Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y45G5AM_5
         (1302 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17565748|ref|NP_504160.1| myosin heavy like (50.1 kD) (5E646)...   843   0.0
gi|39588805|emb|CAE58329.1| Hypothetical protein CBG01442 [Caeno...   320   6e-86
gi|34869316|ref|XP_221489.2| similar to myosin heavy chain [Ratt...    87   7e-16
gi|50286051|ref|XP_445454.1| unnamed protein product [Candida gl...    83   1e-14
gi|11276953|pir||A59294 skeletal myosin - nematode (Onchocerca v...    82   2e-14
gi|50738301|ref|XP_419285.1| PREDICTED: hypothetical protein XP_...    80   1e-13
gi|12697534|emb|CAC28360.1| myosin heavy chain [Toxocara canis]        80   1e-13
gi|345377|pir||A45627 myosin heavy chain [similarity] - nematode...    79   2e-13
gi|38079956|ref|XP_356900.1| similar to KIAA1000 protein [Mus mu...    77   1e-12
gi|38081072|ref|XP_359049.1| similar to myosin heavy chain [Mus ...    77   1e-12
gi|23485476|gb|EAA20445.1| hypothetical protein [Plasmodium yoel...    76   2e-12
gi|39584408|emb|CAE72546.1| Hypothetical protein CBG19730 [Caeno...    74   8e-12
gi|50415820|gb|AAH78168.1| LOC55580 protein [Homo sapiens]             74   1e-11
gi|39581964|emb|CAE73826.1| Hypothetical protein CBG21388 [Caeno...    74   1e-11
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n...    73   2e-11
gi|39592202|emb|CAE75423.1| Hypothetical protein CBG23416 [Caeno...    73   2e-11
gi|25140983|ref|NP_740768.1| cytomatrix protein p110 [Rattus nor...    72   2e-11
gi|37536608|ref|NP_922606.1| putative kinesin-related protein [O...    72   3e-11
gi|127743|sp|P02566|MYSB_CAEEL Myosin heavy chain B (MHC B) >gnl...    71   5e-11
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ...    71   5e-11
gi|17566982|ref|NP_504677.1| HoloCentric chromosome binding Prot...    71   5e-11
gi|17509401|ref|NP_493596.1| UNCoordinated locomotion UNC-54, en...    71   5e-11
gi|46442063|gb|EAL01355.1| hypothetical protein CaO19.10199 [Can...    70   8e-11
gi|38045898|ref|NP_829884.1| Rab6-interacting protein 2 isoform ...    70   1e-10
gi|11384448|pir||S02771 myosin heavy chain A [similarity] - Caen...    70   1e-10
gi|38045896|ref|NP_829883.1| Rab6-interacting protein 2 isoform ...    70   1e-10
gi|26986436|emb|CAD58915.1| SMC4 protein [Takifugu rubripes]           70   1e-10
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv...    70   1e-10
gi|32566139|ref|NP_506065.2| MYOsin heavy chain structural gene,...    70   1e-10
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8]                 70   1e-10
gi|42656791|ref|XP_036988.9| KIAA1000 protein [Homo sapiens]           70   1e-10
gi|27529750|dbj|BAA76844.2| KIAA1000 protein [Homo sapiens]            70   1e-10
gi|50748602|ref|XP_421320.1| PREDICTED: similar to DVL-binding p...    70   1e-10
gi|23478145|gb|EAA15312.1| hypothetical protein [Plasmodium yoel...    70   1e-10
gi|41386711|ref|NP_777152.1| myosin, heavy polypeptide 7, cardia...    70   1e-10
gi|3041706|sp|P13533|MYH6_HUMAN Myosin heavy chain, cardiac musc...    70   1e-10
gi|27764861|ref|NP_002462.1| myosin heavy chain 6; myosin heavy ...    70   1e-10
gi|7494129|pir||T18296 myosin heavy chain - Entamoeba histolytic...    70   1e-10
gi|15898100|ref|NP_342705.1| Microtubule binding protein, putati...    70   1e-10
gi|14591553|ref|NP_143635.1| chromosome assembly protein [Pyroco...    69   2e-10
gi|47214961|emb|CAG10783.1| unnamed protein product [Tetraodon n...    69   2e-10
gi|42559495|sp|Q8T305|MYSP_TAESA Paramyosin >gnl|BL_ORD_ID|90944...    69   2e-10
gi|18859641|ref|NP_542766.1| myosin, heavy polypeptide 7, cardia...    69   3e-10
gi|50751436|ref|XP_422397.1| PREDICTED: similar to hypothetical ...    69   3e-10
gi|34879616|ref|XP_223709.2| similar to hypothetical protein [Ra...    68   4e-10
gi|3041708|sp|P13540|MYH7_MESAU Myosin heavy chain, cardiac musc...    68   4e-10
gi|476355|pir||A46762 myosin alpha heavy chain, cardiac muscle -...    68   4e-10
gi|191618|gb|AAA37159.1| alpha cardiac myosin heavy chain              68   4e-10
gi|6754774|ref|NP_034986.1| myosin, heavy polypeptide 6, cardiac...    68   4e-10
gi|11360366|pir||T42722 male-enhanced antigen-2 - mouse                68   5e-10
gi|14149147|dbj|BAA86889.2| male enhanced antigen 2/golgi autoan...    68   5e-10
gi|26328421|dbj|BAC27949.1| unnamed protein product [Mus musculus]     68   5e-10
gi|17561652|ref|NP_505094.1| myosin heavy chain family member (5...    68   5e-10
gi|32470592|sp|P55937|GOA3_MOUSE Golgi autoantigen, golgin subfa...    68   5e-10
gi|31982330|ref|NP_032172.3| Golgi autoantigen, golgin subfamily...    68   5e-10
gi|14149148|dbj|BAA86890.2| alternative splicing [Mus musculus]        68   5e-10
gi|8393804|ref|NP_058935.1| myosin heavy chain, polypeptide 6; m...    68   5e-10
gi|16716511|ref|NP_444434.1| Rab6-interacting protein 2 [Mus mus...    68   5e-10
gi|28175771|gb|AAH43452.1| Golga3 protein [Mus musculus]               68   5e-10
gi|45383005|ref|NP_989918.1| myosin heavy chain [Gallus gallus] ...    68   5e-10
gi|18043255|gb|AAH20075.1| D3Ertd250e protein [Mus musculus]           67   7e-10
gi|38045894|ref|NP_829882.1| Rab6-interacting protein 2 isoform ...    67   7e-10
gi|13592049|ref|NP_112360.1| Rho-associated kinase beta [Rattus ...    67   7e-10
gi|39593982|emb|CAE70092.1| Hypothetical protein CBG16534 [Caeno...    67   7e-10
gi|38045892|ref|NP_829881.1| Rab6-interacting protein 2 isoform ...    67   7e-10
gi|13385172|ref|NP_079990.1| DNA segment, Chr 3, ERATO Doi 250, ...    67   7e-10
gi|23508159|ref|NP_700829.1| liver stage antigen, putative [Plas...    67   7e-10
gi|127740|sp|P04460|MYH6_RABIT Myosin heavy chain, cardiac muscl...    67   7e-10
gi|12060489|dbj|BAB20630.1| myosin heavy chain slow isoform [Sus...    67   7e-10
gi|21907902|dbj|BAC05681.1| myosin heavy chain slow [Equus cabal...    67   7e-10
gi|8393807|ref|NP_058936.1| myosin heavy chain, polypeptide 7; m...    67   7e-10
gi|4557773|ref|NP_000248.1| myosin, heavy polypeptide 7, cardiac...    67   7e-10
gi|27545259|ref|NP_775360.1| MC4 structural maintenance of chrom...    67   7e-10
gi|41406064|ref|NP_005955.1| myosin, heavy polypeptide 10, non-m...    67   7e-10
gi|1346640|sp|P35580|MYHA_HUMAN Myosin heavy chain, nonmuscle ty...    67   7e-10
gi|39582764|emb|CAE74227.1| Hypothetical protein CBG21911 [Caeno...    67   7e-10
gi|20521758|dbj|BAA83033.2| KIAA1081 protein [Homo sapiens]            67   7e-10
gi|127747|sp|P04461|MYH7_RABIT Myosin heavy chain, cardiac muscl...    67   9e-10
gi|11276949|pir||A59282 nonmuscle myosin II heavy chain A - Afri...    67   9e-10
gi|12053672|emb|CAC20413.1| beta-myosin heavy chain [Homo sapiens]     67   9e-10
gi|28703810|gb|AAH47253.1| LOC398083 protein [Xenopus laevis]          67   9e-10
gi|111999|pir||S21801 myosin heavy chain, neuronal [similarity] ...    67   9e-10
gi|11496756|ref|NP_045547.1| B. burgdorferi predicted coding reg...    67   1e-09
gi|6682319|emb|CAB64662.1| myosin heavy chain [Mytilus galloprov...    67   1e-09
gi|4102980|gb|AAD09328.1| virulent strain associated lipoprotein...    67   1e-09
gi|15221524|ref|NP_177046.1| expressed protein [Arabidopsis thal...    67   1e-09
gi|6677759|ref|NP_033097.1| Rho-associated coiled-coil forming k...    67   1e-09
gi|6682323|emb|CAB64664.1| catchin protein [Mytilus galloprovinc...    67   1e-09
gi|39592962|emb|CAE62576.1| Hypothetical protein CBG06689 [Caeno...    67   1e-09
gi|7513208|pir||T08880 NMDA receptor-binding protein yotiao - hu...    66   2e-09
gi|3941320|gb|AAC82332.1| myosin [Schistosoma japonicum]               66   2e-09
gi|3645944|gb|AAC60380.1| yotiao [Homo sapiens]                        66   2e-09
gi|22538391|ref|NP_671700.1| A-kinase anchor protein 9 isoform 1...    66   2e-09
gi|22538387|ref|NP_005742.4| A-kinase anchor protein 9 isoform 2...    66   2e-09
gi|3941223|gb|AAC82221.1| myosin heavy chain [Schistosoma japoni...    66   2e-09
gi|22538393|ref|NP_671714.1| A-kinase anchor protein 9 isoform 3...    66   2e-09
gi|4584423|emb|CAB40713.1| AKAP450 protein [Homo sapiens]              66   2e-09
gi|2144825|pir||MWRBCB myosin beta heavy chain, cardiac muscle [...    66   2e-09
gi|45382693|ref|NP_990808.1| myosin heavy chain, nonmuscle [Gall...    66   2e-09
gi|22538389|ref|NP_671695.1| A-kinase anchor protein 9 isoform 4...    66   2e-09
gi|23510054|ref|NP_702720.1| hypothetical protein [Plasmodium fa...    66   2e-09
gi|34896152|ref|NP_909420.1| P0701D05.31 [Oryza sativa (japonica...    66   2e-09
gi|3041710|sp|Q01202|MYSP_BRUMA Paramyosin >gnl|BL_ORD_ID|176789...    66   2e-09
gi|47575800|ref|NP_001001244.1| myosin heavy chain [Xenopus trop...    66   2e-09
gi|34852562|ref|XP_228197.2| similar to Golgi coiled coil protei...    66   2e-09
gi|191622|gb|AAA37161.1| alpha cardiac myosin heavy chain              66   2e-09
gi|48111808|ref|XP_396309.1| similar to hypothetical protein [Ap...    66   2e-09
gi|48106337|ref|XP_396089.1| similar to CG5020-PB [Apis mellifera]     65   3e-09
gi|1236759|emb|CAA58041.1| 256 kD golgin [Homo sapiens]                65   3e-09
gi|29468|emb|CAA35940.1| beta-myosin heavy chain (1151 AA) [Homo...    65   3e-09
gi|11276954|pir||A59234 slow myosin heavy chain 3 - quail >gnl|B...    65   3e-09
gi|2274851|dbj|BAA21515.1| 3-7 gene product [Homo sapiens]             65   3e-09
gi|6715600|ref|NP_002069.2| golgi autoantigen, golgin subfamily ...    65   3e-09
gi|39588370|emb|CAE72721.1| Hypothetical protein CBG19958 [Caeno...    65   3e-09
gi|547972|sp|P13392|MYSP_DIRIM Paramyosin >gnl|BL_ORD_ID|170237 ...    65   3e-09
gi|47605987|sp|P61584|ROC1_PANTR Rho-associated protein kinase 1...    65   4e-09
gi|34577114|ref|NP_056391.1| cytomatrix protein p110 [Homo sapiens]    65   4e-09
gi|15219336|ref|NP_178048.1| expressed protein [Arabidopsis thal...    65   4e-09
gi|34873054|ref|XP_231418.2| similar to male enhanced antigen 2/...    65   4e-09
gi|1173565|gb|AAC51791.1| golgin-245 [Homo sapiens] >gnl|BL_ORD_...    65   4e-09
gi|547976|sp|Q02171|MYSP_ONCVO Paramyosin >gnl|BL_ORD_ID|1266662...    65   4e-09
gi|422615|pir||A47297 myosin heavy chain form B, nonmuscle - Afr...    65   4e-09
gi|38488753|ref|NP_942118.1| myosin, heavy polypeptide 6, cardia...    65   4e-09
gi|477300|pir||A48575 paramyosin - nematode (Onchocerca volvulus)      65   4e-09
gi|20521019|dbj|BAA20832.2| KIAA0378 [Homo sapiens]                    65   4e-09
gi|33469071|ref|NP_031734.1| citron; citron kinase [Mus musculus...    65   4e-09
gi|5051743|dbj|BAA78718.1| Centrosome- and Golgi-localized PKN-a...    65   4e-09
gi|1345860|sp|P49025|CTRO_MOUSE Citron protein (Rho-interacting,...    65   4e-09
gi|34865346|ref|XP_216723.2| similar to ninein [Rattus norvegicus]     65   4e-09
gi|12855620|dbj|BAB30400.1| unnamed protein product [Mus musculus]     65   4e-09
gi|4885583|ref|NP_005397.1| Rho-associated, coiled-coil containi...    65   4e-09
gi|28422303|gb|AAH46881.1| Zgc:66156 protein [Danio rerio]             65   5e-09
gi|47229709|emb|CAG06905.1| unnamed protein product [Tetraodon n...    65   5e-09
gi|37604192|gb|AAH59863.1| Myh10 protein [Mus musculus]                65   5e-09
gi|15384839|emb|CAC59753.1| myosin heavy chain [Paracirrhites fo...    65   5e-09
gi|23508767|ref|NP_701435.1| hypothetical protein [Plasmodium fa...    65   5e-09
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di...    65   5e-09
gi|48130462|ref|XP_396665.1| similar to hypothetical protein [Ap...    65   5e-09
gi|28972888|dbj|BAC65860.1| mKIAA3005 protein [Mus musculus]           65   5e-09
gi|33598964|ref|NP_780469.1| myosin heavy chain 10, non-muscle; ...    65   5e-09
gi|15606061|ref|NP_213438.1| chromosome assembly protein homolog...    65   5e-09
gi|6323340|ref|NP_013412.1| Protein involved in vesicular transp...    64   6e-09
gi|24646174|ref|NP_650144.1| CG3532-PA [Drosophila melanogaster]...    64   6e-09
gi|6320145|ref|NP_010225.1| involved intracellular protein trans...    64   6e-09
gi|137175|sp|P25386|USO1_YEAST Intracellular protein transport p...    64   6e-09
gi|47213413|emb|CAF96073.1| unnamed protein product [Tetraodon n...    64   6e-09
gi|14192753|gb|AAK54395.1| myosin heavy chain [Trichinella spira...    64   6e-09
gi|23593319|ref|NP_703169.1| hypothetical protein [Plasmodium fa...    64   6e-09
gi|46432411|gb|EAK91894.1| hypothetical protein CaO19.13673 [Can...    64   6e-09
gi|32422023|ref|XP_331455.1| hypothetical protein [Neurospora cr...    64   6e-09
gi|20806787|ref|NP_621958.1| ATPase involved in DNA repair [Ther...    64   6e-09
gi|27227578|emb|CAD59406.1| SMC4 protein [Anopheles gambiae]           64   6e-09
gi|28972187|dbj|BAC65547.1| mKIAA0378 protein [Mus musculus]           64   6e-09
gi|7494317|pir||E71606 hypothetical protein PFB0765w - malaria p...    64   6e-09
gi|1903280|emb|CAA98620.1| USO1 [Saccharomyces cerevisiae]             64   6e-09
gi|38079397|ref|XP_357444.1| similar to ENSANGP00000010412 [Mus ...    64   6e-09
gi|31226222|ref|XP_317674.1| ENSANGP00000018543 [Anopheles gambi...    64   6e-09
gi|47211780|emb|CAF94090.1| unnamed protein product [Tetraodon n...    64   6e-09
gi|37360977|ref|NP_808482.2| CAZ-associated structural protein h...    64   6e-09
gi|22138113|gb|AAL07517.1| CAST1 [Rattus norvegicus]                   64   8e-09
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628...    64   8e-09
gi|30173370|sp|Q9ERA5|SMC4_MICAR Structural maintenance of chrom...    64   8e-09
gi|45387543|ref|NP_991115.1| Unknown (protein for MGC:77294); wu...    64   8e-09
gi|39591036|emb|CAE58816.1| Hypothetical protein CBG02025 [Caeno...    64   8e-09
gi|7446304|pir||T06048 kinesin-related protein katB - Arabidopsi...    64   8e-09
gi|9971579|dbj|BAB12571.1| myosin heavy chain [Pennahia argentata]     64   8e-09
gi|47229697|emb|CAG06893.1| unnamed protein product [Tetraodon n...    64   8e-09
gi|18416938|ref|NP_567768.1| kinesin-like protein B (KATB) [Arab...    64   8e-09
gi|10241756|emb|CAC09587.1| SMC4 protein [Microtus arvalis]            64   8e-09
gi|38177589|gb|AAF00096.2| ventricular myosin heavy chain [Danio...    64   8e-09
gi|127760|sp|P10567|MYSP_CAEEL Paramyosin >gnl|BL_ORD_ID|619234 ...    64   1e-08
gi|47205359|emb|CAF96150.1| unnamed protein product [Tetraodon n...    64   1e-08
gi|38073613|ref|XP_127084.3| thyroid hormone receptor interactor...    64   1e-08
gi|39586196|emb|CAE66607.1| Hypothetical protein CBG11932 [Caeno...    64   1e-08
gi|17509391|ref|NP_492085.1| paramyosin, UNCoordinated locomotio...    64   1e-08
gi|41053824|ref|NP_955874.1| hyaluronan mediated motility recept...    64   1e-08
gi|23489781|gb|EAA21707.1| hypothetical protein [Plasmodium yoel...    64   1e-08
gi|84472|pir||S04027 paramyosin - Caenorhabditis elegans               64   1e-08
gi|13431711|sp|Q90339|MYSS_CYPCA Myosin heavy chain, fast skelet...    64   1e-08
gi|38105537|gb|EAA51953.1| hypothetical protein MG03548.4 [Magna...    64   1e-08
gi|12667788|ref|NP_002464.1| myosin, heavy polypeptide 9, non-mu...    64   1e-08
gi|47208509|emb|CAF96454.1| unnamed protein product [Tetraodon n...    64   1e-08
gi|50728478|ref|XP_416138.1| PREDICTED: similar to Early endosom...    64   1e-08
gi|13928704|ref|NP_113708.1| myosin heavy chain 10, non-muscle; ...    64   1e-08
gi|7209643|dbj|BAA92289.1| myosin heavy chain [Seriola dumerili]       64   1e-08
gi|127751|sp|P02567|MYSD_CAEEL Myosin heavy chain D (MHC D) >gnl...    64   1e-08
gi|17508449|ref|NP_492053.1| MYOsin heavy chain structural gene,...    64   1e-08
gi|11138796|gb|AAG31484.1| paramyosin-like protein [Wuchereria b...    64   1e-08
gi|7496266|pir||T34107 hypothetical protein C18C4.5 - Caenorhabd...    63   1e-08
gi|29466|emb|CAA35941.1| fetal-myosin heavy chain (1437 AA) [Hom...    63   1e-08
gi|8923838|ref|NP_060041.1| hypothetical protein LOC55580 [Homo ...    63   1e-08
gi|25149352|ref|NP_741539.1| myosin heavy chain (5G32) [Caenorha...    63   1e-08
gi|2351219|dbj|BAA22067.1| myosin heavy chain [Cyprinus carpio]        63   1e-08
gi|547974|sp|P35417|MYSP_ECHGR Paramyosin >gnl|BL_ORD_ID|365607 ...    63   1e-08
gi|33620941|gb|AAM29663.2| Hypothetical protein C18C4.5b [Caenor...    63   1e-08
gi|27529744|dbj|BAA74889.2| KIAA0866 protein [Homo sapiens]            63   1e-08
gi|38348350|ref|NP_940927.1| similar to kinesin family member 21...    63   1e-08
gi|27469623|gb|AAH41716.1| MYH4 protein [Xenopus laevis]               63   1e-08
gi|3041707|sp|P13535|MYH8_HUMAN Myosin heavy chain, skeletal mus...    63   1e-08
gi|2104553|gb|AAC31665.1| Myosin heavy chain (MHY11) (5'partial)...    63   1e-08
gi|2119300|pir||I38055 myosin heavy chain, perinatal skeletal mu...    63   1e-08
gi|4505301|ref|NP_002463.1| myosin, heavy polypeptide 8, skeleta...    63   1e-08
gi|42559536|sp|Q9NJA9|MYSP_ANISI Paramyosin (Allergen Ani s 2) >...    63   1e-08
gi|47219756|emb|CAG03383.1| unnamed protein product [Tetraodon n...    63   1e-08
gi|47123036|gb|AAH70715.1| LOC431973 protein [Xenopus laevis]          63   1e-08
gi|50251369|dbj|BAD28396.1| putative serine/threonine-specific p...    63   1e-08
gi|13124879|ref|NP_002465.1| smooth muscle myosin heavy chain 11...    63   1e-08
gi|806511|dbj|BAA09067.1| myosin heavy chain [Cyprinus carpio]         63   1e-08
gi|677198|gb|AAB00143.1| putative                                      63   1e-08
gi|50368680|gb|AAH76678.1| Unknown (protein for MGC:79657) [Xeno...    63   1e-08
gi|25149347|ref|NP_741538.1| myosin heavy chain (5G32) [Caenorha...    63   1e-08
gi|4417214|dbj|BAA36971.1| smooth muscle myosin heavy chain [Hom...    63   1e-08
gi|13124875|ref|NP_074035.1| smooth muscle myosin heavy chain 11...    63   1e-08
gi|27807325|ref|NP_777259.1| myosin, heavy polypeptide 10, non-m...    63   1e-08
gi|15606017|ref|NP_213394.1| recombination protein RecN [Aquifex...    63   2e-08
gi|21489941|ref|NP_659210.1| myosin, heavy polypeptide 2, skelet...    63   2e-08
gi|47221621|emb|CAF97886.1| unnamed protein product [Tetraodon n...    63   2e-08
gi|6682321|emb|CAB64663.1| pedal retractor muscle myosin heavy c...    63   2e-08
gi|46390031|dbj|BAD16508.1| putative KIF4 [Oryza sativa (japonic...    63   2e-08
gi|37925239|gb|AAP59794.1| slow muscle myosin S1 heavy chain [Ho...    63   2e-08
gi|46390030|dbj|BAD16507.1| putative KIF4 [Oryza sativa (japonic...    63   2e-08
gi|28830050|gb|AAO52540.1| similar to Entamoeba histolytica. Myo...    63   2e-08
gi|7488926|pir||T14321 nuclear matrix constituent protein 1 - ca...    63   2e-08
gi|21750735|dbj|BAC03827.1| unnamed protein product [Homo sapiens]     62   2e-08
gi|47900428|gb|AAT39222.1| putative myosin heavy chain [Oryza sa...    62   2e-08
gi|477266|pir||A48467 myosin heavy chain - nematode (Brugia mala...    62   2e-08
gi|50749767|ref|XP_421748.1| PREDICTED: similar to CG5882-PA [Ga...    62   2e-08
gi|39598344|emb|CAE69037.1| Hypothetical protein CBG15043 [Caeno...    62   2e-08
gi|25150872|ref|NP_506347.2| similar to early endosome-associate...    62   2e-08
gi|836950|gb|AAC49006.1| CIP1 >gnl|BL_ORD_ID|452536 gi|1096881|p...    62   2e-08
gi|7507640|pir||T24806 hypothetical protein T10G3.5 - Caenorhabd...    62   2e-08
gi|109322|pir||A41604 myosin heavy chain, smooth muscle, long sp...    62   2e-08
gi|50308363|ref|XP_454183.1| unnamed protein product [Kluyveromy...    62   2e-08
gi|1346644|sp|P35748|MYHB_RABIT Myosin heavy chain, smooth muscl...    62   2e-08
gi|49274652|gb|AAT58679.1| unknown protein [Oryza sativa (japoni...    62   2e-08
gi|50423079|ref|XP_460118.1| unnamed protein product [Debaryomyc...    62   2e-08
gi|34870888|ref|XP_340819.1| similar to myosin heavy chain 2b [R...    62   2e-08
gi|38347761|dbj|BAD01606.1| myosin heavy chain [Lethenteron japo...    62   2e-08
gi|24286605|gb|AAN46661.1| M protein precursor [Streptococcus py...    62   3e-08
gi|46431250|gb|EAK90848.1| hypothetical protein CaO19.2629 [Cand...    62   3e-08
gi|40218526|gb|AAR83180.1| LPXTG anchored putative adhesin [Stre...    62   3e-08
gi|34911958|ref|NP_917326.1| putative myosin heavy chain-like pr...    62   3e-08
gi|38086933|ref|XP_133575.3| kinesin family member 7 [Mus musculus]    62   3e-08
gi|7657037|ref|NP_055705.1| downregulated in ovarian cancer 1 is...    62   3e-08
gi|625305|pir||A61231 myosin heavy chain nonmuscle form A - human      62   3e-08
gi|46433735|gb|EAK93166.1| hypothetical protein CaO19.6148 [Cand...    62   3e-08
gi|50417102|gb|AAH77134.1| Unknown (protein for MGC:100899) [Dan...    62   3e-08
gi|2119533|pir||I52300 giantin - human >gnl|BL_ORD_ID|1705043 gi...    62   3e-08
gi|49523259|gb|AAH75407.1| Unknown (protein for MGC:89159) [Xeno...    62   3e-08
gi|189036|gb|AAA36349.1| nonmuscle myosin heavy chain (NMHC)           62   3e-08
gi|103260|pir||D35815 myosin heavy chain 4, muscle - fruit fly (...    62   3e-08
gi|24644332|ref|NP_730971.1| CG31551-PA [Drosophila melanogaster...    62   3e-08
gi|627059|pir||A45592 liver stage antigen LSA-1 - malaria parasi...    62   3e-08
gi|38636442|emb|CAE81978.1| related to vesicular transport prote...    62   3e-08
gi|4758454|ref|NP_004478.1| golgi autoantigen, golgin subfamily ...    62   3e-08
gi|32417180|ref|XP_329068.1| hypothetical protein [Neurospora cr...    62   3e-08
gi|7669506|ref|NP_005954.2| myosin, heavy polypeptide 1, skeleta...    62   3e-08
gi|42660674|ref|XP_377369.1| similar to hypothetical protein FLJ...    62   3e-08
gi|12247751|gb|AAG50019.1| M protein precursor [Streptococcus py...    62   3e-08
gi|31198813|ref|XP_308354.1| ENSANGP00000024069 [Anopheles gambi...    62   4e-08
gi|103256|pir||A35815 myosin heavy chain 1, muscle - fruit fly (...    62   4e-08
gi|103258|pir||B35815 myosin heavy chain 2, muscle - fruit fly (...    62   4e-08
gi|47208342|emb|CAF88490.1| unnamed protein product [Tetraodon n...    62   4e-08
gi|39597779|emb|CAE68471.1| Hypothetical protein CBG14270 [Caeno...    62   4e-08
gi|47847498|dbj|BAD21421.1| mFLJ00279 protein [Mus musculus]           62   4e-08
gi|30025501|gb|AAP04414.1| KIF27B [Homo sapiens]                       62   4e-08
gi|13161382|dbj|BAB32977.1| lamin B3 [Carassius auratus]               62   4e-08
gi|21930292|gb|AAF23015.2| ninein [Homo sapiens]                       62   4e-08
gi|33946313|ref|NP_057434.3| ninein isoform 4; GSK3B-interacting...    62   4e-08
gi|50591389|ref|ZP_00332703.1| COG1196: Chromosome segregation A...    62   4e-08
gi|15238181|ref|NP_198994.1| COP1-interactive protein 1 / CIP1 [...    62   4e-08
gi|33946321|ref|NP_891991.1| ninein isoform 5; GSK3B-interacting...    62   4e-08
gi|21930287|gb|AAG33512.2| ninein-Lm isoform [Homo sapiens]            62   4e-08
gi|13929120|ref|NP_113978.1| postsynaptic density protein (citro...    62   4e-08
gi|33946317|ref|NP_891989.1| ninein isoform 1; GSK3B-interacting...    62   4e-08
gi|42658064|ref|XP_376656.1| hypothetical protein FLJ22037 [Homo...    62   4e-08
gi|42658517|ref|XP_379895.1| similar to superfast myosin heavy c...    62   4e-08
gi|21623523|dbj|BAC00871.1| myosin heavy chain [Oncorhynchus keta]     62   4e-08
gi|21907898|dbj|BAC05679.1| myosin heavy chain 2a [Equus caballus]     62   4e-08
gi|41350446|gb|AAS00505.1| fast skeletal muscle myosin heavy cha...    62   4e-08
gi|24584714|ref|NP_724009.1| CG17927-PL [Drosophila melanogaster...    62   4e-08
gi|24584716|ref|NP_724010.1| CG17927-PM [Drosophila melanogaster...    62   4e-08
gi|24584712|ref|NP_724008.1| CG17927-PK [Drosophila melanogaster...    62   4e-08
gi|33946319|ref|NP_891990.1| ninein isoform 3; GSK3B-interacting...    62   4e-08
gi|103259|pir||C35815 myosin heavy chain 3, muscle - fruit fly (...    62   4e-08
gi|2546937|emb|CAA37309.1| muscle myosin heavy chain [Drosophila...    62   4e-08
gi|482955|pir||B32491 myosin heavy chain 2, muscle - fruit fly (...    62   4e-08
gi|24584702|ref|NP_724004.1| CG17927-PD [Drosophila melanogaster...    62   4e-08
gi|28574239|ref|NP_523587.4| CG17927-PH [Drosophila melanogaster...    62   4e-08
gi|20455497|sp|P05661|MYSA_DROME Myosin heavy chain, muscle            62   4e-08
gi|24584706|ref|NP_724006.1| CG17927-PI [Drosophila melanogaster...    62   4e-08
gi|24584694|ref|NP_724000.1| CG17927-PG [Drosophila melanogaster...    62   4e-08
gi|15242952|ref|NP_200041.1| protein transport protein-related [...    62   4e-08
gi|24584700|ref|NP_724003.1| CG17927-PF [Drosophila melanogaster...    62   4e-08
gi|24584692|ref|NP_723999.1| CG17927-PC [Drosophila melanogaster...    62   4e-08
gi|157892|gb|AAA28687.1| myosin heavy chain                            62   4e-08
gi|24584696|ref|NP_724001.1| CG17927-PE [Drosophila melanogaster...    62   4e-08
gi|157891|gb|AAA28686.1| myosin heavy chain                            62   4e-08
gi|24584704|ref|NP_724005.1| CG17927-PA [Drosophila melanogaster...    62   4e-08
gi|24584710|ref|NP_724007.1| CG17927-PB [Drosophila melanogaster...    62   4e-08
gi|20137006|ref|NP_071855.1| myosin heavy chain IX [Mus musculus...    62   4e-08
gi|31198815|ref|XP_308355.1| ENSANGP00000009410 [Anopheles gambi...    62   4e-08
gi|34870892|ref|XP_340820.1| similar to Myosin heavy chain, skel...    62   4e-08
gi|24584698|ref|NP_724002.1| CG17927-PJ [Drosophila melanogaster...    62   4e-08
gi|50757613|ref|XP_415578.1| PREDICTED: similar to myosin heavy ...    62   4e-08
gi|13775212|ref|NP_112583.1| polyamine modulated factor 1 bindin...    62   4e-08
gi|33946315|ref|NP_065972.2| ninein isoform 2; GSK3B-interacting...    62   4e-08
gi|23508409|ref|NP_701078.1| hypothetical protein [Plasmodium fa...    62   4e-08
gi|482280|pir||A32491 myosin heavy chain 1, muscle - fruit fly (...    62   4e-08
gi|1346637|sp|P02565|MYH3_CHICK Myosin heavy chain, fast skeleta...    62   4e-08
gi|21907900|dbj|BAC05680.1| myosin heavy chain 2x [Equus caballus]     62   4e-08
gi|11024712|ref|NP_060003.1| myosin, heavy polypeptide 4, skelet...    62   4e-08
gi|7494144|pir||T18372 repeat organellar protein - Plasmodium ch...    62   4e-08
gi|13560269|dbj|BAB40920.1| myosin heavy chain 2a [Bos taurus]         62   4e-08
gi|13431707|sp|Q28641|MYH4_RABIT Myosin heavy chain, skeletal mu...    62   4e-08
gi|86358|pir||A29320 myosin heavy chain, fast skeletal muscle, e...    62   4e-08
gi|47605964|sp|O77819|ROC1_RABIT Rho-associated protein kinase 1...    62   4e-08
gi|23613557|ref|NP_704578.1| hypothetical protein [Plasmodium fa...    61   5e-08
gi|23479124|gb|EAA16038.1| repeat organellar protein-related [Pl...    61   5e-08
gi|6225510|sp|P97779|HMMR_RAT HYALURONAN MEDIATED MOTILITY RECEP...    61   5e-08
gi|3986196|dbj|BAA34955.1| myosin heavy chain [Dugesia japonica]       61   5e-08
gi|45382109|ref|NP_990097.1| myosin heavy chain [Gallus gallus] ...    61   5e-08
gi|50756157|ref|XP_415041.1| PREDICTED: similar to CDC42-binding...    61   5e-08
gi|46437104|gb|EAK96456.1| hypothetical protein CaO19.10613 [Can...    61   5e-08
gi|50557322|ref|XP_506069.1| hypothetical protein [Yarrowia lipo...    61   5e-08
gi|47205442|emb|CAG05719.1| unnamed protein product [Tetraodon n...    61   5e-08
gi|3851160|gb|AAC72234.1| cp431 [Rattus norvegicus]                    61   5e-08
gi|39590394|emb|CAE66133.1| Hypothetical protein CBG11357 [Caeno...    61   5e-08
gi|47210728|emb|CAF95759.1| unnamed protein product [Tetraodon n...    61   5e-08
gi|50309061|ref|XP_454536.1| unnamed protein product [Kluyveromy...    61   5e-08
gi|38091413|ref|XP_354615.1| myosin, heavy polypeptide 1, skelet...    61   5e-08
gi|34870880|ref|XP_340818.1| myosin, heavy polypeptide 4 [Rattus...    61   5e-08
gi|34870884|ref|XP_213345.2| similar to Myosin heavy chain, skel...    61   5e-08
gi|34856033|ref|XP_218617.2| similar to nonmuscle myosin heavy c...    61   5e-08
gi|47206494|emb|CAF92339.1| unnamed protein product [Tetraodon n...    61   5e-08
gi|35505155|gb|AAH57227.1| Unknown (protein for IMAGE:4702419) [...    61   5e-08
gi|50730576|ref|XP_425585.1| PREDICTED: similar to GRIP coiled-c...    61   5e-08
gi|42476190|ref|NP_060004.2| myosin, heavy polypeptide 2, skelet...    61   5e-08
gi|13431716|sp|Q9UKX2|MYH2_HUMAN Myosin heavy chain, skeletal mu...    61   5e-08
gi|5360750|dbj|BAA82146.1| myosin heavy chain 2x [Sus scrofa]          61   5e-08
gi|3915779|sp|P13539|MYH6_MESAU Myosin heavy chain, cardiac musc...    61   5e-08
gi|479891|pir||S35575 myosin heavy chain, cardiac muscle - chick...    61   7e-08
gi|15644384|ref|NP_229436.1| conserved hypothetical protein [The...    61   7e-08
gi|47230685|emb|CAF99878.1| unnamed protein product [Tetraodon n...    61   7e-08
gi|50256527|gb|EAL19252.1| hypothetical protein CNBH3510 [Crypto...    61   7e-08
gi|49618681|gb|AAT67990.1| ninein-like protein [Xenopus laevis]        61   7e-08
gi|47059017|ref|NP_037096.2| hyaluronan mediated motility recept...    61   7e-08
gi|23613114|ref|NP_703436.1| chromosome condensation protein, pu...    61   7e-08
gi|266596|sp|P29616|MYSC_CHICK Myosin heavy chain, cardiac muscl...    61   7e-08
gi|33086618|gb|AAP92621.1| Ac2-154 [Rattus norvegicus]                 61   7e-08
gi|26351889|dbj|BAC39581.1| unnamed protein product [Mus musculus]     61   7e-08
gi|45383668|ref|NP_989559.1| myosin, heavy polypeptide 2, skelet...    61   7e-08
gi|13549083|gb|AAK29628.1| Rho-associated coiled coil forming ki...    61   7e-08
gi|50512294|ref|NP_694514.2| myosin, heavy polypeptide 2, fast m...    61   7e-08
gi|32408715|ref|XP_324838.1| hypothetical protein [Neurospora cr...    61   7e-08
gi|47213344|emb|CAF92967.1| unnamed protein product [Tetraodon n...    61   7e-08
gi|50746971|ref|XP_420699.1| PREDICTED: similar to testis specif...    61   7e-08
gi|17553764|ref|NP_497706.1| protein kinase beta like (3E511) [C...    61   7e-08
gi|50745035|ref|XP_419954.1| PREDICTED: similar to Rho-associate...    61   7e-08
gi|47222189|emb|CAG11615.1| unnamed protein product [Tetraodon n...    61   7e-08
gi|46227810|gb|EAK88730.1| SMC1 structural maintenance of chromo...    61   7e-08
gi|34860343|ref|XP_230784.2| similar to centrosomal Nek2-associa...    61   7e-08
gi|41386691|ref|NP_776542.1| myosin, heavy polypeptide 1, skelet...    61   7e-08
gi|22121649|gb|AAM88909.1| fast myosin heavy chain HCII [Gallus ...    61   7e-08
gi|31235868|ref|XP_319313.1| ENSANGP00000023782 [Anopheles gambi...    60   9e-08
gi|24762818|ref|NP_726506.1| CG15792-PB [Drosophila melanogaster...    60   9e-08
gi|2351221|dbj|BAA22068.1| myosin heavy chain [Cyprinus carpio]        60   9e-08
gi|23509283|ref|NP_701950.1| hypothetical protein [Plasmodium fa...    60   9e-08
gi|31235874|ref|XP_319314.1| ENSANGP00000022367 [Anopheles gambi...    60   9e-08
gi|15643938|ref|NP_228987.1| chromosome segregation SMC protein,...    60   9e-08
gi|31235881|ref|XP_319315.1| ENSANGP00000024583 [Anopheles gambi...    60   9e-08
gi|31235848|ref|XP_319310.1| ENSANGP00000024621 [Anopheles gambi...    60   9e-08
gi|31235842|ref|XP_319309.1| ENSANGP00000024129 [Anopheles gambi...    60   9e-08
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p...    60   9e-08
gi|34902382|ref|NP_912537.1| Putative kinesin-related protein [O...    60   9e-08
gi|50729652|ref|XP_416601.1| PREDICTED: similar to RIKEN cDNA 49...    60   9e-08
gi|18391490|ref|NP_563924.1| nuclear matrix constituent protein-...    60   9e-08
gi|7441404|pir||T16416 hypothetical protein F52B10.1 - Caenorhab...    60   9e-08
gi|18204753|gb|AAH21427.1| Hmmr protein [Mus musculus]                 60   9e-08
gi|4502781|ref|NP_001804.1| centromere protein E; Centromere aut...    60   9e-08
gi|382658|prf||1819485A CENP-E protein                                 60   9e-08
gi|16804929|ref|NP_472958.1| hypothetical protein [Plasmodium fa...    60   9e-08
gi|25150354|ref|NP_508504.2| non-muscle myosin (nmy-1) [Caenorha...    60   9e-08
gi|24762816|ref|NP_523860.2| CG15792-PA [Drosophila melanogaster...    60   9e-08
gi|1777305|dbj|BAA19070.1| myosin heavy chain [Theragra chalcogr...    60   9e-08
gi|18652658|gb|AAD28718.2| myosin heavy chain A [Schmidtea medit...    60   9e-08
gi|31235885|ref|XP_319316.1| ENSANGP00000023510 [Anopheles gambi...    60   9e-08
gi|31235852|ref|XP_319311.1| ENSANGP00000022605 [Anopheles gambi...    60   9e-08
gi|31235859|ref|XP_319312.1| ENSANGP00000025304 [Anopheles gambi...    60   9e-08
gi|31235836|ref|XP_319308.1| ENSANGP00000012555 [Anopheles gambi...    60   9e-08
gi|33325035|gb|AAQ08177.1| GPBP-interacting protein A [Homo sapi...    60   1e-07
gi|42556335|gb|AAS19756.1| myosin heavy chain [Gasterosteus acul...    60   1e-07
gi|16081854|ref|NP_394249.1| chromosome segregation protein rela...    60   1e-07
gi|437191|gb|AAA50854.1| M5.8193 protein                               60   1e-07
gi|17533739|ref|NP_494819.1| M protein repeat containing protein...    60   1e-07
gi|28278258|gb|AAH46212.1| Similar to cytomatrix protein p110 [H...    60   1e-07
gi|6981236|ref|NP_037326.1| myosin, heavy polypeptide 9; Myosin,...    60   1e-07
gi|19851917|gb|AAL99918.1| CLL-associated antigen KW-11 [Homo sa...    60   1e-07
gi|45198804|ref|NP_985833.1| AFR286Wp [Eremothecium gossypii] >g...    60   1e-07
gi|50757621|ref|XP_415581.1| PREDICTED: similar to fast myosin h...    60   1e-07
gi|5360748|dbj|BAA82145.1| myosin heavy chain 2b [Sus scrofa]          60   1e-07
gi|33667105|ref|NP_878913.1| downregulated in ovarian cancer 1 i...    60   1e-07
gi|40788217|dbj|BAA20794.2| KIAA0336 [Homo sapiens]                    60   1e-07
gi|50746907|ref|XP_420670.1| PREDICTED: similar to Centromeric p...    60   1e-07
gi|3668187|dbj|BAA33452.1| myosin heavy chain [Theragra chalcogr...    60   1e-07
gi|31563507|ref|NP_852118.1| GRIP coiled-coil protein GCC185 iso...    60   1e-07
gi|33325039|gb|AAQ08179.1| GPBP-interacting protein C [Homo sapi...    60   1e-07
gi|33325037|gb|AAQ08178.1| GPBP-interacting protein B [Homo sapi...    60   1e-07
gi|47216947|emb|CAG04889.1| unnamed protein product [Tetraodon n...    60   1e-07
gi|20380754|gb|AAH27860.1| DOC1 protein [Homo sapiens]                 60   1e-07
gi|7705839|ref|NP_057206.1| NY-REN-58 antigen [Homo sapiens] >gn...    60   1e-07
gi|23508469|ref|NP_701138.1| hypothetical protein [Plasmodium fa...    60   1e-07
gi|11321579|ref|NP_003793.1| myosin, heavy polypeptide 13, skele...    60   1e-07
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa...    60   1e-07
gi|25408221|pir||F84730 probable myosin heavy chain [imported] -...    60   1e-07
gi|47125165|gb|AAH70659.1| LOC431812 protein [Xenopus laevis]          60   1e-07
gi|5360746|dbj|BAA82144.1| myosin heavy chain 2a [Sus scrofa]          60   1e-07
gi|32565065|ref|NP_872028.1| M protein repeat containing protein...    60   1e-07
gi|16805082|ref|NP_473111.1| liver stage antigen 3 [Plasmodium f...    60   1e-07
gi|420071|pir||A43336 microtubule-vesicle linker CLIP-170 - huma...    60   1e-07
gi|38044112|ref|NP_937883.1| restin isoform b; cytoplasmic linke...    60   1e-07
gi|48133166|ref|XP_393334.1| similar to myosin heavy chain 2, mu...    60   1e-07
gi|806513|dbj|BAA09068.1| myosin heavy chain [Cyprinus carpio]         60   1e-07
gi|4506751|ref|NP_002947.1| restin isoform a; cytoplasmic linker...    60   1e-07
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi...    60   1e-07
gi|34860939|ref|XP_217691.2| similar to DNA segment, Chr 3, ERAT...    60   1e-07
gi|23612484|ref|NP_704045.1| hypothetical protein [Plasmodium fa...    60   1e-07
gi|17533741|ref|NP_494820.1| M protein repeat containing protein...    60   1e-07
gi|17568557|ref|NP_510648.1| intermediate Filament, A (67.1 kD) ...    60   1e-07
gi|38347763|dbj|BAD01607.1| myosin heavy chain [Lethenteron japo...    60   1e-07
gi|34896156|ref|NP_909422.1| P0701D05.33 [Oryza sativa (japonica...    60   1e-07
gi|17533743|ref|NP_494821.1| M protein repeat containing protein...    60   1e-07
gi|6688931|emb|CAB65343.1| liver stage antigen-3 [Plasmodium fal...    60   1e-07
gi|50749502|ref|XP_421665.1| PREDICTED: similar to hypothetical ...    60   1e-07
gi|5817598|gb|AAD52842.1| myosin heavy chain [Pecten maximus]          60   1e-07
gi|37515173|gb|AAQ91890.1| Hypothetical protein ZC8.4d [Caenorha...    59   2e-07
gi|1572482|gb|AAB09050.1| nonmuscle myosin-II heavy chain [Droso...    59   2e-07
gi|12657350|emb|CAC27776.1| myosin heavy chain [Notothenia corii...    59   2e-07
gi|16758474|ref|NP_446109.1| CDC42-binding protein kinase alpha;...    59   2e-07
gi|11385652|gb|AAG34907.1| CTCL tumor antigen se20-7 [Homo sapiens]    59   2e-07
gi|28375557|emb|CAD66602.1| SMC protein [Pyrococcus furiosus]          59   2e-07
gi|50510675|dbj|BAD32323.1| mKIAA0866 protein [Mus musculus]           59   2e-07
gi|1572481|gb|AAB09049.1| nonmuscle myosin-II heavy chain [Droso...    59   2e-07
gi|2119295|pir||S61477 myosin II heavy chain, non-muscle - fruit...    59   2e-07
gi|50284899|ref|XP_444877.1| unnamed protein product [Candida gl...    59   2e-07
gi|37360930|dbj|BAC98374.1| KIAA2034 protein [Homo sapiens]            59   2e-07
gi|31982906|ref|NP_116255.2| hypothetical protein FLJ14957 [Homo...    59   2e-07
gi|34978672|gb|AAQ83577.1| lactoferrin binding protein [Streptoc...    59   2e-07
gi|7510855|pir||T29999 hypothetical protein ZC8.4 - Caenorhabdit...    59   2e-07
gi|50405040|ref|YP_054132.1| hypothetical protein PTMB.204c [Par...    59   2e-07
gi|29421206|dbj|BAB21840.2| KIAA1749 protein [Homo sapiens]            59   2e-07
gi|50288085|ref|XP_446471.1| unnamed protein product [Candida gl...    59   2e-07
gi|36507|emb|CAA49154.1| smooth muscle mysosin heavy chain [Homo...    59   2e-07
gi|547969|sp|Q99323|MYSN_DROME Myosin heavy chain, non-muscle (Z...    59   2e-07
gi|22218336|ref|NP_032935.1| periplakin; 195-kD protein; 195kDa ...    59   2e-07
gi|1572480|gb|AAB09048.1| nonmuscle myosin-II heavy chain [Droso...    59   2e-07
gi|1141790|gb|AAB09051.1| nonmuscle myosin-II heavy chain [Droso...    59   2e-07
gi|17570563|ref|NP_508847.1| major antigen like (XF611) [Caenorh...    59   2e-07
gi|20070691|gb|AAH26142.1| Myh11 protein [Mus musculus]                59   2e-07
gi|13431676|sp|O08638|MYHB_MOUSE Myosin heavy chain, smooth musc...    59   2e-07
gi|157953|gb|AAA28713.1| non-muscle myosin heavy chain                 59   2e-07
gi|7662062|ref|NP_055450.1| GRIP coiled-coil protein GCC185 isof...    59   2e-07
gi|46437031|gb|EAK96384.1| hypothetical protein CaO19.3100 [Cand...    59   2e-07
gi|25151529|ref|NP_508848.2| major antigen like (273.8 kD) (XF61...    59   2e-07
gi|47210347|emb|CAF90604.1| unnamed protein product [Tetraodon n...    59   2e-07
gi|7509394|pir||T26467 hypothetical protein Y11D7A.14 - Caenorha...    59   2e-07
gi|28077007|ref|NP_082559.1| nuclear membrane binding protein NU...    59   2e-07
gi|9800488|gb|AAF99315.1| fast myosin heavy chain isoform 3 [Gal...    59   2e-07
gi|32566156|ref|NP_501620.2| myosin head  and M protein repeat (...    59   2e-07
gi|23379831|gb|AAM88910.1| fast myosin heavy chain HCIII [Gallus...    59   2e-07
gi|50510991|dbj|BAD32481.1| mKIAA1561 protein [Mus musculus]           59   2e-07
gi|38091410|ref|XP_354614.1| myosin, heavy polypeptide 3, skelet...    59   2e-07
gi|6981234|ref|NP_036736.1| myosin, heavy polypeptide 3; Myosin,...    59   2e-07
gi|20891813|ref|XP_147228.1| myosin heavy chain 11, smooth muscl...    59   2e-07
gi|50757921|ref|XP_425359.1| PREDICTED: similar to Myosin heavy ...    59   2e-07
gi|1842051|gb|AAB47555.1| myosin heavy chain [Gallus gallus]           59   2e-07
gi|7305295|ref|NP_038635.1| myosin heavy chain 11, smooth muscle...    59   2e-07
gi|18978215|ref|NP_579572.1| chromosome segregation protein smc ...    59   2e-07
gi|86355|pir||JX0178 myosin heavy chain, fast skeletal muscle, a...    59   2e-07
gi|13432175|sp|P13538|MYSS_CHICK Myosin heavy chain, skeletal mu...    59   2e-07
gi|39580984|emb|CAE72954.1| Hypothetical protein CBG20286 [Caeno...    59   3e-07
gi|7305145|ref|NP_038580.1| hyaluronan mediated motility recepto...    59   3e-07
gi|42557661|emb|CAF28780.1| FYVE and coiled-coil [Gallus gallus]       59   3e-07
gi|31203693|ref|XP_310795.1| ENSANGP00000023103 [Anopheles gambi...    59   3e-07
gi|1495187|emb|CAA45849.1| HA receptor for hyaluronic acid [Mus ...    59   3e-07
gi|42520218|ref|NP_966133.1| hypothetical protein WD0335 [Wolbac...    59   3e-07
gi|17540328|ref|NP_500790.1| coiled-coil protein, similar to yea...    59   3e-07
gi|7416982|gb|AAF62394.1| myosin heavy chain cardiac muscle spec...    59   3e-07
gi|25396050|pir||C88690 protein F41H10.4 [imported] - Caenorhabd...    59   3e-07
gi|7416980|gb|AAF62392.1| myosin heavy chain catch (smooth) musc...    59   3e-07
gi|13376689|ref|NP_079390.1| hypothetical protein FLJ13615 [Homo...    59   3e-07
gi|1495186|emb|CAA45848.1| HA receptor for hyaluronic acid [Mus ...    59   3e-07
gi|7505675|pir||T32092 hypothetical protein K09F6.6 - Caenorhabd...    59   3e-07
gi|49068802|ref|XP_398690.1| hypothetical protein UM01075.1 [Ust...    59   3e-07
gi|42660665|ref|XP_208835.4| similar to hypothetical protein FLJ...    59   3e-07
gi|50416526|gb|AAH77739.1| Unknown (protein for MGC:78831) [Xeno...    59   3e-07
gi|7416983|gb|AAF62395.1| myosin heavy chain cardiac muscle spec...    59   3e-07
gi|37534452|ref|NP_921528.1| putative centromere protein [Oryza ...    59   3e-07
gi|50757733|ref|XP_415624.1| PREDICTED: similar to acyl-CoA oxid...    59   3e-07
gi|497653|gb|AAC46490.1| myosin heavy chain >gnl|BL_ORD_ID|76853...    59   3e-07


>gi|17565748|ref|NP_504160.1| myosin heavy like (50.1 kD) (5E646)
            [Caenorhabditis elegans]
 gi|15145452|gb|AAK84606.1| Hypothetical protein Y45G5AM.7
            [Caenorhabditis elegans]
          Length = 433

 Score =  843 bits (2177), Expect = 0.0
 Identities = 433/433 (100%), Positives = 433/433 (100%)
 Frame = -1

Query: 1302 MDETQRSVPGSNSSLVRDPEIERLAPVSVKGSDKYTAIFQDLKASWKKYTDLEDGERIAA 1123
            MDETQRSVPGSNSSLVRDPEIERLAPVSVKGSDKYTAIFQDLKASWKKYTDLEDGERIAA
Sbjct: 1    MDETQRSVPGSNSSLVRDPEIERLAPVSVKGSDKYTAIFQDLKASWKKYTDLEDGERIAA 60

Query: 1122 ILRDNSVENEVELLSKMSENEIADLFRVKLRKVAILEEENDQLHRRNRDLSHRLHLVEHR 943
            ILRDNSVENEVELLSKMSENEIADLFRVKLRKVAILEEENDQLHRRNRDLSHRLHLVEHR
Sbjct: 61   ILRDNSVENEVELLSKMSENEIADLFRVKLRKVAILEEENDQLHRRNRDLSHRLHLVEHR 120

Query: 942  VGKAQIVVMEKVEKATGHIIQEFHERELDLARNVEILQEENSNLTAKNEKLEETVDDLHE 763
            VGKAQIVVMEKVEKATGHIIQEFHERELDLARNVEILQEENSNLTAKNEKLEETVDDLHE
Sbjct: 121  VGKAQIVVMEKVEKATGHIIQEFHERELDLARNVEILQEENSNLTAKNEKLEETVDDLHE 180

Query: 762  KVANLETSNKELTEINVDNERKISNSSDEIFSLQDLLGKTKVQLEEETEKVLQERTIVEN 583
            KVANLETSNKELTEINVDNERKISNSSDEIFSLQDLLGKTKVQLEEETEKVLQERTIVEN
Sbjct: 181  KVANLETSNKELTEINVDNERKISNSSDEIFSLQDLLGKTKVQLEEETEKVLQERTIVEN 240

Query: 582  LKAQFLKERKESTEKIELIQKEAEDYRKRIEEDIRNRQQRHKKEVDAHQEKFSATVNHQN 403
            LKAQFLKERKESTEKIELIQKEAEDYRKRIEEDIRNRQQRHKKEVDAHQEKFSATVNHQN
Sbjct: 241  LKAQFLKERKESTEKIELIQKEAEDYRKRIEEDIRNRQQRHKKEVDAHQEKFSATVNHQN 300

Query: 402  AVIEELTQTVKQKQSEIAELKDQLEKQESRIKGDLKRGLAADYRQKLGMVSSLDTHPIRT 223
            AVIEELTQTVKQKQSEIAELKDQLEKQESRIKGDLKRGLAADYRQKLGMVSSLDTHPIRT
Sbjct: 301  AVIEELTQTVKQKQSEIAELKDQLEKQESRIKGDLKRGLAADYRQKLGMVSSLDTHPIRT 360

Query: 222  PLYENPFYEWNQENRKRNERAQCPPSPQRTLGIQTSADLAPAAAPVTSTKPRQLGNQKNV 43
            PLYENPFYEWNQENRKRNERAQCPPSPQRTLGIQTSADLAPAAAPVTSTKPRQLGNQKNV
Sbjct: 361  PLYENPFYEWNQENRKRNERAQCPPSPQRTLGIQTSADLAPAAAPVTSTKPRQLGNQKNV 420

Query: 42   KFTSSGRLPSHRK 4
            KFTSSGRLPSHRK
Sbjct: 421  KFTSSGRLPSHRK 433




[DB home][top]