic-specific cyclin 1 (B-... 113 7e-24
gi|50307539|ref|XP_453749.1| unnamed protein product [Kluyveromy... 113 7e-24
gi|47086401|ref|NP_997983.1| cyclin A1 [Danio rerio] >gnl|BL_ORD... 112 9e-24
gi|1076742|pir||S49462 cyclin - rice >gnl|BL_ORD_ID|725423 gi|55... 112 1e-23
gi|15239172|ref|NP_199122.1| cyclin, putative [Arabidopsis thali... 112 2e-23
gi|1345739|sp|P47829|CG21_CANAL G2/MITOTIC-SPECIFIC CYCLIN CYB1 ... 112 2e-23
gi|7438511|pir||T02963 cyclin A-type (clone 105) - common tobacc... 111 2e-23
gi|7438501|pir||T10526 cyclin B1c-ll - yellow lupine >gnl|BL_ORD... 111 2e-23
gi|7242793|emb|CAB77269.1| cyclin A3.1 [Pisum sativum] 111 2e-23
gi|6321545|ref|NP_011622.1| Involved in mitotic induction; Clb1p... 111 3e-23
gi|8953392|emb|CAB96665.1| cyclin 3b [Arabidopsis thaliana] 111 3e-23
gi|50546897|ref|XP_500918.1| hypothetical protein [Yarrowia lipo... 110 4e-23
gi|15218225|ref|NP_173010.1| cyclin, putative [Arabidopsis thali... 110 4e-23
gi|3913236|sp|Q40671|CG2B_ORYSA G2/mitotic-specific cyclin 2 (B-... 110 4e-23
gi|116172|sp|P18606|CGA1_XENLA Cyclin A1 >gnl|BL_ORD_ID|443136 g... 110 4e-23
gi|49257965|gb|AAH74115.1| LOC397885 protein [Xenopus laevis] 110 5e-23
gi|16944477|emb|CAC28649.2| related to cyclin B3 [Neurospora cra... 110 6e-23
gi|32412510|ref|XP_326735.1| related to cyclin B3 [MIPS] [Neuros... 110 6e-23
gi|1168895|sp|P42524|CG2B_DICDI G2/mitotic-specific cyclin B >gn... 109 8e-23
gi|13812157|ref|NP_113284.1| cyclin B [Guillardia theta] >gnl|BL... 109 8e-23
gi|15237067|ref|NP_195287.1| cyclin 2b (CYC2b) [Arabidopsis thal... 109 8e-23
gi|2131136|pir||JC4828 cyclin B - yeast (Candida albicans) 109 8e-23
gi|509423|emb|CAA83276.1| cyclin 2b protein [Arabidopsis thaliana] 109 1e-22
gi|15220120|ref|NP_178153.1| cyclin, putative [Arabidopsis thali... 108 1e-22
gi|30694019|ref|NP_564499.3| cyclin family protein [Arabidopsis ... 108 1e-22
gi|15217987|ref|NP_173485.1| cyclin, putative [Arabidopsis thali... 108 1e-22
gi|48140418|ref|XP_397108.1| similar to CG5814-PA [Apis mellifera] 108 1e-22
gi|25294182|pir||B86339 protein F2D10.10 [imported] - Arabidopsi... 108 1e-22
gi|45382543|ref|NP_990570.1| cyclin B3 [Gallus gallus] >gnl|BL_O... 108 2e-22
gi|49089028|ref|XP_406274.1| hypothetical protein AN2137.2 [Aspe... 108 2e-22
gi|33942087|ref|NP_898836.1| cyclin B3 [Mus musculus] >gnl|BL_OR... 108 2e-22
gi|802010|gb|AAA65989.1| cyclin A 108 2e-22
gi|38111078|gb|EAA56710.1| hypothetical protein MG07065.4 [Magna... 108 2e-22
gi|14719420|ref|NP_149020.1| cyclin B3 isoform 3 [Homo sapiens] ... 107 3e-22
gi|48428108|sp|Q8WWL7|CGB3_HUMAN G2/mitotic-specific cyclin B3 >... 107 3e-22
gi|50255678|gb|EAL18411.1| hypothetical protein CNBJ3340 [Crypto... 107 3e-22
gi|15220147|ref|NP_175156.1| cyclin, putative [Arabidopsis thali... 107 4e-22
gi|33112018|gb|AAP94019.1| B-type cyclin 1 [Ustilago maydis] 107 5e-22
gi|15227875|ref|NP_179353.1| cyclin, putative (CYC2a) [Arabidops... 107 5e-22
gi|728519|emb|CAA83275.1| cyclin 2a protein [Arabidopsis thaliana] 107 5e-22
gi|49074484|ref|XP_401373.1| hypothetical protein UM03758.1 [Ust... 107 5e-22
gi|7438512|pir||T02964 cyclin A-type (clone 13) - common tobacco... 106 7e-22
gi|6325376|ref|NP_015444.1| Involved in mitotic induction; Clb2p... 106 7e-22
gi|5733098|gb|AAD49424.1| cyclin A [Carassius auratus gibelio] 106 7e-22
gi|5420282|emb|CAB46645.1| cyclin B2 [Lycopersicon esculentum] 106 7e-22
gi|231736|sp|P30278|CG2B_MEDSA G2/mitotic-specific cyclin 2 (B-l... 106 9e-22
gi|2494006|sp|Q92161|CGA1_CARAU Cyclin A1 (Cyclin A) >gnl|BL_ORD... 106 9e-22
gi|5733100|gb|AAD49425.1| cyclin A [Carassius auratus] 106 9e-22
gi|34856942|ref|XP_215565.2| similar to Cyclin A1 [Rattus norveg... 106 9e-22
gi|1168896|sp|P46278|CG2B_MEDVA G2/mitotic-specific cyclin 2 (B-... 106 9e-22
gi|2129565|pir||S71192 mitosis-specific cyclin 2 - Arabidopsis t... 105 1e-21
gi|50257819|gb|EAL20520.1| hypothetical protein CNBE4400 [Crypto... 105 1e-21
gi|2130122|pir||D57742 cyclin III - maize >gnl|BL_ORD_ID|814188 ... 105 1e-21
gi|29603432|emb|CAD88195.1| cyclin B3 [Mus musculus] 105 1e-21
gi|439146|emb|CAA51408.1| B-type cyclin [Saccharomyces cerevisiae] 105 1e-21
gi|6321546|ref|NP_011623.1| role in DNA replication during S pha... 105 1e-21
gi|1076444|pir||S53003 mitosis-specific cyclin CYC1 - rape >gnl|... 105 1e-21
gi|25294186|pir||F96790 hypothetical protein F15M4.19 [imported]... 105 2e-21
gi|22330658|ref|NP_177758.2| cyclin, putative [Arabidopsis thali... 105 2e-21
gi|15220145|ref|NP_175155.1| cyclin, putative [Arabidopsis thali... 105 2e-21
gi|50307537|ref|XP_453748.1| unnamed protein product [Kluyveromy... 105 2e-21
gi|46125509|ref|XP_387308.1| hypothetical protein FG07132.1 [Gib... 104 3e-21
gi|1245816|gb|AAB35583.1| cyclin A homolog [Medicago falcata=alf... 104 3e-21
gi|50286371|ref|XP_445614.1| unnamed protein product [Candida gl... 104 3e-21
gi|25294181|pir||F86289 probable cyclin [imported] - Arabidopsis... 104 3e-21
gi|50286369|ref|XP_445613.1| unnamed protein product [Candida gl... 103 4e-21
gi|396499|emb|CAA49894.1| cyclin [Saccharomyces cerevisiae] >gnl... 103 4e-21
gi|45184922|ref|NP_982640.1| AAR099Wp [Eremothecium gossypii] >g... 103 7e-21
gi|47227508|emb|CAG04656.1| unnamed protein product [Tetraodon n... 102 1e-20
gi|5305100|emb|CAB46083.1| cyclin A2 [Medicago sativa] 102 1e-20
gi|42571785|ref|NP_973983.1| cyclin, putative [Arabidopsis thali... 102 1e-20
gi|12313575|emb|CAC24491.1| cyclin B3 [Xenopus laevis] >gnl|BL_O... 102 2e-20
gi|4033971|emb|CAA07237.1| cyclin B3 [Drosophila melanogaster] 101 2e-20
gi|4033981|emb|CAA10059.1| cyclin B3 [Drosophila melanogaster] 101 2e-20
gi|24649824|ref|NP_651303.2| CG5814-PA [Drosophila melanogaster]... 101 2e-20
gi|47213877|emb|CAF93559.1| unnamed protein product [Tetraodon n... 101 3e-20
gi|50344804|ref|NP_001002075.1| zgc:86724 [Danio rerio] >gnl|BL_... 100 4e-20
gi|173351|gb|AAA35288.1| B-type cyclin 100 6e-20
gi|7438498|pir||T09596 cyclin cyc3 - alfalfa >gnl|BL_ORD_ID|8622... 100 8e-20
gi|12644174|sp|P24865|CG21_SCHPO G2/mitotic-specific cyclin cig1... 99 1e-19
gi|31206987|ref|XP_312460.1| ENSANGP00000022140 [Anopheles gambi... 99 2e-19
gi|50294822|ref|XP_449822.1| unnamed protein product [Candida gl... 98 2e-19
gi|47211452|emb|CAG12259.1| unnamed protein product [Tetraodon n... 98 3e-19
gi|19173352|ref|NP_597155.1| G2/MITOTIC SPECIFIC CYCLIN 2 [Encep... 98 3e-19
gi|6031209|gb|AAD11475.2| cyclin [Pisum sativum] 97 4e-19
gi|34933473|ref|XP_228779.2| similar to cyclin B3 [Rattus norveg... 97 7e-19
gi|2129566|pir||S71193 mitosis-specific cyclin 3c - Arabidopsis ... 96 9e-19
gi|22329611|ref|NP_173083.2| cyclin family protein [Arabidopsis ... 96 1e-18
gi|482111|pir||S40740 cyclin A homolog - Caenorhabditis elegans 96 2e-18
gi|29250185|gb|EAA41683.1| GLP_385_43758_42733 [Giardia lamblia ... 96 2e-18
gi|17556947|ref|NP_499018.1| cyclin A, G2/M cyclin (55.5 kD) (cy... 96 2e-18
gi|1588543|prf||2208459A cyclin 96 2e-18
gi|50294820|ref|XP_449821.1| unnamed protein product [Candida gl... 95 3e-18
gi|15419009|gb|AAK81695.1| cyclin A2 [Medicago sativa] 95 3e-18
gi|47227064|emb|CAG00426.1| unnamed protein product [Tetraodon n... 94 3e-18
gi|19075610|ref|NP_588110.1| g2/mitotic-specific cyclin cig1p [S... 94 5e-18
gi|18077579|emb|CAC94916.1| cyclin B3 [Mus musculus] 93 8e-18
gi|47219036|emb|CAG00175.1| unnamed protein product [Tetraodon n... 93 8e-18
gi|26324292|gb|AAN77907.1| putative mitotic B-type cyclin CycB2 ... 93 8e-18
gi|23392955|emb|CAD43046.1| cyclin 6 [Trypanosoma brucei] 93 8e-18
gi|23392953|emb|CAD43045.1| cyclin 6 [Trypanosoma brucei] 93 8e-18
gi|742564|prf||2010269A ORF Ma52 93 1e-17
gi|47214525|emb|CAG04545.1| unnamed protein product [Tetraodon n... 90 7e-17
gi|27881777|gb|AAH43855.1| Ccne2-prov protein [Xenopus laevis] 89 2e-16
gi|18676381|emb|CAD20131.1| cyclin [Leishmania mexicana mexicana] 89 2e-16
gi|29470389|gb|AAM95631.2| cyclin [Leishmania donovani] 88 2e-16
gi|6753312|ref|NP_033960.1| cyclin E2; cyclin E 2 [Mus musculus]... 87 6e-16
gi|32417652|ref|XP_329304.1| hypothetical protein [Neurospora cr... 87 6e-16
gi|34866169|ref|XP_342805.1| similar to cyclin E2 [Rattus norveg... 87 6e-16
gi|6225106|sp|Q9Z238|CGE2_MOUSE G1/S-specific cyclin E2 >gnl|BL_... 87 6e-16
gi|12848285|dbj|BAB27897.1| unnamed protein product [Mus musculus] 87 6e-16
gi|17318567|ref|NP_004693.2| cyclin E2 isoform 3; G1/S-specific ... 87 7e-16
gi|46436206|gb|EAK95573.1| hypothetical protein CaO19.3207 [Cand... 86 9e-16
gi|1168891|sp|P24866|CG11_CANAL G1/S-specific cyclin CLN1 >gnl|B... 86 9e-16
gi|578114|emb|CAA56336.1| G1 cyclin [Candida albicans] 86 9e-16
gi|6573715|gb|AAF17635.1| T23E18.24 [Arabidopsis thaliana] 86 1e-15
gi|7438504|pir||T04106 B-type cyclin homolog (clone CycZme3) - m... 86 2e-15
gi|1076939|pir||S49206 G1 cyclin CLN1 - yeast (Candida albicans) 86 2e-15
gi|27362896|gb|AAN87004.1| cyclin A [Populus alba] 85 2e-15
gi|729106|sp|P39949|CGE1_RAT G1/S-specific cyclin E1 >gnl|BL_ORD... 85 2e-15
gi|18088427|gb|AAH20729.1| CCNE2 protein [Homo sapiens] 85 3e-15
gi|15705141|gb|AAL03941.1| cyclin E [Cricetulus longicaudatus] 85 3e-15
gi|17318565|ref|NP_477097.1| cyclin E2 isoform 1; G1/S-specific ... 85 3e-15
gi|22324555|gb|AAM95610.1| cyclin A-like protein [Nicotiana taba... 84 4e-15
gi|1000731|gb|AAA81647.1| cyclin E 84 5e-15
gi|31657216|gb|AAH53727.1| Cyclin E2 [Mus musculus] 84 5e-15
gi|1778793|gb|AAB72018.1| type B-like cyclin [Zea mays] 84 5e-15
gi|6671698|ref|NP_031659.1| cyclin E1 [Mus musculus] >gnl|BL_ORD... 84 6e-15
gi|6469589|gb|AAF13345.1| cyclin dependent kinase homolog [Eufol... 83 8e-15
gi|46309465|ref|NP_996931.1| Unknown (protein for MGC:77240) [Da... 83 8e-15
gi|38105591|gb|EAA52000.1| hypothetical protein MG03595.4 [Magna... 83 1e-14
gi|17318559|ref|NP_001229.1| cyclin E1 isoform 1; Cyclin E; Cycl... 82 1e-14
gi|576781|gb|AAB60342.1| cyclin F 82 1e-14
gi|20178283|sp|P41002|CG2F_HUMAN G2/mitotic-specific cyclin F >g... 82 1e-14
gi|4502621|ref|NP_001752.1| cyclin F; F-box only protein 1 [Homo... 82 1e-14
gi|50300495|gb|AAT73638.1| 'unknown protein, contains cyclins re... 82 1e-14
gi|17318561|ref|NP_476530.1| cyclin E1 isoform 2; Cyclin E; Cycl... 82 1e-14
gi|18858511|ref|NP_571070.1| cyclin E [Danio rerio] >gnl|BL_ORD_... 82 2e-14
gi|25294195|pir||G86468 protein F12K21.22 [imported] - Arabidops... 82 2e-14
gi|46228335|gb|EAK89234.1| cyclin [Cryptosporidium parvum] 82 2e-14
gi|6136885|dbj|BAA85846.1| cyclin E [Carassius auratus] 82 2e-14
gi|1705768|sp|P49707|CGE1_CHICK G1/S-specific cyclin E1 >gnl|BL_... 82 2e-14
gi|7484645|pir||T14551 cyclin - beet (fragment) >gnl|BL_ORD_ID|8... 82 2e-14
gi|49076982|ref|XP_402406.1| hypothetical protein UM04791.1 [Ust... 82 2e-14
gi|49092942|ref|XP_407932.1| hypothetical protein AN3795.2 [Aspe... 81 3e-14
gi|50548683|ref|XP_501811.1| hypothetical protein [Yarrowia lipo... 81 4e-14
gi|48096894|ref|XP_394802.1| similar to Drosophila cyclin E type... 81 4e-14
gi|18399278|ref|NP_564446.1| cyclin, putative [Arabidopsis thali... 80 5e-14
gi|542564|pir||S41756 cyclin E type I - fruit fly (Drosophila me... 80 7e-14
gi|17136874|ref|NP_476960.1| CG3938-PB [Drosophila melanogaster]... 80 7e-14
gi|16769124|gb|AAL28781.1| LD17578p [Drosophila melanogaster] 80 7e-14
gi|25155316|ref|NP_506825.2| cyclin B (44.8 kD) (cyb-3) [Caenorh... 80 7e-14
gi|17136872|ref|NP_476959.1| CG3938-PA [Drosophila melanogaster]... 80 7e-14
gi|21431754|sp|Q10654|CGB3_CAEEL G2/mitotic-specific cyclin B3 >... 80 7e-14
gi|14530553|emb|CAC42336.1| C. elegans CYB-3 protein (correspond... 80 7e-14
gi|50731722|ref|XP_418342.1| PREDICTED: similar to cyclin E2 iso... 80 7e-14
gi|50254774|gb|EAL17519.1| hypothetical protein CNBM0860 [Crypto... 80 9e-14
gi|1147785|gb|AAA85131.1| cyclin A box 80 9e-14
gi|1314794|gb|AAB01984.1| cyclin B3 79 1e-13
gi|13518057|gb|AAK27418.1| cyclin B1 [Homo sapiens] 79 1e-13
gi|13518059|gb|AAK27419.1| cyclin B1 [Homo sapiens] >gnl|BL_ORD_... 79 1e-13
gi|34869380|ref|XP_221389.2| similar to cyclin B [Rattus norvegi... 79 2e-13
gi|13518072|gb|AAK27425.1| cyclin B1 [Homo sapiens] 79 2e-13
gi|37362766|gb|AAQ91341.1| cyclin B [Plodia interpunctella] 79 2e-13
gi|13518055|gb|AAK27417.1| cyclin B1 [Homo sapiens] 78 3e-13
gi|629513|pir||S45294 cyclin Cyc2 - Arabidopsis thaliana (fragme... 78 3e-13
gi|33416739|gb|AAH56134.1| MGC69175 protein [Xenopus laevis] 78 3e-13
gi|19112590|ref|NP_595798.1| putative g2/mitotic-specific cyclin... 77 4e-13
gi|50756172|ref|XP_415043.1| PREDICTED: similar to G2/mitotic-sp... 77 6e-13
gi|50422457|ref|XP_459795.1| unnamed protein product [Debaryomyc... 77 6e-13
gi|47210143|emb|CAF95182.1| unnamed protein product [Tetraodon n... 77 6e-13
gi|46108118|ref|XP_381117.1| hypothetical protein FG00941.1 [Gib... 77 6e-13
gi|17506305|ref|NP_491941.1| cyclin E, abnormal Eversion of VuLv... 76 1e-12
gi|13518061|gb|AAK27420.1| cyclin B1 [Homo sapiens] 76 1e-12
gi|30025129|gb|AAP13781.1| Cyclin e protein 1, isoform b [Caenor... 76 1e-12
gi|7497136|pir||T30156 hypothetical protein C37A2.4 - Caenorhabd... 76 1e-12
gi|1705770|sp|P50756|CGE1_XENLA G1/S-specific cyclin E1 >gnl|BL_... 76 1e-12
gi|3023476|sp|Q91780|CGE2_XENLA G1/S-specific cyclin E2 (Cyclin ... 76 1e-12
gi|3023468|sp|O42575|CGE3_XENLA G1/S-specific cyclin E3 >gnl|BL_... 75 2e-12
gi|5921729|sp|O15995|CG1E_HEMPU G1/S-specific cyclin E >gnl|BL_O... 75 2e-12
gi|28526977|ref|XP_127523.2| similar to uracil-DNA glycosylase 2... 75 2e-12
gi|12006236|gb|AAG44801.1| cyclin 1 [Cryptoperidiniopsis brodyi]... 75 2e-12
gi|15212482|gb|AAK92014.1| cyclin-dependent kinase regulatory su... 75 2e-12
gi|14210077|gb|AAK56923.1| cyclin A2 [Rattus norvegicus] 75 3e-12
gi|39585305|emb|CAE61627.1| Hypothetical protein CBG05553 [Caeno... 75 3e-12
gi|2129791|pir||S52997 mitosis-specific cyclin CYC1.4 - rape (fr... 75 3e-12
gi|25518478|pir||D86298 hypothetical protein F3O9.13 - Arabidops... 74 4e-12
gi|10441234|gb|AAG16962.1| cyclin [Pleurochrysis carterae] 74 4e-12
gi|2707280|gb|AAB92249.1| cyclin B [Aureococcus anophagefferens] 74 5e-12
gi|34870506|ref|XP_340764.1| similar to cyclin F [Rattus norvegi... 72 1e-11
gi|676861|gb|AAA62317.1| cyclin F 72 1e-11
gi|699512|gb|AAA63152.1| cyclin F 72 1e-11
gi|33112233|sp|Q8MUK3|CG1E_CAEBR G1/S-specific cyclin E >gnl|BL_... 72 1e-11
gi|39595813|emb|CAE67316.1| Hypothetical protein CBG12774 [Caeno... 72 1e-11
gi|21311259|gb|AAM46626.1| cyclin F [Rattus norvegicus] 72 1e-11
gi|16306525|ref|NP_391990.1| cyclin B3 isoform 1 [Homo sapiens] ... 72 2e-11
gi|38482648|gb|AAR21119.1| cyclin III [Zea mays] 72 2e-11
gi|38482650|gb|AAR21120.1| cyclin III [Zea mays] >gnl|BL_ORD_ID|... 72 2e-11
gi|38482674|gb|AAR21132.1| cyclin III [Zea mays] >gnl|BL_ORD_ID|... 72 2e-11
gi|38482708|gb|AAR21149.1| cyclin III [Zea mays] 72 2e-11
gi|38482668|gb|AAR21129.1| cyclin III [Zea mays] >gnl|BL_ORD_ID|... 72 2e-11
gi|38482676|gb|AAR21133.1| cyclin III [Zea mays] >gnl|BL_ORD_ID|... 72 2e-11
gi|38482670|gb|AAR21130.1| cyclin III [Zea mays] >gnl|BL_ORD_ID|... 72 2e-11
gi|38482736|gb|AAR21163.1| cyclin III [Zea mays] >gnl|BL_ORD_ID|... 72 2e-11
gi|38482696|gb|AAR21143.1| cyclin III [Zea mays] >gnl|BL_ORD_ID|... 72 2e-11
gi|38482680|gb|AAR21135.1| cyclin III [Zea mays] >gnl|BL_ORD_ID|... 72 2e-11
gi|38482718|gb|AAR21154.1| cyclin III [Zea mays] 72 2e-11
gi|31560724|ref|NP_031660.2| cyclin F [Mus musculus] >gnl|BL_ORD... 72 2e-11
gi|26349735|dbj|BAC38507.1| unnamed protein product [Mus musculus] 72 2e-11
gi|22902267|gb|AAH37662.1| Cyclin F [Mus musculus] 71 3e-11
gi|31223195|ref|XP_317276.1| ENSANGP00000021921 [Anopheles gambi... 71 4e-11
gi|38482700|gb|AAR21145.1| cyclin III [Zea mays] 71 4e-11
gi|6537173|gb|AAF15556.1| mitotic cyclin-like protein [Sterkiell... 71 4e-11
gi|2707290|gb|AAB92254.1| cyclin [Skeletonema costatum] 71 4e-11
gi|38087057|ref|XP_145725.3| similar to G2/mitotic-specific cycl... 70 7e-11
gi|12006234|gb|AAG44800.1| cyclin 1 [Pfiesteria piscicida] 70 7e-11
gi|1705776|sp|P51944|CG2F_MOUSE G2/mitotic-specific cyclin F >gn... 70 7e-11
gi|10438808|dbj|BAB15351.1| unnamed protein product [Homo sapiens] 70 9e-11
gi|11120345|gb|AAG30853.1| cyclin 2 [Strombidinopsis acuminata] 69 1e-10
gi|47550981|ref|NP_999664.1| cyclin D [Strongylocentrotus purpur... 69 2e-10
gi|47498018|ref|NP_998837.1| hypothetical protein MGC69220 [Xeno... 69 2e-10
gi|25294192|pir||A86339 protein F2D10.8 [imported] - Arabidopsis... 69 2e-10
gi|27362898|gb|AAN87005.1| cyclin B [Populus alba] 69 2e-10
gi|8778596|gb|AAF79604.1| F5M15.8 [Arabidopsis thaliana] 68 3e-10
gi|6537175|gb|AAF15557.1| mitotic cyclin-like protein [Colpoda sp.] 68 3e-10
gi|12232560|gb|AAB92248.2| mitotic cyclin [Dunaliella tertiolecta] 67 5e-10
gi|6537171|gb|AAF15555.1| mitotic cyclin-like protein 2 [Blephar... 67 6e-10
gi|38482652|gb|AAR21121.1| cyclin III [Zea mays] >gnl|BL_ORD_ID|... 67 6e-10
gi|6319277|ref|NP_009360.1| role in cell cycle START; involved i... 66 1e-09
gi|295599|gb|AAA34551.1| short DAF1 product 66 1e-09
gi|50305643|ref|XP_452782.1| unnamed protein product [Kluyveromy... 66 1e-09
gi|37362764|gb|AAQ91340.1| cyclin A [Plodia interpunctella] 66 1e-09
gi|45188257|ref|NP_984480.1| ADR384Wp [Eremothecium gossypii] >g... 66 1e-09
gi|47205717|emb|CAF90866.1| unnamed protein product [Tetraodon n... 66 1e-09
gi|11120343|gb|AAG30852.1| cyclin 1 [Strombidinopsis acuminata] 66 1e-09
gi|1076458|pir||S52996 mitosis-specific cyclin CYC - turnip (fra... 66 1e-09
gi|38482716|gb|AAR21153.1| cyclin III [Zea mays] 66 1e-09
gi|2129792|pir||S52998 mitosis-specific cyclin CYC1.6 - rape (fr... 66 1e-09
gi|47211724|emb|CAF92522.1| unnamed protein product [Tetraodon n... 66 1e-09
gi|1076936|pir||S51613 cyclin homolog CLN2 - yeast (Candida albi... 64 4e-09
gi|1168892|sp|P43062|CG12_CANAL G1/S-SPECIFIC CYCLIN CLN2 >gnl|B... 64 4e-09
gi|2707284|gb|AAB92251.1| cyclin [Isochrysis galbana] 64 5e-09
gi|6537168|gb|AAF15554.1| mitotic cyclin-like protein [Tetrahyme... 64 5e-09
gi|46437300|gb|EAK96649.1| hypothetical protein CaO19.9515 [Cand... 64 7e-09
gi|50422517|ref|XP_459828.1| unnamed protein product [Debaryomyc... 64 7e-09
gi|562186|gb|AAA51658.1| cyclin 64 7e-09
gi|7438517|pir||S53002 mitotic-specific cyclin CYC2.9 - rape (fr... 64 7e-09
gi|50548769|ref|XP_501854.1| hypothetical protein [Yarrowia lipo... 63 9e-09
gi|38482766|gb|AAR21178.1| cyclin III [Zea mays] 62 1e-08
gi|50404873|ref|YP_053965.1| Cyclin, putative [Paramecium tetrau... 62 2e-08
gi|1276895|gb|AAC47016.1| Cyclin D 62 2e-08
gi|17647293|ref|NP_523355.1| CG9096-PA [Drosophila melanogaster]... 62 2e-08
gi|10121610|gb|AAG13285.1| cyclin D [Drosophila melanogaster] 62 2e-08
gi|49257947|gb|AAH74566.1| Unknown (protein for MGC:69515) [Xeno... 61 3e-08
gi|50294904|ref|XP_449863.1| unnamed protein product [Candida gl... 60 6e-08
gi|13096721|pdb|1G3N|C Chain C, Structure Of A P18(Ink4c)-Cdk6-K... 60 6e-08
gi|27694633|gb|AAH43758.1| MGC52909 protein [Xenopus laevis] 60 6e-08
gi|19173226|ref|NP_597029.1| similarity to G2/mitotic specific c... 60 6e-08
gi|2707288|gb|AAB92253.1| cyclin [Prorocentrum minimum] 60 7e-08
gi|32492562|gb|AAP85369.1| Aa1064 [Rattus norvegicus] >gnl|BL_OR... 59 1e-07
gi|34863099|ref|XP_343036.1| Apolipoprotein B [Rattus norvegicus] 59 1e-07
>gi|17543416|ref|NP_502047.1| cyclin B (36.0 kD) (cyb-2.1)
[Caenorhabditis elegans]
gi|14530630|emb|CAA15975.2| Hypothetical protein Y43E12A.1
[Caenorhabditis elegans]
Length = 317
Score = 600 bits (1546), Expect = e-170
Identities = 306/306 (100%), Positives = 306/306 (100%)
Frame = +1
Query: 1 MLRVTTSIRKTTKNAVGPRTNLEEVLNCIAMAEDIYNYLVHHEKKYVLDDSFINGGNVNS 180
MLRVTTSIRKTTKNAVGPRTNLEEVLNCIAMAEDIYNYLVHHEKKYVLDDSFINGGNVNS
Sbjct: 1 MLRVTTSIRKTTKNAVGPRTNLEEVLNCIAMAEDIYNYLVHHEKKYVLDDSFINGGNVNS 60
Query: 181 KMRRILVDWLIQVHLRFHLTPETLHLTIFVLDRIIVKNIVSKAEFQLLGVAALFVASKFE 360
KMRRILVDWLIQVHLRFHLTPETLHLTIFVLDRIIVKNIVSKAEFQLLGVAALFVASKFE
Sbjct: 61 KMRRILVDWLIQVHLRFHLTPETLHLTIFVLDRIIVKNIVSKAEFQLLGVAALFVASKFE 120
Query: 361 DIYLPDILEYEMITDNTFSKKQIMAMEQTILNALNFDLSCPSSLVFLRCISKTLTENDVN 540
DIYLPDILEYEMITDNTFSKKQIMAMEQTILNALNFDLSCPSSLVFLRCISKTLTENDVN
Sbjct: 121 DIYLPDILEYEMITDNTFSKKQIMAMEQTILNALNFDLSCPSSLVFLRCISKTLTENDVN 180
Query: 541 PIDKEAFYYVHNISKCLGELALLDSVMSTVPRSHVASASMIITLNVITVDGINPKTAASM 720
PIDKEAFYYVHNISKCLGELALLDSVMSTVPRSHVASASMIITLNVITVDGINPKTAASM
Sbjct: 181 PIDKEAFYYVHNISKCLGELALLDSVMSTVPRSHVASASMIITLNVITVDGINPKTAASM 240
Query: 721 IRKQLGASKQDIYDAIALLAQVAYKNFRHQKLCAIREKYQSSKFGRVSYLMTDEILEKIH 900
IRKQLGASKQDIYDAIALLAQVAYKNFRHQKLCAIREKYQSSKFGRVSYLMTDEILEKIH
Sbjct: 241 IRKQLGASKQDIYDAIALLAQVAYKNFRHQKLCAIREKYQSSKFGRVSYLMTDEILEKIH 300
Query: 901 RMGRNV 918
RMGRNV
Sbjct: 301 RMGRNV 306