Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y45F10C_4
(1179 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17543462|ref|NP_502641.1| cyclin-like F-box and Protein of un... 798 0.0
gi|17561154|ref|NP_507392.1| cyclin-like F-box and Protein of un... 167 3e-40
gi|17562698|ref|NP_507832.1| predicted CDS, cyclin-like F-box an... 166 1e-39
gi|17542918|ref|NP_500676.1| u6 small nuclear RNA (4F695) [Caeno... 161 2e-38
gi|17561146|ref|NP_507388.1| cyclin-like F-box and Protein of un... 154 3e-36
gi|17558538|ref|NP_507448.1| predicted CDS, cyclin-like F-box an... 150 6e-35
gi|17561150|ref|NP_507390.1| cyclin-like F-box and Protein of un... 146 8e-34
gi|17560982|ref|NP_507061.1| protein of unknown function DUF38 a... 140 8e-32
gi|32565215|ref|NP_493020.2| cyclin-like F-box and Protein of un... 140 8e-32
gi|17565402|ref|NP_507537.1| cyclin-like F-box and Protein of un... 134 4e-30
gi|17561148|ref|NP_507389.1| cyclin-like F-box and Protein of un... 130 8e-29
gi|17565404|ref|NP_507538.1| predicted CDS, cyclin-like F-box an... 129 1e-28
gi|32699248|gb|AAB70969.2| Hypothetical protein C08E3.10 [Caenor... 129 2e-28
gi|17532193|ref|NP_496869.1| cyclin-like F-box and Protein of un... 128 2e-28
gi|17531641|ref|NP_494015.1| cyclin-like F-box and Protein of un... 122 2e-26
gi|17531637|ref|NP_494013.1| cyclin-like F-box and Protein of un... 122 2e-26
gi|17565406|ref|NP_507539.1| predicted CDS, cyclin-like F-box an... 121 4e-26
gi|17531633|ref|NP_494010.1| cyclin-like F-box and Protein of un... 121 4e-26
gi|17570499|ref|NP_508071.1| predicted CDS, cyclin-like F-box an... 119 1e-25
gi|7509942|pir||T26970 hypothetical protein Y47H9C.11 - Caenorha... 119 1e-25
gi|7494907|pir||T18734 hypothetical protein B0391.6 - Caenorhabd... 114 3e-24
gi|30145722|emb|CAD89725.1| Hypothetical protein B0391.6 [Caenor... 114 4e-24
gi|17557360|ref|NP_506881.1| cyclin-like F-box and Protein of un... 114 6e-24
gi|17561590|ref|NP_507465.1| predicted CDS, cyclin-like F-box an... 112 1e-23
gi|32698040|emb|CAA21741.2| Hypothetical protein Y47H9C.10 [Caen... 111 3e-23
gi|47606781|sp|Q09336|YOF9_CAEEL Hypothetical protein ZK1290.9 i... 111 4e-23
gi|17557362|ref|NP_506880.1| cyclin-like F-box and Protein of un... 110 5e-23
gi|17564170|ref|NP_506746.1| cyclin-like F-box and Protein of un... 108 2e-22
gi|7507552|pir||T24767 hypothetical protein T09F5.11 - Caenorhab... 108 2e-22
gi|39590048|emb|CAE61046.1| Hypothetical protein CBG04791 [Caeno... 107 4e-22
gi|17557372|ref|NP_506878.1| cyclin-like F-box and Protein of un... 107 5e-22
gi|14530343|emb|CAB07161.2| Hypothetical protein C06H5.1 [Caenor... 107 7e-22
gi|39591146|emb|CAE58926.1| Hypothetical protein CBG02191 [Caeno... 106 9e-22
gi|17566392|ref|NP_507290.1| cyclin-like F-box and Protein of un... 105 3e-21
gi|17531639|ref|NP_494014.1| putative cytoplasmic protein family... 104 4e-21
gi|7495580|pir||T19028 hypothetical protein C06H5.1 - Caenorhabd... 101 4e-20
gi|17566466|ref|NP_507893.1| cyclin-like F-box and Protein of un... 100 5e-20
gi|17563922|ref|NP_504642.1| cyclin-like F-box and Protein of un... 100 9e-20
gi|17538572|ref|NP_502631.1| cyclin-like F-box and Protein of un... 99 2e-19
gi|17557722|ref|NP_507510.1| predicted CDS, cyclin-like F-box an... 99 3e-19
gi|39582886|emb|CAE71662.1| Hypothetical protein CBG18634 [Caeno... 97 6e-19
gi|17563966|ref|NP_506963.1| putative cytoplasmic protein family... 97 7e-19
gi|17563968|ref|NP_506964.1| cyclin-like F-box and Protein of un... 96 1e-18
gi|17565420|ref|NP_507573.1| cyclin-like F-box and Protein of un... 96 1e-18
gi|17560668|ref|NP_507008.1| cyclin-like F-box and Protein of un... 96 2e-18
gi|39582885|emb|CAE71661.1| Hypothetical protein CBG18633 [Caeno... 95 3e-18
gi|39579997|emb|CAE56313.1| Hypothetical protein CBG23976 [Caeno... 95 3e-18
gi|17561582|ref|NP_507460.1| cyclin-like F-box and Protein of un... 94 8e-18
gi|17566364|ref|NP_507275.1| cyclin-like F-box and Protein of un... 93 1e-17
gi|17556518|ref|NP_499593.1| predicted CDS, cyclin-like F-box an... 93 1e-17
gi|17542926|ref|NP_500678.1| predicted CDS, cyclin-like F-box an... 92 2e-17
gi|17564868|ref|NP_504615.1| predicted CDS, cyclin-like F-box an... 92 2e-17
gi|17558540|ref|NP_507447.1| cyclin-like F-box and Protein of un... 91 4e-17
gi|17561694|ref|NP_507466.1| cyclin-like F-box family member (5S... 91 5e-17
gi|17566080|ref|NP_507530.1| cyclin-like F-box and Protein of un... 91 7e-17
gi|33620962|gb|AAB65278.2| Hypothetical protein F17A9.1 [Caenorh... 89 2e-16
gi|17566472|ref|NP_507898.1| cyclin-like F-box and Protein of un... 89 3e-16
gi|17558528|ref|NP_507449.1| predicted CDS, cyclin-like F-box an... 88 3e-16
gi|17566470|ref|NP_507896.1| feminization Of Germline FOG-2, cyc... 88 3e-16
gi|17538115|ref|NP_495583.1| cyclin-like F-box and Protein of un... 87 8e-16
gi|32566897|ref|NP_507444.2| cyclin-like F-box and Protein of un... 87 1e-15
gi|17557364|ref|NP_506879.1| cyclin-like F-box and Protein of un... 87 1e-15
gi|39582833|emb|CAE71609.1| Hypothetical protein CBG18569 [Caeno... 86 1e-15
gi|17566468|ref|NP_507895.1| cyclin-like F-box and Protein of un... 86 2e-15
gi|17566462|ref|NP_507892.1| cyclin-like F-box and Protein of un... 84 6e-15
gi|34555909|emb|CAB07340.2| Hypothetical protein F10A3.2 [Caenor... 84 8e-15
gi|39590047|emb|CAE61045.1| Hypothetical protein CBG04790 [Caeno... 82 2e-14
gi|17566474|ref|NP_507897.1| cyclin-like F-box and Protein of un... 80 7e-14
gi|17566378|ref|NP_507282.1| predicted CDS, cyclin-like F-box fa... 80 7e-14
gi|17566380|ref|NP_507283.1| predicted CDS, cyclin-like F-box fa... 80 7e-14
gi|34850041|gb|AAC17005.2| Hypothetical protein F56C3.2 [Caenorh... 80 9e-14
gi|17566368|ref|NP_507277.1| cyclin-like F-box and Protein of un... 80 9e-14
gi|17565426|ref|NP_504572.1| cyclin-like F-box and Protein of un... 79 2e-13
gi|17559464|ref|NP_507065.1| predicted CDS, cyclin-like F-box an... 79 2e-13
gi|17565408|ref|NP_507540.1| cyclin-like F-box and Protein of un... 79 2e-13
gi|17550870|ref|NP_508309.1| cyclin-like F-box and Protein of un... 78 4e-13
gi|17555040|ref|NP_497302.1| cyclin-like F-box and Protein of un... 78 5e-13
gi|17565400|ref|NP_507536.1| cyclin-like F-box and Protein of un... 76 1e-12
gi|17532195|ref|NP_496870.1| predicted CDS, cyclin-like F-box an... 75 2e-12
gi|7496780|pir||T19605 hypothetical protein C31C9.5 - Caenorhabd... 75 2e-12
gi|17556775|ref|NP_497363.1| predicted CDS, cyclin-like F-box an... 75 2e-12
gi|17570013|ref|NP_510419.1| cyclin-like F-box and Protein of un... 75 2e-12
gi|17560964|ref|NP_504516.1| cyclin-like F-box and Protein of un... 75 2e-12
gi|17558196|ref|NP_506704.1| predicted CDS, cyclin-like F-box an... 75 3e-12
gi|17561690|ref|NP_507468.1| cyclin-like F-box and Protein of un... 75 4e-12
gi|17509607|ref|NP_491152.1| cyclin-like F-box and Protein of un... 72 4e-12
gi|17559796|ref|NP_504580.1| putative cytoplasmic protein family... 74 7e-12
gi|17555602|ref|NP_497448.1| cyclin-like F-box and Protein of un... 72 2e-11
gi|39580277|emb|CAE69669.1| Hypothetical protein CBG15918 [Caeno... 72 2e-11
gi|17531635|ref|NP_494012.1| cyclin-like F-box and Protein of un... 72 3e-11
gi|32697987|emb|CAE11303.1| Hypothetical protein F28F8.8 [Caenor... 72 3e-11
gi|7495522|pir||T19004 hypothetical protein C06C3.9 - Caenorhabd... 71 4e-11
gi|32565209|ref|NP_497381.2| cyclin-like F-box and Protein of un... 71 4e-11
gi|17566384|ref|NP_507285.1| predicted CDS, cyclin-like F-box an... 71 6e-11
gi|17561692|ref|NP_507467.1| putative cytoplasmic protein family... 70 7e-11
gi|49035104|gb|AAB66207.2| Hypothetical protein F45C12.8 [Caenor... 70 1e-10
gi|17534521|ref|NP_494046.1| putative cytoplasmic protein family... 70 1e-10
gi|17556590|ref|NP_497383.1| predicted CDS, cyclin-like F-box an... 69 2e-10
gi|17560388|ref|NP_507384.1| cyclin-like F-box and Protein of un... 69 2e-10
gi|7508625|pir||T28991 hypothetical protein T28A11.21 - Caenorha... 69 2e-10
gi|29570408|gb|AAO91685.1| Hypothetical protein Y22D7AR.9 [Caeno... 69 2e-10
gi|32567140|ref|NP_503905.2| predicted CDS, cyclin-like F-box an... 69 2e-10
gi|32565399|ref|NP_497446.2| cyclin-like F-box and Protein of un... 69 2e-10
gi|17556773|ref|NP_497364.1| cyclin-like F-box and Protein of un... 69 3e-10
gi|17558544|ref|NP_507445.1| predicted CDS, cyclin-like F-box an... 69 3e-10
gi|17550772|ref|NP_510807.1| cyclin-like F-box and Protein of un... 68 4e-10
gi|17510067|ref|NP_493019.1| putative protein family member (1M4... 68 4e-10
gi|39582834|emb|CAE71610.1| Hypothetical protein CBG18570 [Caeno... 68 5e-10
gi|17552570|ref|NP_497515.1| cyclin-like F-box and Protein of un... 68 5e-10
gi|7496285|pir||T19394 hypothetical protein C18D4.8 - Caenorhabd... 67 6e-10
gi|17556586|ref|NP_497385.1| cyclin-like F-box and Protein of un... 67 8e-10
gi|17556202|ref|NP_497534.1| predicted CDS, cyclin-like F-box an... 67 8e-10
gi|17552576|ref|NP_497513.1| cyclin-like F-box and Protein of un... 67 1e-09
gi|17564010|ref|NP_506827.1| cyclin-like F-box and Protein of un... 66 1e-09
gi|17556588|ref|NP_497384.1| cyclin-like F-box and Protein of un... 66 1e-09
gi|17566376|ref|NP_507281.1| cyclin-like F-box and Protein of un... 66 2e-09
gi|17543930|ref|NP_502739.1| cyclin-like F-box and Protein of un... 66 2e-09
gi|17558050|ref|NP_503929.1| cyclin-like F-box and Protein of un... 65 2e-09
gi|17555024|ref|NP_497305.1| cyclin-like F-box and Protein of un... 65 2e-09
gi|17556598|ref|NP_497382.1| predicted CDS, cyclin-like F-box an... 65 3e-09
gi|32565389|ref|NP_497353.2| predicted CDS, cyclin-like F-box an... 65 3e-09
gi|17567995|ref|NP_508366.1| cyclin-like F-box and Protein of un... 65 4e-09
gi|17555022|ref|NP_497307.1| cyclin-like F-box and Protein of un... 64 7e-09
gi|17510245|ref|NP_493040.1| cyclin-like F-box and Protein of un... 64 9e-09
gi|17556204|ref|NP_497535.1| predicted CDS, cyclin-like F-box an... 64 9e-09
gi|17562142|ref|NP_507432.1| predicted CDS, cyclin-like F-box an... 64 9e-09
gi|17536079|ref|NP_493845.1| putative cytoplasmic protein family... 63 1e-08
gi|17556771|ref|NP_497367.1| predicted CDS, cyclin-like F-box an... 63 1e-08
gi|17560392|ref|NP_507385.1| predicted CDS, cyclin-like F-box an... 63 2e-08
gi|17531643|ref|NP_494016.1| predicted CDS, putative protein fam... 63 2e-08
gi|17556594|ref|NP_497378.1| predicted CDS, cyclin-like F-box an... 62 2e-08
gi|7494906|pir||T18728 hypothetical protein B0391.5 - Caenorhabd... 62 2e-08
gi|17555032|ref|NP_497296.1| transposase family member (3B552) [... 62 3e-08
gi|30145758|emb|CAD89750.1| Hypothetical protein T25E12.12 [Caen... 62 3e-08
gi|39589824|emb|CAE67059.1| Hypothetical protein CBG12467 [Caeno... 60 8e-08
gi|17555038|ref|NP_497300.1| cyclin-like F-box and Protein of un... 60 8e-08
gi|17555028|ref|NP_497303.1| cyclin-like F-box and Protein of un... 60 8e-08
gi|39587086|emb|CAE57553.1| Hypothetical protein CBG00531 [Caeno... 60 1e-07
gi|17567983|ref|NP_508358.1| predicted CDS, cyclin-like F-box an... 59 2e-07
gi|32566510|ref|NP_508355.2| predicted CDS, cyclin-like F-box an... 59 2e-07
gi|17536139|ref|NP_494084.1| predicted CDS, cyclin-like F-box an... 59 3e-07
gi|7510151|pir||T27120 hypothetical protein Y53C10A.8 - Caenorha... 58 4e-07
gi|17568223|ref|NP_508255.1| cyclin-like F-box and Protein of un... 58 5e-07
gi|7496779|pir||T19604 hypothetical protein C31C9.4 - Caenorhabd... 58 5e-07
gi|17510243|ref|NP_493039.1| cyclin-like F-box and Protein of un... 57 6e-07
gi|17557506|ref|NP_504892.1| cyclin-like F-box and Protein of un... 56 1e-06
gi|17559682|ref|NP_507041.1| predicted CDS, cyclin-like F-box an... 56 1e-06
gi|17566382|ref|NP_507284.1| predicted CDS, putative cytoplasmic... 56 1e-06
gi|17561152|ref|NP_507391.1| cyclin-like F-box and Protein of un... 56 1e-06
gi|17552578|ref|NP_497512.1| predicted CDS, cyclin-like F-box an... 56 2e-06
gi|17534061|ref|NP_494052.1| cyclin-like F-box and Protein of un... 55 2e-06
gi|17556721|ref|NP_497373.1| predicted CDS, cyclin-like F-box an... 55 2e-06
gi|17561360|ref|NP_506948.1| cyclin-like F-box and Protein of un... 55 2e-06
gi|17552580|ref|NP_497517.1| cyclin-like F-box and Protein of un... 55 2e-06
gi|17564298|ref|NP_507106.1| cyclin-like F-box and Protein of un... 55 2e-06
gi|17556715|ref|NP_497377.1| predicted CDS, cyclin-like F-box an... 55 2e-06
gi|17543752|ref|NP_502778.1| predicted CDS, protein of unknown f... 55 4e-06
gi|17555200|ref|NP_497526.1| putative protein family member (3D3... 55 4e-06
gi|17555026|ref|NP_497304.1| cyclin-like F-box and Protein of un... 55 4e-06
gi|45644988|sp|P34294|YKO6_CAEEL Hypothetical protein C05B5.6 in... 54 5e-06
gi|17551988|ref|NP_499220.1| putative endoplasmic reticulum prot... 54 5e-06
gi|17556733|ref|NP_497354.1| predicted CDS, cyclin-like F-box an... 54 7e-06
gi|7495668|pir||T32354 hypothetical protein C08E3.4 - Caenorhabd... 54 9e-06
gi|32564809|ref|NP_494008.2| putative cytoplasmic protein family... 54 9e-06
gi|17540364|ref|NP_500327.1| putative cytoplasmic protein family... 54 9e-06
gi|17556316|ref|NP_499476.1| putative N-myristoylated protein fa... 53 1e-05
gi|17560312|ref|NP_506871.1| cyclin-like F-box and Protein of un... 53 1e-05
gi|17556064|ref|NP_499622.1| putative nuclear protein family mem... 53 1e-05
gi|32565381|ref|NP_497299.2| cyclin-like F-box and Protein of un... 53 2e-05
gi|17565394|ref|NP_506838.1| cyclin-like F-box and Protein of un... 53 2e-05
gi|7507726|pir||T33677 hypothetical protein T12B5.8 - Caenorhabd... 53 2e-05
gi|17566748|ref|NP_505079.1| predicted CDS, cyclin-like F-box an... 53 2e-05
gi|39580000|emb|CAE56316.1| Hypothetical protein CBG23979 [Caeno... 52 3e-05
gi|17567309|ref|NP_510401.1| cyclin-like F-box and Protein of un... 52 3e-05
gi|17560554|ref|NP_506398.1| cyclin-like F-box and Protein of un... 52 3e-05
gi|17552766|ref|NP_497124.1| cyclin-like F-box and Protein of un... 52 3e-05
gi|17552568|ref|NP_497516.1| predicted CDS, cyclin-like F-box an... 52 3e-05
gi|7507718|pir||T33684 hypothetical protein T12B5.12 - Caenorhab... 51 5e-05
gi|50727060|gb|AAT81200.1| Hypothetical protein F14D2.13 [Caenor... 51 6e-05
gi|17556767|ref|NP_497365.1| predicted CDS, cyclin-like F-box an... 50 8e-05
gi|7508443|pir||T25281 hypothetical protein T25E12.11 - Caenorha... 50 1e-04
gi|32566983|ref|NP_507232.2| protein of unknown function DUF38 a... 50 1e-04
gi|39590092|emb|CAE61090.1| Hypothetical protein CBG04843 [Caeno... 50 1e-04
gi|49035143|gb|AAB66190.2| Hypothetical protein T07D3.1 [Caenorh... 50 1e-04
gi|17556192|ref|NP_497531.1| predicted CDS, cyclin-like F-box an... 50 1e-04
gi|17531645|ref|NP_494017.1| predicted CDS, putative cytoplasmic... 49 2e-04
gi|17559414|ref|NP_507270.1| predicted CDS, cyclin-like F-box an... 49 2e-04
gi|17556737|ref|NP_497352.1| predicted CDS, cyclin-like F-box an... 49 2e-04
gi|32565204|ref|NP_497530.2| cyclin-like F-box and Protein of un... 48 4e-04
gi|17556769|ref|NP_497366.1| predicted CDS, cyclin-like F-box an... 48 4e-04
gi|17551458|ref|NP_508314.1| cyclin-like F-box and Protein of un... 48 5e-04
gi|39579178|emb|CAE56009.1| Hypothetical protein CBG23561 [Caeno... 48 5e-04
gi|17560420|ref|NP_503290.1| predicted CDS, putative cytoplasmic... 48 5e-04
gi|17510071|ref|NP_493016.1| putative nuclear protein family mem... 47 0.001
gi|17509669|ref|NP_493419.1| cyclin-like F-box and Protein of un... 47 0.001
gi|17559410|ref|NP_507267.1| cyclin-like F-box and Protein of un... 47 0.001
gi|17556578|ref|NP_497390.1| predicted CDS, cyclin-like F-box an... 47 0.001
gi|17565954|ref|NP_507584.1| cyclin-like F-box and Protein of un... 46 0.001
gi|17510235|ref|NP_493038.1| cyclin-like F-box and Protein of un... 46 0.002
gi|17556626|ref|NP_497399.1| predicted CDS, cyclin-like F-box fa... 46 0.002
gi|17566264|ref|NP_506747.1| putative cytoplasmic protein family... 46 0.002
gi|7503264|pir||T32285 hypothetical protein F42G2.4 - Caenorhabd... 45 0.003
gi|32564782|ref|NP_872001.1| cyclin-like F-box and Protein of un... 45 0.003
gi|25148588|ref|NP_494270.2| cyclin-like F-box and Protein of un... 45 0.003
gi|17506555|ref|NP_493496.1| cyclin-like F-box and Protein of un... 45 0.003
gi|17531631|ref|NP_494009.1| cyclin-like F-box and Protein of un... 45 0.004
gi|17552410|ref|NP_497143.1| predicted CDS, cyclin-like F-box an... 44 0.006
gi|39579643|emb|CAE56642.1| Hypothetical protein CBG24403 [Caeno... 44 0.006
gi|17566374|ref|NP_507280.1| cyclin-like F-box and Protein of un... 44 0.006
gi|17565048|ref|NP_507824.1| putative cytoplasmic protein family... 44 0.007
gi|39590113|emb|CAE61111.1| Hypothetical protein CBG04868 [Caeno... 44 0.007
gi|7507723|pir||T33676 hypothetical protein T12B5.5 - Caenorhabd... 44 0.010
gi|39584334|emb|CAE65498.1| Hypothetical protein CBG10468 [Caeno... 44 0.010
gi|32565379|ref|NP_497298.2| predicted CDS, putative cytoplasmic... 44 0.010
gi|17556719|ref|NP_497375.1| predicted CDS, cyclin-like F-box an... 43 0.013
gi|7509472|pir||T22376 hypothetical protein Y20C6A.1 - Caenorhab... 43 0.013
gi|32566899|ref|NP_507397.2| protein of unknown function DUF38 a... 43 0.013
gi|50470582|emb|CAA16306.3| Hypothetical protein Y20C6A.1 [Caeno... 43 0.013
gi|17568453|ref|NP_510502.1| cyclin-like F-box and Protein of un... 43 0.016
gi|49035157|gb|AAT48620.1| Hypothetical protein F42G2.4a [Caenor... 43 0.016
gi|49035158|gb|AAT48621.1| Hypothetical protein F42G2.4b [Caenor... 43 0.016
gi|39587303|emb|CAE74957.1| Hypothetical protein CBG22848 [Caeno... 42 0.021
gi|17556731|ref|NP_497355.1| cyclin-like F-box and Protein of un... 42 0.028
gi|37907390|gb|AAP51084.1| transposase [Forficula auricularia] 41 0.048
gi|37907386|gb|AAP51082.1| transposase [Forficula auricularia] 41 0.048
gi|17554546|ref|NP_497862.1| transposase (3F388) [Caenorhabditis... 41 0.062
gi|17543060|ref|NP_502686.1| predicted CDS, serpentine Receptor,... 41 0.062
gi|37907396|gb|AAP51087.1| transposase [Forficula auricularia] 41 0.062
gi|39590024|emb|CAE61022.1| Hypothetical protein CBG04764 [Caeno... 40 0.081
gi|17531897|ref|NP_495069.1| predicted CDS, cyclin-like F-box fa... 40 0.081
gi|37907388|gb|AAP51083.1| transposase [Forficula auricularia] 40 0.081
gi|17567987|ref|NP_508360.1| predicted CDS, transposase family m... 40 0.081
gi|17555196|ref|NP_497523.1| predicted CDS, putative mitochondri... 40 0.11
gi|39579646|emb|CAE56645.1| Hypothetical protein CBG24406 [Caeno... 40 0.11
gi|17541416|ref|NP_502346.1| predicted CDS, transposase (4N77) [... 40 0.11
gi|17556404|ref|NP_497337.1| transposase (3C210) [Caenorhabditis... 40 0.11
gi|17558638|ref|NP_503590.1| predicted CDS, serpentine Receptor,... 40 0.14
gi|17555204|ref|NP_497524.1| predicted CDS, cyclin-like F-box an... 40 0.14
gi|17564088|ref|NP_503541.1| putative mitochondrial protein fami... 40 0.14
gi|17538870|ref|NP_502250.1| predicted CDS, transposase (4M633) ... 40 0.14
gi|1176502|sp|P41997|YKC6_CAEEL Hypothetical 29.3 kDa protein B0... 39 0.18
gi|17538304|ref|NP_502666.1| transposase family member (4O598) [... 39 0.18
gi|17570311|ref|NP_510596.1| predicted CDS, transposase (XQ400) ... 39 0.18
gi|17565788|ref|NP_503700.1| transposase (5D34) [Caenorhabditis ... 39 0.18
gi|7510357|pir||T27281 hypothetical protein Y64G10A.d - Caenorha... 39 0.18
gi|17541018|ref|NP_502706.1| predicted CDS, transposase (4O880) ... 39 0.18
gi|17510715|ref|NP_490793.1| transposase (1B403) [Caenorhabditis... 39 0.18
gi|17538948|ref|NP_501681.1| predicted CDS, transposase (4K265) ... 39 0.18
gi|17564768|ref|NP_506792.1| predicted CDS, transposase (5P782) ... 39 0.18
gi|17544368|ref|NP_502911.1| transposase (4Q775) [Caenorhabditis... 39 0.18
gi|17542588|ref|NP_502765.1| predicted CDS, transposase (4P302) ... 39 0.18
gi|17511197|ref|NP_493315.1| predicted CDS, transposase (1N802) ... 39 0.18
gi|17550718|ref|NP_510757.1| predicted CDS, transposase (XR675) ... 39 0.18
gi|17538334|ref|NP_502525.1| predicted CDS, transposase (4N878) ... 39 0.18
gi|17561494|ref|NP_503674.1| transposase (5C928) [Caenorhabditis... 39 0.18
gi|17556723|ref|NP_497374.1| predicted CDS, transposase (3C384) ... 39 0.18
gi|17543894|ref|NP_502735.1| predicted CDS, transposase (4P15) [... 39 0.18
gi|17506679|ref|NP_492271.1| predicted CDS, transposase (1I949) ... 39 0.18
gi|17506467|ref|NP_493144.1| predicted CDS, transposase (1M994) ... 39 0.18
gi|17566558|ref|NP_504191.1| predicted CDS, transposase (5E791) ... 39 0.18
gi|17535143|ref|NP_493892.1| transposase (2B320) [Caenorhabditis... 39 0.18
gi|17540746|ref|NP_501661.1| predicted CDS, transposase (4K176) ... 39 0.18
gi|17544206|ref|NP_502864.1| predicted CDS, transposase (4Q262) ... 39 0.18
gi|17567457|ref|NP_510748.1| predicted CDS, transposase (XR629) ... 39 0.18
gi|17559572|ref|NP_507657.1| predicted CDS, transposase (5T217) ... 39 0.18
gi|17562986|ref|NP_504049.1| transposase family member (5E269) [... 39 0.18
gi|17543466|ref|NP_502642.1| predicted CDS, transposase, type 1 ... 39 0.18
gi|39582869|emb|CAE71645.1| Hypothetical protein CBG18616 [Caeno... 39 0.24
gi|27465081|gb|AAO12864.1| Ccmar2 transposase [Ceratitis capitata] 39 0.24
gi|17565468|ref|NP_507953.1| putative cytoplasmic protein family... 39 0.24
gi|37907406|gb|AAP51092.1| transposase [Forficula auricularia] 39 0.24
gi|32699249|gb|AAB70963.2| Hypothetical protein C08E3.5 [Caenorh... 39 0.24
gi|39587335|emb|CAE74989.1| Hypothetical protein CBG22882 [Caeno... 39 0.31
gi|17506541|ref|NP_493266.1| cyclin-like F-box and Protein of un... 39 0.31
gi|37907394|gb|AAP51086.1| transposase [Forficula auricularia] 38 0.40
gi|17543524|ref|NP_502965.1| transposase precursor (4R518) [Caen... 38 0.40
gi|37907423|gb|AAP51096.1| transposase [Forficula auricularia] 38 0.40
gi|17556194|ref|NP_497529.1| predicted CDS, cyclin-like F-box an... 38 0.53
gi|48139320|ref|XP_396994.1| similar to CG7937-PA [Apis mellifera] 38 0.53
gi|37515227|gb|AAB94179.2| Hypothetical protein T08B1.5 [Caenorh... 38 0.53
gi|39590089|emb|CAE61087.1| Hypothetical protein CBG04840 [Caeno... 38 0.53
gi|37907426|gb|AAP51097.1| transposase [Forficula auricularia] 38 0.53
gi|27465079|gb|AAO12863.1| Famar1 transposase [Forficula auricul... 38 0.53
gi|37907408|gb|AAP51093.1| transposase [Forficula auricularia] 38 0.53
gi|27465075|gb|AAO12861.1| Ammar1 transposase [Apis mellifera] 38 0.53
gi|48132779|ref|XP_396703.1| similar to Ammar1 transposase [Apis... 37 0.69
gi|17557368|ref|NP_506876.1| putative cytoskeletal protein famil... 37 0.69
gi|37907412|gb|AAP51095.1| transposase [Forficula auricularia] 37 0.69
gi|37907428|gb|AAP51098.1| transposase [Forficula auricularia] >... 37 0.69
gi|37907400|gb|AAP51089.1| transposase [Forficula auricularia] 37 0.69
gi|17541780|ref|NP_501218.1| predicted CDS, transposase (4I289) ... 37 0.90
gi|39581728|emb|CAE71061.1| Hypothetical protein CBG17904 [Caeno... 37 0.90
gi|37907402|gb|AAP51090.1| transposase [Forficula auricularia] >... 37 0.90
gi|37907392|gb|AAP51085.1| transposase [Forficula auricularia] 37 1.2
gi|17564680|ref|NP_507237.1| putative cytoplasmic protein (36.9 ... 37 1.2
gi|17506067|ref|NP_493267.1| cyclin-like F-box and Protein of un... 36 1.5
gi|17555034|ref|NP_497297.1| predicted CDS, cyclin-like F-box an... 36 1.5
gi|48118414|ref|XP_396428.1| similar to Camar1 transposase [Apis... 36 2.0
gi|17562328|ref|NP_504083.1| predicted CDS, transposase (5E386) ... 36 2.0
gi|17559466|ref|NP_507066.1| cyclin-like F-box family member (5Q... 35 2.6
gi|39580079|emb|CAE56839.1| Hypothetical protein CBG24664 [Caeno... 35 2.6
gi|16801968|ref|NP_472236.1| similar to hypothetical transcripti... 35 2.6
gi|16804803|ref|NP_466288.1| similar to hypothetical transcripti... 35 2.6
gi|33869529|gb|AAH08931.2| SETMAR protein [Homo sapiens] 35 2.6
gi|39588617|emb|CAE58141.1| Hypothetical protein CBG01230 [Caeno... 35 2.6
gi|3005702|gb|AAC09350.1| unknown [Homo sapiens] 35 2.6
gi|5730039|ref|NP_006506.1| SET domain and mariner transposase f... 35 2.6
gi|37907398|gb|AAP51088.1| transposase [Forficula auricularia] 35 2.6
gi|3136138|gb|AAC16616.1| transposase [Drosophila simulans] 35 3.4
gi|39582868|emb|CAE71644.1| Hypothetical protein CBG18615 [Caeno... 35 3.4
gi|42782574|ref|NP_979821.1| response regulator, putative [Bacil... 35 4.4
gi|30692868|ref|NP_198446.3| DNA-binding protein, putative [Arab... 35 4.4
gi|17556781|ref|NP_497369.1| cyclin-like F-box and Protein of un... 35 4.4
gi|18448946|gb|AAL69970.1| transposase [Mamestra brassicae] 35 4.4
gi|32564766|ref|NP_871999.1| cyclin-like F-box and BTB/POZ domai... 35 4.4
gi|7499081|pir||T32791 hypothetical protein F14D2.8 - Caenorhabd... 35 4.4
gi|39582107|emb|CAE60783.1| Hypothetical protein CBG04472 [Caeno... 35 4.4
gi|37907404|gb|AAP51091.1| transposase [Forficula auricularia] 35 4.4
gi|20302606|dbj|BAB91130.1| Ser/Thr kinase [Arabidopsis thaliana] 34 5.8
gi|17532541|ref|NP_494091.1| protein of unknown function DUF38 a... 34 5.8
gi|18422160|ref|NP_568599.1| protein kinase family protein [Arab... 34 5.8
gi|9757944|dbj|BAB08432.1| MAP kinase [Arabidopsis thaliana] 34 5.8
gi|7496170|pir||T15539 hypothetical protein C17C3.14 - Caenorhab... 34 7.6
gi|17228214|ref|NP_484762.1| unknown protein [Nostoc sp. PCC 712... 34 7.6
gi|17556755|ref|NP_497358.1| cyclin-like F-box and Protein of un... 34 7.6
gi|47570068|ref|ZP_00240728.1| uncharacterised protein family (U... 33 9.9
gi|34850050|gb|AAF02103.2| Hypothetical protein F52D2.8 [Caenorh... 33 9.9
gi|23612862|ref|NP_704401.1| hypothetical protein [Plasmodium fa... 33 9.9
gi|23479788|gb|EAA16521.1| 235 kDa rhoptry protein [Plasmodium y... 33 9.9
gi|14161477|gb|AAK54758.1| mariner-like transposase [Musca domes... 33 9.9
gi|48098674|ref|XP_394132.1| similar to ENSANGP00000012180 [Apis... 33 9.9
gi|84871|pir||A26491 probable transposition protein - fruit fly ... 33 9.9
gi|23612963|ref|NP_704502.1| hypothetical protein [Plasmodium fa... 33 9.9
gi|11094099|gb|AAG29550.1| p235 rhoptry protein E2 [Plasmodium y... 33 9.9
gi|39590174|emb|CAE61172.1| Hypothetical protein CBG04940 [Caeno... 33 9.9
>gi|17543462|ref|NP_502641.1| cyclin-like F-box and Protein of unknown
function DUF38 family member (4O430) [Caenorhabditis
elegans]
gi|7509876|pir||T26927 hypothetical protein Y45F10C.3 -
Caenorhabditis elegans
gi|3880969|emb|CAB16478.1| Hypothetical protein Y45F10C.3
[Caenorhabditis elegans]
Length = 392
Score = 798 bits (2062), Expect = 0.0
Identities = 392/392 (100%), Positives = 392/392 (100%)
Frame = -1
Query: 1179 MADSNSTVEQYRSLKRKMIEKKDLMRNNRTALRACILFNCLLGTSIRDAYNQFCRAVGSD 1000
MADSNSTVEQYRSLKRKMIEKKDLMRNNRTALRACILFNCLLGTSIRDAYNQFCRAVGSD
Sbjct: 1 MADSNSTVEQYRSLKRKMIEKKDLMRNNRTALRACILFNCLLGTSIRDAYNQFCRAVGSD 60
Query: 999 VMEYREYEFWFYQFKRGDADFSDAISWNPNTIKLDELPIEVINTISSFSMPMERLTLRKV 820
VMEYREYEFWFYQFKRGDADFSDAISWNPNTIKLDELPIEVINTISSFSMPMERLTLRKV
Sbjct: 61 VMEYREYEFWFYQFKRGDADFSDAISWNPNTIKLDELPIEVINTISSFSMPMERLTLRKV 120
Query: 819 SKNLRTLIDSEPFCFQRIIVRIGHRTSYLQLDGYPGIEYIHCGADCNVLYGKRDKYVKNK 640
SKNLRTLIDSEPFCFQRIIVRIGHRTSYLQLDGYPGIEYIHCGADCNVLYGKRDKYVKNK
Sbjct: 121 SKNLRTLIDSEPFCFQRIIVRIGHRTSYLQLDGYPGIEYIHCGADCNVLYGKRDKYVKNK 180
Query: 639 NHVEYALTEAIQLMRNSNNHSKEFHVRAERSNDQELSMVLRKFFDSVEIELYAKKIVVSG 460
NHVEYALTEAIQLMRNSNNHSKEFHVRAERSNDQELSMVLRKFFDSVEIELYAKKIVVSG
Sbjct: 181 NHVEYALTEAIQLMRNSNNHSKEFHVRAERSNDQELSMVLRKFFDSVEIELYAKKIVVSG 240
Query: 459 FSFADTSSVLCHFKAGFLEEIQVLPGSGGPWTNVLVEMEQYKKAKVLKICTEFPVLLDIE 280
FSFADTSSVLCHFKAGFLEEIQVLPGSGGPWTNVLVEMEQYKKAKVLKICTEFPVLLDIE
Sbjct: 241 FSFADTSSVLCHFKAGFLEEIQVLPGSGGPWTNVLVEMEQYKKAKVLKICTEFPVLLDIE 300
Query: 279 DLLHFRRFEIAIKSDFTERMARKIRDVLTNSEHFEYAHIITQDLHHRTVIKFFNRNAENV 100
DLLHFRRFEIAIKSDFTERMARKIRDVLTNSEHFEYAHIITQDLHHRTVIKFFNRNAENV
Sbjct: 301 DLLHFRRFEIAIKSDFTERMARKIRDVLTNSEHFEYAHIITQDLHHRTVIKFFNRNAENV 360
Query: 99 FWNYGSMNYNNKKRLFHIEYNHRQFVIKKLNM 4
FWNYGSMNYNNKKRLFHIEYNHRQFVIKKLNM
Sbjct: 361 FWNYGSMNYNNKKRLFHIEYNHRQFVIKKLNM 392