Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y47G6A_9
         (1149 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17510005|ref|NP_491168.1| flap (42.5 kD) (1E51) [Caenorhabdit...   657   0.0
gi|39598273|emb|CAE68965.1| Hypothetical protein CBG14945 [Caeno...   551   e-155
gi|37362214|gb|AAQ91235.1| flap structure-specific endonuclease ...   449   e-125
gi|49619155|gb|AAT68162.1| flap structure specific endonuclease ...   443   e-123
gi|1549393|gb|AAB08478.1| XFEN1b [Xenopus laevis]                     434   e-120
gi|2674207|gb|AAB88707.1| flap endonuclease 1 [Xenopus laevis]        431   e-119
gi|1490870|gb|AAB06176.1| 5' nuclease xFEN1a [Xenopus laevis] >g...   430   e-119
gi|4758356|ref|NP_004102.1| flap structure-specific endonuclease...   426   e-118
gi|31227272|ref|XP_317855.1| ENSANGP00000014920 [Anopheles gambi...   426   e-118
gi|15778123|dbj|BAB68507.1| FEN-1 nuclease [Gallus gallus]            426   e-118
gi|20071071|gb|AAH27295.1| Fen1 protein [Mus musculus]                421   e-116
gi|46048490|ref|NP_032025.2| flap structure specific endonucleas...   421   e-116
gi|16758170|ref|NP_445882.1| flap structure-specific endonucleas...   421   e-116
gi|26345786|dbj|BAC36544.1| unnamed protein product [Mus musculus]    421   e-116
gi|26335423|dbj|BAC31412.1| unnamed protein product [Mus musculus]    419   e-116
gi|17647423|ref|NP_523765.1| CG8648-PA [Drosophila melanogaster]...   417   e-115
gi|13506617|gb|AAK01853.1| flap endonuclease-1 [Mus musculus]         406   e-112
gi|729476|sp|P39749|FEN1_MOUSE Flap endonuclease-1 >gnl|BL_ORD_I...   406   e-112
gi|19115884|ref|NP_594972.1| dna repair protein Rad2p [Schizosac...   387   e-106
gi|42570539|ref|NP_850877.2| endonuclease, putative [Arabidopsis...   379   e-104
gi|46439119|gb|EAK98441.1| hypothetical protein CaO19.547 [Candi...   379   e-104
gi|50424755|ref|XP_460967.1| unnamed protein product [Debaryomyc...   374   e-102
gi|4587225|dbj|BAA36171.1| FEN-1 [Oryza sativa (japonica cultiva...   368   e-100
gi|6322736|ref|NP_012809.1| 5' to 3' exonuclease, 5' flap endonu...   360   3e-98
gi|50292567|ref|XP_448716.1| unnamed protein product [Candida gl...   359   8e-98
gi|49274673|gb|AAT58700.1| putative flap endonuclease 1 [Oryza s...   357   3e-97
gi|49090880|ref|XP_406901.1| hypothetical protein AN2764.2 [Aspe...   350   3e-95
gi|50556476|ref|XP_505646.1| hypothetical protein [Yarrowia lipo...   349   6e-95
gi|49079856|ref|XP_403527.1| hypothetical protein UM05912.1 [Ust...   343   4e-93
gi|46138549|ref|XP_390965.1| conserved hypothetical protein [Gib...   335   2e-90
gi|38105388|gb|EAA51824.1| hypothetical protein MG03419.4 [Magna...   332   8e-90
gi|23489735|gb|EAA21673.1| flap endonuclease-1-related [Plasmodi...   332   1e-89
gi|50310391|ref|XP_455215.1| unnamed protein product [Kluyveromy...   329   6e-89
gi|7446863|pir||T01198 endonuclease homolog F21E10.3 - Arabidops...   327   2e-88
gi|32421241|ref|XP_331064.1| hypothetical protein [Neurospora cr...   326   5e-88
gi|9885425|gb|AAG01445.1| flap endonuclease-1 [Plasmodium falcip...   323   6e-87
gi|23510075|ref|NP_702741.1| flap exonuclease, putative [Plasmod...   323   6e-87
gi|37719664|gb|AAR01941.1| flap endonuclease 1 [Plasmodium falci...   322   8e-87
gi|29467052|dbj|BAC66965.1| flap endonuclease-1b [Oryza sativa (...   320   5e-86
gi|40714676|gb|AAR88582.1| flap endonuclease-1b [Oryza sativa (j...   318   1e-85
gi|19173066|ref|NP_597617.1| STRUCTURE-SPECIFIC ENDONUCLEASE OF ...   299   7e-80
gi|38488751|ref|NP_942115.1| flap structure-specific endonucleas...   282   1e-74
gi|50258446|gb|EAL21135.1| hypothetical protein CNBD5110 [Crypto...   280   3e-74
gi|46092541|dbj|BAD14303.1| flap endonuclease-1 [Coprinopsis cin...   273   7e-72
gi|29249952|gb|EAA41454.1| GLP_422_59630_60715 [Giardia lamblia ...   258   2e-67
gi|14520948|ref|NP_126423.1| DNA repair protein RAD2 [Pyrococcus...   235   1e-60
gi|24987745|pdb|1MC8|A Chain A, Crystal Structure Of Flap Endonu...   234   2e-60
gi|14591211|ref|NP_143287.1| 5' nuclease [Pyrococcus horikoshii ...   234   2e-60
gi|45185178|ref|NP_982895.1| ABL052Cp [Eremothecium gossypii] >g...   234   3e-60
gi|18977786|ref|NP_579143.1| flap structure-specific endonucleas...   230   4e-59
gi|20094004|ref|NP_613851.1| 5'-3' exonuclease [Methanopyrus kan...   219   9e-56
gi|14600460|ref|NP_146975.1| flap endonuclease-1 [Aeropyrum pern...   201   3e-50
gi|28380025|sp|Q9YFY5|FEN_AERPE Flap structure-specific endonucl...   201   3e-50
gi|18312112|ref|NP_558779.1| DNA endonuclease rad2 homolog [Pyro...   199   8e-50
gi|15679628|ref|NP_276745.1| DNA repair protein Rad2 [Methanothe...   198   2e-49
gi|20092799|ref|NP_618874.1| FlaP endonuclease-1 [Methanosarcina...   198   2e-49
gi|47212193|emb|CAF90074.1| unnamed protein product [Tetraodon n...   198   2e-49
gi|28380021|sp|Q980U8|FEN_SULSO Flap structure-specific endonucl...   197   5e-49
gi|21227008|ref|NP_632930.1| FLAP endonuclease-1 [Methanosarcina...   194   3e-48
gi|48841306|ref|ZP_00298232.1| COG0258: 5'-3' exonuclease (inclu...   193   6e-48
gi|41614884|ref|NP_963382.1| NEQ088 [Nanoarchaeum equitans Kin4-...   190   5e-47
gi|46063345|gb|AAS79704.1| putative endonuclease [Oryza sativa (...   189   8e-47
gi|11497880|ref|NP_069102.1| DNA repair protein RAD2 (rad2) [Arc...   188   2e-46
gi|28380019|sp|Q976H6|FEN_SULTO Flap structure-specific endonucl...   179   1e-43
gi|15669635|ref|NP_248448.1| DNA repair protein RAD2 (rad2) [Met...   177   5e-43
gi|16082069|ref|NP_394495.1| DNA repair protein RAD2 related pro...   174   5e-42
gi|48477300|ref|YP_023006.1| RAD-2/FEN-1 exonuclease [Picrophilu...   173   6e-42
gi|15897130|ref|NP_341735.1| DNA repair endo/exonuclease FEN-1 (...   172   1e-41
gi|48852128|ref|ZP_00306319.1| COG0258: 5'-3' exonuclease (inclu...   167   3e-40
gi|45358876|ref|NP_988433.1| flap endonuclease [Methanococcus ma...   164   4e-39
gi|13541391|ref|NP_111079.1| 5'-3' exonuclease [Thermoplasma vol...   154   4e-36
gi|15920393|ref|NP_376062.1| 304aa long hypothetical flap endonu...   153   6e-36
gi|48104378|ref|XP_395769.1| similar to CG8648-PA [Apis mellifera]    144   3e-33
gi|47180383|emb|CAG14230.1| unnamed protein product [Tetraodon n...   119   1e-25
gi|15790386|ref|NP_280210.1| DNA repair protein; Rad2 [Halobacte...   111   3e-23
gi|47227957|emb|CAF97586.1| unnamed protein product [Tetraodon n...   108   2e-22
gi|16804952|ref|NP_472981.1| DNA repair endonuclease, putative [...   106   9e-22
gi|34880965|ref|XP_222932.2| similar to exonuclease 1 [Rattus no...   100   1e-19
gi|49073011|ref|XP_400756.1| hypothetical protein UM03141.1 [Ust...    99   1e-19
gi|46434429|gb|EAK93839.1| hypothetical protein CaO19.8904 [Cand...    99   1e-19
gi|23485391|gb|EAA20406.1| XPG I-region, putative [Plasmodium yo...    99   2e-19
gi|3170238|gb|AAC32259.1| Hex1 [Homo sapiens] >gnl|BL_ORD_ID|904...    99   2e-19
gi|39995069|ref|NP_003677.3| exonuclease 1 isoform a; rad2 nucle...    99   2e-19
gi|3445182|gb|AAC32424.1| Hex1 [Homo sapiens] >gnl|BL_ORD_ID|322...    99   2e-19
gi|3513573|gb|AAC33874.1| exonuclease I [Homo sapiens]                 99   2e-19
gi|4249655|gb|AAD13754.1| exonuclease I [Homo sapiens]                 99   2e-19
gi|3822433|gb|AAC69879.1| exonuclease Ib [Homo sapiens] >gnl|BL_...    99   2e-19
gi|18491016|ref|NP_569082.1| exonuclease 1 isoform b; rad2 nucle...    99   2e-19
gi|49091422|ref|XP_407172.1| hypothetical protein AN3035.2 [Aspe...    98   3e-19
gi|31560511|ref|NP_036142.2| exonuclease 1 [Mus musculus] >gnl|B...    98   3e-19
gi|5689874|emb|CAB51863.1| exonuclease 1 homologue [Mus musculus]      98   3e-19
gi|50740755|ref|XP_419550.1| PREDICTED: similar to exonuclease 1...    94   5e-18
gi|50427729|ref|XP_462477.1| unnamed protein product [Debaryomyc...    94   5e-18
gi|19074876|ref|NP_586382.1| EXONUCLEASE 1 [Encephalitozoon cuni...    94   6e-18
gi|38101551|gb|EAA48497.1| hypothetical protein MG00155.4 [Magna...    93   1e-17
gi|32414609|ref|XP_327784.1| hypothetical protein [Neurospora cr...    92   2e-17
gi|38102331|gb|EAA49183.1| hypothetical protein MG00841.4 [Magna...    92   3e-17
gi|4884906|gb|AAD31867.1| exonuclease ExoI [Xenopus laevis]            91   5e-17
gi|49095784|ref|XP_409353.1| hypothetical protein AN5216.2 [Aspe...    89   2e-16
gi|45198651|ref|NP_985680.1| AFR133Cp [Eremothecium gossypii] >g...    89   2e-16
gi|47087335|ref|NP_998634.1| zgc:55521 [Danio rerio] >gnl|BL_ORD...    88   3e-16
gi|15220506|ref|NP_174256.1| exonuclease, putative [Arabidopsis ...    87   6e-16
gi|48104074|ref|XP_395708.1| similar to ENSANGP00000021102 [Apis...    87   7e-16
gi|50553030|ref|XP_503925.1| hypothetical protein [Yarrowia lipo...    87   7e-16
gi|6321697|ref|NP_011774.1| Single-stranded DNA endonuclease, cl...    87   7e-16
gi|31209645|ref|XP_313789.1| ENSANGP00000012281 [Anopheles gambi...    87   9e-16
gi|50302949|ref|XP_451412.1| unnamed protein product [Kluyveromy...    86   1e-15
gi|34910036|ref|NP_916365.1| putative exonuclease [Oryza sativa ...    86   2e-15
gi|23482332|gb|EAA18344.1| structure-specific endonuclease of th...    85   3e-15
gi|23507884|ref|NP_700554.1| endonuclease, putative [Plasmodium ...    85   3e-15
gi|50287803|ref|XP_446331.1| unnamed protein product [Candida gl...    84   6e-15
gi|46125331|ref|XP_387219.1| hypothetical protein FG07043.1 [Gib...    84   8e-15
gi|50259717|gb|EAL22387.1| hypothetical protein CNBB5600 [Crypto...    83   1e-14
gi|32410927|ref|XP_325944.1| hypothetical protein [Neurospora cr...    83   1e-14
gi|267421|sp|P14629|XPG_XENLA DNA-repair protein complementing X...    82   2e-14
gi|50416246|gb|AAH77363.1| XPGC protein [Xenopus laevis]               82   2e-14
gi|50551183|ref|XP_503065.1| hypothetical protein [Yarrowia lipo...    82   2e-14
gi|15079080|ref|NP_149832.1| 369L [Invertebrate iridescent virus...    82   3e-14
gi|50745055|ref|XP_419963.1| PREDICTED: similar to RIKEN cDNA 58...    82   3e-14
gi|47207240|emb|CAF92263.1| unnamed protein product [Tetraodon n...    81   4e-14
gi|48142177|ref|XP_393585.1| similar to ENSANGP00000021368 [Apis...    80   7e-14
gi|34558672|gb|AAQ75078.1| RAD2 [Cryptosporidium parvum]               80   9e-14
gi|46226699|gb|EAK87678.1| XPG, DNA excision repair protein, fla...    80   9e-14
gi|19112842|ref|NP_596050.1| exonuclease i [Schizosaccharomyces ...    80   1e-13
gi|49074810|ref|XP_401513.1| hypothetical protein UM03898.1 [Ust...    79   3e-13
gi|19173283|ref|NP_597086.1| similarity to DNA repair protein RA...    79   3e-13
gi|21619256|gb|AAH31522.1| XPG-complementing protein [Homo sapie...    79   3e-13
gi|4503601|ref|NP_000114.1| XPG-complementing protein; excision-...    79   3e-13
gi|306742|gb|AAC37533.1| excision repair protein >gnl|BL_ORD_ID|...    79   3e-13
gi|9587154|gb|AAF89179.1| xeroderma pigmentosum complementation ...    79   3e-13
gi|50422801|ref|XP_459977.1| unnamed protein product [Debaryomyc...    78   3e-13
gi|1419489|emb|CAA61430.1| Tosca [Drosophila melanogaster]             78   4e-13
gi|6175466|sp|P35689|XPG_MOUSE DNA-repair protein complementing ...    78   4e-13
gi|6756023|ref|NP_035859.1| excision repair cross-complementing ...    78   4e-13
gi|15291899|gb|AAK93218.1| LD31018p [Drosophila melanogaster]          77   8e-13
gi|17137168|ref|NP_477145.1| CG10387-PA [Drosophila melanogaster...    77   8e-13
gi|26326927|dbj|BAC27207.1| unnamed protein product [Mus musculus]     77   8e-13
gi|31542023|ref|NP_796305.2| RIKEN cDNA 5830483C08 gene [Mus mus...    77   1e-12
gi|47271493|ref|NP_872431.2| hypothetical protein FLJ40869 [Homo...    77   1e-12
gi|31206581|ref|XP_312255.1| ENSANGP00000021102 [Anopheles gambi...    76   1e-12
gi|46438448|gb|EAK97778.1| hypothetical protein CaO19.926 [Candi...    75   2e-12
gi|2135184|pir||I58009 gene ERCC5 protein - human >gnl|BL_ORD_ID...    75   2e-12
gi|50730663|ref|XP_425590.1| PREDICTED: similar to DNA-repair pr...    75   3e-12
gi|422055|pir||S30301 excision repair protein - fission yeast (S...    75   4e-12
gi|9930001|dbj|BAB12157.1| hypothetical protein [Macaca fascicul...    74   5e-12
gi|25513625|pir||F86150 F22M8.2 protein - Arabidopsis thaliana >...    74   5e-12
gi|15223502|ref|NP_171691.1| DNA repair protein, putative [Arabi...    74   5e-12
gi|19112887|ref|NP_596095.1| dna repair protein rad13 [Schizosac...    74   5e-12
gi|11994123|dbj|BAB01125.1| unnamed protein product [Arabidopsis...    73   1e-11
gi|18405624|ref|NP_566830.1| UV hypersensitive protein (UVH3) / ...    73   1e-11
gi|19113794|ref|NP_592882.1| putative excision repair endonuclea...    73   1e-11
gi|5688955|dbj|BAA82754.1| DNA repair protein RAD2 [Red sea brea...    72   2e-11
gi|31237931|ref|XP_319693.1| ENSANGP00000021368 [Anopheles gambi...    72   2e-11
gi|24658219|ref|NP_647943.2| CG10670-PA [Drosophila melanogaster...    72   2e-11
gi|5679043|gb|AAD46833.1| GM10765p [Drosophila melanogaster] >gn...    72   2e-11
gi|50309395|ref|XP_454705.1| unnamed protein product [Kluyveromy...    72   2e-11
gi|47230549|emb|CAF99742.1| unnamed protein product [Tetraodon n...    72   2e-11
gi|46117088|ref|XP_384562.1| hypothetical protein FG04386.1 [Gib...    72   3e-11
gi|6320469|ref|NP_010549.1| Mitochondrial nuclease functioning i...    72   3e-11
gi|5758314|gb|AAD50779.1| XPG [Drosophila melanogaster]                71   5e-11
gi|28574067|ref|NP_788002.1| CG32956-PB [Drosophila melanogaster...    71   5e-11
gi|5712619|gb|AAD47568.1| DNA repair endonuclease [Drosophila me...    71   5e-11
gi|50261003|gb|EAL23653.1| hypothetical protein CNBA3000 [Crypto...    71   5e-11
gi|5758316|gb|AAD50780.1| XPG variant [Drosophila melanogaster]        71   5e-11
gi|28574071|ref|NP_788001.1| CG32956-PD [Drosophila melanogaster...    71   5e-11
gi|19881432|ref|NP_612249.1| putative DNA repair protein [infect...    70   1e-10
gi|39595717|emb|CAE67220.1| Hypothetical protein CBG12657 [Caeno...    70   1e-10
gi|50289437|ref|XP_447150.1| unnamed protein product [Candida gl...    69   2e-10
gi|17553464|ref|NP_499770.1| exonuclease I (72.1 kD) (3O513) [Ca...    69   2e-10
gi|7503488|pir||T22235 hypothetical protein F45G2.3 - Caenorhabd...    69   2e-10
gi|34875746|ref|XP_217387.2| similar to XPG [Rattus norvegicus]        69   2e-10
gi|5689765|emb|CAB52135.1| Nucleotide excision repair protein [D...    67   8e-10
gi|18767721|ref|NP_572012.1| putative DNA repair protein RAD2 [R...    67   1e-09
gi|30685678|ref|NP_849684.1| exonuclease, putative [Arabidopsis ...    66   1e-09
gi|18394573|ref|NP_564047.1| exonuclease, putative [Arabidopsis ...    66   1e-09
gi|49237393|ref|YP_031674.1| putative DNA repair protein RAD2 [F...    66   2e-09
gi|47201249|emb|CAF87424.1| unnamed protein product [Tetraodon n...    65   2e-09
gi|45686018|ref|YP_003781.1| DNA repair enzyme RAD2 [Regina rana...    65   4e-09
gi|17507747|ref|NP_491891.1| excision repair (1H135) [Caenorhabd...    65   4e-09
gi|14091405|gb|AAK53745.1| P8.141B [Regina ranavirus]                  65   4e-09
gi|9719724|gb|AAF97826.1| Contains similarity to exonuclease Exo...    65   4e-09
gi|6324607|ref|NP_014676.1| 5'-3' exonuclease and flap-endonucle...    63   1e-08
gi|39586573|emb|CAE73700.1| Hypothetical protein CBG21211 [Caeno...    62   3e-08
gi|32398743|emb|CAD98703.1| XPG (rad-related) exonuclease, possi...    62   3e-08
gi|22655212|gb|AAM98196.1| exonuclease, putative [Arabidopsis th...    61   6e-08
gi|45190988|ref|NP_985242.1| AER387Cp [Eremothecium gossypii] >g...    59   2e-07
gi|26325914|dbj|BAC26711.1| unnamed protein product [Mus musculus]     59   2e-07
gi|13358436|ref|NP_078767.1| Putative XPG/RAD2-type nuclease [Ly...    59   2e-07
gi|38110433|gb|EAA56149.1| hypothetical protein MG01800.4 [Magna...    58   5e-07
gi|34863334|ref|XP_233966.2| similar to CG10670-PA [Rattus norve...    57   6e-07
gi|41117713|ref|XP_371477.1| similar to RIKEN cDNA 5830483C08 ge...    57   8e-07
gi|50423057|ref|XP_460107.1| unnamed protein product [Debaryomyc...    57   8e-07
gi|16923283|dbj|BAB72003.1| single-strand DNA endonuclease-1 [Or...    56   1e-06
gi|18376035|emb|CAD21041.1| related to DNA repair endonuclease r...    55   2e-06
gi|17555016|ref|NP_498361.1| excision repair (49.6 kD) (3H336) [...    55   2e-06
gi|32404418|ref|XP_322822.1| hypothetical protein [Neurospora cr...    55   2e-06
gi|39594873|emb|CAE70741.1| Hypothetical protein CBG17486 [Caeno...    55   4e-06
gi|50302247|ref|XP_451057.1| unnamed protein product [Kluyveromy...    54   5e-06
gi|41719600|ref|ZP_00148476.1| COG0258: 5'-3' exonuclease (inclu...    54   7e-06
gi|2506365|sp|P80194|DPO1_THECA DNA polymerase I, thermostable (...    53   1e-05
gi|50259619|gb|EAL22290.1| hypothetical protein CNBC0040 [Crypto...    52   2e-05
gi|46198998|ref|YP_004665.1| DNA polymerase I [Thermus thermophi...    52   3e-05
gi|1097211|prf||2113329A DNA polymerase                                52   3e-05
gi|1706502|sp|P52028|DPOT_THETH DNA polymerase I, thermostable (...    52   3e-05
gi|46433375|gb|EAK92818.1| hypothetical protein CaO19.8267 [Cand...    52   3e-05
gi|49075846|ref|XP_401959.1| hypothetical protein UM04344.1 [Ust...    51   6e-05
gi|19073960|ref|NP_584566.1| hypothetical protein [Encephalitozo...    51   6e-05
gi|18310976|ref|NP_562910.1| DNA polymerase I [Clostridium perfr...    50   8e-05
gi|46433350|gb|EAK92794.1| hypothetical protein CaO19.652 [Candi...    50   1e-04
gi|25402838|pir||C86316 protein T10O22.7 [imported] - Arabidopsi...    50   1e-04
gi|47224621|emb|CAG03605.1| unnamed protein product [Tetraodon n...    48   5e-04
gi|16801060|ref|NP_471328.1| similar to 5'-3' exonuclease [Liste...    47   6e-04
gi|16803920|ref|NP_465405.1| similar to 5'-3' exonuclease [Liste...    47   6e-04
gi|42522378|ref|NP_967758.1| DNA polymerase I [Bdellovibrio bact...    47   8e-04
gi|49072378|ref|XP_400478.1| hypothetical protein UM02863.1 [Ust...    46   0.001
gi|46908113|ref|YP_014502.1| 5'-3' exonuclease family protein [L...    46   0.001
gi|47094187|ref|ZP_00231903.1| 5'-3' exonuclease family protein ...    46   0.001
gi|12001920|gb|AAG43103.1| DNA polymerase I [Rhodococcus sp. ATC...    46   0.001
gi|23099618|ref|NP_693084.1| DNA polymerase I [Oceanobacillus ih...    46   0.002
gi|50553730|ref|XP_504276.1| hypothetical protein [Yarrowia lipo...    46   0.002
gi|49091724|ref|XP_407323.1| hypothetical protein AN3186.2 [Aspe...    45   0.003
gi|29250007|gb|EAA41508.1| GLP_623_40575_38077 [Giardia lamblia ...    45   0.003
gi|50259892|gb|EAL22560.1| hypothetical protein CNBB4370 [Crypto...    45   0.003
gi|23612622|ref|NP_704183.1| exonuclease i, putative [Plasmodium...    45   0.004
gi|38146979|gb|AAR11874.1| DNA polymerase I [Thermoanaerobacteri...    44   0.005
gi|17978836|gb|AAL47553.1| DNA polymerase [Thermoanaerobacter yo...    44   0.005
gi|20807355|ref|NP_622526.1| DNA polymerase I - 3'-5' exonucleas...    44   0.005
gi|45198756|ref|NP_985785.1| AFR238Wp [Eremothecium gossypii] >g...    44   0.005
gi|32420289|ref|XP_330588.1| hypothetical protein [Neurospora cr...    44   0.009
gi|98023|pir||A32949 DNA-directed DNA polymerase (EC 2.7.7.7) - ...    43   0.016
gi|15902076|ref|NP_357626.1| DNA polymerase I [Streptococcus pne...    43   0.016
gi|622944|gb|AAA60376.1| gene 3' to GLN3; similar to protein Yer...    42   0.021
gi|49483630|ref|YP_040854.1| putative 5'-3' exonuclease [Staphyl...    42   0.021
gi|21283058|ref|NP_646146.1| ORFID:MW1329~hypothetical protein, ...    42   0.021
gi|15924430|ref|NP_371964.1| hypothetical protein SAV1440 [Staph...    42   0.021
gi|3913510|sp|O52225|DPO1_THEFI DNA polymerase I, thermostable (...    42   0.021
gi|15899978|ref|NP_344582.1| DNA polymerase I [Streptococcus pne...    42   0.021
gi|5805306|gb|AAD51936.1| mutant nucleotide excision repair prot...    42   0.021
gi|6320880|ref|NP_010959.1| Protein of unknown function, has sim...    42   0.021
gi|38146983|gb|AAR11876.1| DNA polymerase I [Thermus filiformis]       42   0.027
gi|232010|sp|P30313|DPOF_THETH DNA polymerase I, thermostable (T...    42   0.035
gi|50285691|ref|XP_445274.1| unnamed protein product [Candida gl...    42   0.035
gi|7512638|pir||T12524 hypothetical protein DKFZp434L013.1 - hum...    41   0.046
gi|50365399|ref|YP_053824.1| DNA polymerase I [Mesoplasma florum...    41   0.046
gi|15894383|ref|NP_347732.1| DNA polymerase I, polA [Clostridium...    41   0.046
gi|24378800|ref|NP_720755.1| DNA polymerase I (POL I) [Streptoco...    41   0.046
gi|28211720|ref|NP_782664.1| DNA polymerase I [Clostridium tetan...    41   0.060
gi|45547575|ref|ZP_00187621.1| COG0749: DNA polymerase I - 3'-5'...    41   0.060
gi|15608767|ref|NP_216145.1| polA [Mycobacterium tuberculosis H3...    40   0.078
gi|1205984|gb|AAB52611.1| DNA polymerase I                             40   0.10
gi|2231821|gb|AAB62092.1| DNA  polymerase I [Geobacillus stearot...    40   0.10
gi|42783764|ref|NP_981011.1| DNA polymerase I [Bacillus cereus A...    40   0.10
gi|21402630|ref|NP_658615.1| DNA_pol_A, DNA polymerase family A ...    40   0.10
gi|49481342|ref|YP_038632.1| DNA polymerase I [Bacillus thuringi...    40   0.10
gi|47564997|ref|ZP_00236040.1| DNA polymerase I [Bacillus cereus...    40   0.10
gi|49187477|ref|YP_030729.1| DNA polymerase I [Bacillus anthraci...    40   0.10
gi|23024946|ref|ZP_00064132.1| COG0749: DNA polymerase I - 3'-5'...    40   0.10
gi|1942938|pdb|1TAQ|  Structure Of Taq Dna Polymerase                  40   0.13
gi|2098289|pdb|1TAU|A Chain A, Structure Of Dna Polymerase             40   0.13
gi|118828|sp|P19821|DPO1_THEAQ DNA polymerase I, thermostable (T...    40   0.13
gi|416913|sp|Q04957|DPO1_BACCA DNA polymerase I (POL I) >gnl|BL_...    39   0.17
gi|507891|dbj|BAA06775.1| DNA Polymerase [Thermus aquaticus]           39   0.17
gi|1084022|pir||JX0359 DNA-directed DNA polymerase (EC 2.7.7.7) ...    39   0.17
gi|12001922|gb|AAG43104.1| DNA polymerase I [Brachyspira hyodyse...    39   0.17
gi|30022662|ref|NP_834293.1| DNA polymerase I [Bacillus cereus A...    39   0.17
gi|21674485|ref|NP_662550.1| DNA polymerase I [Chlorobium tepidu...    39   0.23
gi|15674124|ref|NP_268299.1| DNA polymerase I [Lactococcus lacti...    39   0.23
gi|48858410|ref|ZP_00312365.1| COG0749: DNA polymerase I - 3'-5'...    39   0.23
gi|2126855|pir||S70368 DNA polymerase I - Bacillus stearothermop...    39   0.30
gi|3041672|sp|P52026|DPO1_BACST DNA polymerase I (POL I)               39   0.30
gi|9587153|gb|AAF89178.1| xeroderma pigmentosum complementation ...    39   0.30
gi|26332843|dbj|BAC30139.1| unnamed protein product [Mus musculus]     39   0.30
gi|755588|gb|AAA85558.1| DNA polymerase                                39   0.30
gi|825732|emb|CAA50481.1| xeroderma pigmentosum group G compleme...    39   0.30
gi|1363435|pir||JC4286 DNA-directed DNA polymerase (EC 2.7.7.7) ...    39   0.30
gi|23111782|ref|ZP_00097364.1| COG0749: DNA polymerase I - 3'-5'...    38   0.39
gi|6706268|emb|CAB65931.1| possible exonuclease [Leishmania major]     38   0.39
gi|38146965|gb|AAR11867.1| DNA polymerase I [Bacillus caldolyticus]    38   0.39
gi|16079961|ref|NP_390787.1| DNA polymerase I [Bacillus subtilis...    38   0.51
gi|6015003|sp|O32801|DPO1_LACLC DNA polymerase I (POL I) >gnl|BL...    38   0.51
gi|22325428|ref|NP_178359.2| exonuclease family protein [Arabido...    37   0.66
gi|22536572|ref|NP_687423.1| DNA polymerase I [Streptococcus aga...    37   0.66
gi|7487810|pir||T00608 hypothetical protein At2g02550 [imported]...    37   0.66
gi|39939162|ref|NP_950928.1| 5'-3' exonuclease [Onion yellows ph...    37   0.86
gi|41407420|ref|NP_960256.1| PolA [Mycobacterium avium subsp. pa...    37   0.86
gi|13508118|ref|NP_110067.1| 5'-3' exonuclease (complete) [Mycop...    37   1.1
gi|50591450|ref|ZP_00332761.1| COG0749: DNA polymerase I - 3'-5'...    37   1.1
gi|22298882|ref|NP_682129.1| DNA polymerase I [Thermosynechococc...    36   1.5
gi|15674390|ref|NP_268564.1| DNA-directed DNA polymerase I [Stre...    36   1.5
gi|19745349|ref|NP_606485.1| DNA-directed DNA polymerase I [Stre...    36   1.5
gi|23099156|ref|NP_692622.1| 5'-3' exonuclease [Oceanobacillus i...    36   1.5
gi|21909681|ref|NP_663949.1| DNA-directed DNA polymerase I [Stre...    36   1.9
gi|42520815|ref|NP_966730.1| DNA polymerase I [Wolbachia endosym...    36   1.9
gi|31544437|ref|NP_853015.1| Exo [Mycoplasma gallisepticum R] >g...    36   1.9
gi|15615715|ref|NP_244019.1| DNA polymerase I [Bacillus halodura...    35   2.5
gi|42527145|ref|NP_972243.1| DNA polymerase I [Treponema dentico...    35   2.5
gi|20094124|ref|NP_613971.1| DNA-directed RNA polymerase second-...    35   2.5
gi|37702659|gb|AAR00931.1| DNA polymerase I [Bacillus subtilis]        35   3.3
gi|45525440|ref|ZP_00176674.1| COG0749: DNA polymerase I - 3'-5'...    35   3.3
gi|15614743|ref|NP_243046.1| 5'-3' exonuclease [Bacillus halodur...    35   3.3
gi|16079259|ref|NP_390083.1| ypcP [Bacillus subtilis subsp. subt...    35   4.3
gi|29839896|ref|NP_829002.1| DNA polymerase I [Chlamydophila cav...    35   4.3
gi|23612374|ref|NP_703954.1| SET-domain protein, putative [Plasm...    34   5.6
gi|46361248|emb|CAG25109.1| SET-domain protein, putative; putati...    34   5.6
gi|24373120|ref|NP_717163.1| exodeoxyribonuclease IX [Shewanella...    34   5.6
gi|32130563|gb|AAF24859.3| DNA polymerase I [Thermomicrobium ros...    34   5.6
gi|29569818|gb|AAO85272.1| DNA polymerase I [Thermomicrobium ros...    34   5.6
gi|26553652|ref|NP_757586.1| DNA polymerase I: 5'-3' exonuclease...    34   7.3
gi|12002010|gb|AAG43148.1| DNA polymerase I [Rhodococcus erythro...    34   7.3
gi|15617030|ref|NP_240243.1| DNA polymerase I [Buchnera aphidico...    34   7.3
gi|27262526|gb|AAN87544.1| DNA polymerase I [Heliobacillus mobilis]    34   7.3
gi|46442045|gb|EAL01337.1| hypothetical protein CaO19.10181 [Can...    34   7.3
gi|42408993|dbj|BAD10248.1| putative ethylene-insensitive protei...    34   7.3
gi|48850156|ref|ZP_00304398.1| COG0749: DNA polymerase I - 3'-5'...    33   9.5
gi|16331949|ref|NP_442677.1| DNA polymerase I [Synechocystis sp....    33   9.5
gi|42565846|ref|NP_190773.2| 5'-3' exonuclease family protein [A...    33   9.5
gi|42572637|ref|NP_974414.1| 5'-3' exonuclease family protein [A...    33   9.5
gi|41689392|ref|ZP_00145926.1| COG3850: Signal transduction hist...    33   9.5
gi|15606454|ref|NP_213834.1| putative protein [Aquifex aeolicus ...    33   9.5


>gi|17510005|ref|NP_491168.1| flap (42.5 kD) (1E51) [Caenorhabditis
            elegans]
 gi|7331965|gb|AAF60653.1| Cell-death-related nuclease protein 1
            [Caenorhabditis elegans]
 gi|31747251|gb|AAP57297.1| cell death-related nuclease 1
            [Caenorhabditis elegans]
          Length = 382

 Score =  657 bits (1695), Expect = 0.0
 Identities = 331/353 (93%), Positives = 331/353 (93%)
 Frame = +1

Query: 1    MGIKGLSQVIADNAPSAIKVNEMKAFFGRTVAIDASMCLYQFLIAVRQDGSQLQSEDGET 180
            MGIKGLSQVIADNAPSAIKVNEMKAFFGRTVAIDASMCLYQFLIAVRQDGSQLQSEDGET
Sbjct: 1    MGIKGLSQVIADNAPSAIKVNEMKAFFGRTVAIDASMCLYQFLIAVRQDGSQLQSEDGET 60

Query: 181  TSHLMGMLNRTVRMFENGVKPVYVFDGKPPDMKGGXXXXXXXXXXXXXXXXXXXXXXGDV 360
            TSHLMGMLNRTVRMFENGVKPVYVFDGKPPDMKGG                      GDV
Sbjct: 61   TSHLMGMLNRTVRMFENGVKPVYVFDGKPPDMKGGELEKRSERRAEAEKALTEAKEKGDV 120

Query: 361  KEAEKFERRLVKVTKQQNDEAKRLLGLMGIPVVEAPCEAEAQCAHLVKAGKVFGTVTEDM 540
            KEAEKFERRLVKVTKQQNDEAKRLLGLMGIPVVEAPCEAEAQCAHLVKAGKVFGTVTEDM
Sbjct: 121  KEAEKFERRLVKVTKQQNDEAKRLLGLMGIPVVEAPCEAEAQCAHLVKAGKVFGTVTEDM 180

Query: 541  DALTFGSTVLLRHFLAPVAKKIPIKEFNLSLALEEMKLSVEEFIDLCILLGCDYCGTIRG 720
            DALTFGSTVLLRHFLAPVAKKIPIKEFNLSLALEEMKLSVEEFIDLCILLGCDYCGTIRG
Sbjct: 181  DALTFGSTVLLRHFLAPVAKKIPIKEFNLSLALEEMKLSVEEFIDLCILLGCDYCGTIRG 240

Query: 721  VGPKKAVELIRQHKNIETILENIDQNKYPPPEDWPYKRARELFLNPEVTKPEEVELTWKE 900
            VGPKKAVELIRQHKNIETILENIDQNKYPPPEDWPYKRARELFLNPEVTKPEEVELTWKE
Sbjct: 241  VGPKKAVELIRQHKNIETILENIDQNKYPPPEDWPYKRARELFLNPEVTKPEEVELTWKE 300

Query: 901  ADVEGVIQFLCGEKNFNEERIRNALAKLKTSRKSGTQGRIDSFFGNSTKVTCV 1059
            ADVEGVIQFLCGEKNFNEERIRNALAKLKTSRKSGTQGRIDSFFGNSTKVTCV
Sbjct: 301  ADVEGVIQFLCGEKNFNEERIRNALAKLKTSRKSGTQGRIDSFFGNSTKVTCV 353




[DB home][top]