Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y48E1B_11
(2067 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17537259|ref|NP_496854.1| agkisacutacin like (2N882) [Caenorh... 1273 0.0
gi|38422761|emb|CAE54926.1| Hypothetical protein Y48E1B.16 [Caen... 575 e-162
gi|38422762|emb|CAB07697.2| Hypothetical protein Y48E1B.9 [Caeno... 323 1e-86
gi|39591271|emb|CAE73324.1| Hypothetical protein CBG20753 [Caeno... 303 8e-81
gi|50507836|emb|CAE54925.2| Hypothetical protein Y48E1B.15 [Caen... 290 1e-76
gi|39591273|emb|CAE73326.1| Hypothetical protein CBG20755 [Caeno... 271 3e-71
gi|39591204|emb|CAE73257.1| Hypothetical protein CBG20673 [Caeno... 84 2e-14
gi|39579732|emb|CAE56482.1| Hypothetical protein CBG24196 [Caeno... 74 1e-11
gi|17554010|ref|NP_497267.1| predicted CDS, receptor II (3B447) ... 59 6e-07
gi|3023230|sp|P81112|ABA2_TRIAB Alboaggregin A subunit 2 52 6e-05
gi|18252680|gb|AAL66391.1| antithrombin 1 A chain [Deinagkistrod... 52 7e-05
gi|47218860|emb|CAG02845.1| unnamed protein product [Tetraodon n... 52 7e-05
gi|45382743|ref|NP_990815.1| hepatic lectin [Gallus gallus] >gnl... 51 9e-05
gi|23321261|gb|AAN23125.1| agglucetin-alpha 2 subunit precursor ... 51 9e-05
gi|4808981|gb|AAD30041.1| receptor protein-tyrosine kinase; HTK2... 50 2e-04
gi|2134244|pir||JC5058 bitiscetin alpha chain - puff adder >gnl|... 50 2e-04
gi|11277029|pir||JC7135 agkisacutacin beta chain precursor - sha... 49 4e-04
gi|33341194|gb|AAQ15158.1| stejaggregin-B beta chain-1 [Trimeres... 49 5e-04
gi|23321263|gb|AAN23126.1| agglucetin-beta 1 subunit precursor [... 49 5e-04
gi|33341196|gb|AAQ15159.1| stejaggregin-B beta chain-2 [Trimeres... 49 5e-04
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n... 49 5e-04
gi|7505170|pir||T16526 hypothetical protein K02F3.5 - Caenorhabd... 49 5e-04
gi|39581146|emb|CAE71003.1| Hypothetical protein CBG17839 [Caeno... 49 5e-04
gi|6715115|gb|AAF26287.1| agkisacutacin B chain [Deinagkistrodon... 48 8e-04
gi|20562939|gb|AAM22787.1| C-type lectin [Deinagkistrodon acutus... 48 8e-04
gi|1364010|pir||JC4329 coagulation factor IX-binding protein A c... 47 0.001
gi|33243102|gb|AAQ01221.1| C-type lectin CTL-7 [Echis pyramidum ... 47 0.001
gi|1839441|gb|AAB47092.1| platelet glycoprotein Ib-binding prote... 47 0.001
gi|12583677|dbj|BAB21452.1| factor XI/factor X binding protein A... 47 0.002
gi|3212543|pdb|1IXX|A Chain A, Crystal Structure Of Coagulation ... 47 0.002
gi|2851435|sp|P23806|IXA_TRIFL Coagulation factor IX/factor X-bi... 47 0.002
gi|34098769|sp|Q9YGG9|MMHA_AGKHA Mamushigin alpha chain precurso... 47 0.002
gi|399125|sp|P22029|BOTA_BOTJA Botrocetin, alpha chain (Platelet... 47 0.002
gi|399126|sp|P22030|BOTB_BOTJA Botrocetin, beta chain (Platelet ... 47 0.002
gi|47230073|emb|CAG10487.1| unnamed protein product [Tetraodon n... 47 0.002
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe... 46 0.003
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica] 46 0.003
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep... 46 0.003
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti... 46 0.003
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens] 46 0.003
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens] 46 0.003
gi|47551233|ref|NP_999801.1| receptor for egg jelly 3 [Strongylo... 46 0.004
gi|33243092|gb|AAQ01216.1| C-type lectin CTL-27 [Echis ocellatus] 46 0.004
gi|39588321|emb|CAE72672.1| Hypothetical protein CBG19888 [Caeno... 46 0.004
gi|20381202|gb|AAH27742.1| Clecsf12 protein [Mus musculus] 46 0.004
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n... 45 0.005
gi|50750537|ref|XP_422039.1| PREDICTED: similar to Lymphocyte an... 45 0.005
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n... 45 0.005
gi|2829697|sp|P81017|ECHA_ECHCA Echicetin alpha subunit 45 0.005
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g... 45 0.005
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens] 45 0.005
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul... 45 0.005
gi|17565058|ref|NP_507829.1| versican precursor family member (3... 45 0.005
gi|45259478|dbj|BAD12391.1| aggrecan [Danio rerio] 45 0.005
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE... 45 0.005
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_... 45 0.005
gi|47564066|ref|NP_001001158.1| DEC-205/CD205 protein [Bos tauru... 45 0.005
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr... 45 0.007
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic... 45 0.007
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (... 45 0.007
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr... 45 0.007
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA... 45 0.007
gi|21070944|ref|NP_631926.1| killer cell lectin-like receptor su... 45 0.007
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor... 45 0.007
gi|181168|gb|AAA35726.1| proteoglycan core protein 45 0.007
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le... 45 0.007
gi|48110771|ref|XP_396277.1| similar to CG9138-PA [Apis mellifera] 45 0.009
gi|49066125|gb|AAT49134.1| lectin29Ca [Drosophila melanogaster] 45 0.009
gi|3023229|sp|P81111|ABA1_TRIAB Alboaggregin A subunit 1 45 0.009
gi|49066135|gb|AAT49139.1| lectin29Ca [Drosophila melanogaster] 45 0.009
gi|49066123|gb|AAT49133.1| lectin29Ca [Drosophila melanogaster] 45 0.009
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans] 45 0.009
gi|17557916|ref|NP_507547.1| versican precursor family member (5... 45 0.009
gi|50794058|ref|XP_423655.1| PREDICTED: similar to brevican isof... 45 0.009
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ... 45 0.009
gi|49066131|gb|AAT49137.1| lectin29Ca [Drosophila melanogaster] 44 0.012
gi|49066115|gb|AAT49129.1| lectin29Ca [Drosophila melanogaster] 44 0.012
gi|21357479|ref|NP_652640.1| CG17799-PA [Drosophila melanogaster... 44 0.012
gi|49066127|gb|AAT49135.1| lectin29Ca [Drosophila melanogaster] 44 0.012
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8... 44 0.012
gi|34870064|ref|XP_221789.2| similar to DC-SIGN [Rattus norvegicus] 44 0.015
gi|4808975|gb|AAD30038.1| receptor protein-tyrosine kinase; HTK2... 44 0.015
gi|37675379|ref|NP_922941.1| C-type lectin, superfamily member 1... 44 0.015
gi|38493075|pdb|1UOS|A Chain A, The Crystal Structure Of The Sna... 44 0.015
gi|25090033|sp|O93426|CVXA_CRODU Convulxin alpha precursor (CVX ... 44 0.015
gi|16758588|ref|NP_446205.1| C-type lectin, superfamily member 1... 44 0.015
gi|47230595|emb|CAF99788.1| unnamed protein product [Tetraodon n... 44 0.015
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris] 44 0.015
gi|4337050|gb|AAD18055.1| fibrinogen clotting inhibitor A chain ... 44 0.020
gi|33243094|gb|AAQ01217.1| C-type lectin CTL-9 [Echis carinatus ... 44 0.020
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co... 44 0.020
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ... 44 0.020
gi|4808979|gb|AAD30040.1| receptor protein-tyrosine kinase; HTK2... 44 0.020
gi|48476218|gb|AAT44384.1| REJ3CRD [Strongylocentrotus droebachi... 44 0.020
gi|4808977|gb|AAD30039.1| receptor protein-tyrosine kinase; HTK2... 44 0.020
gi|3287903|sp|P81397|RHCA_AGKRH Rhodocetin alpha subunit 44 0.020
gi|211655|gb|AAA48720.1| proteoglycan core protein 44 0.020
gi|32264364|gb|AAP78680.1| MBCTL1 [Monosiga brevicollis] 44 0.020
gi|34858417|ref|XP_342753.1| similar to RIKEN cDNA 3110037K17 [R... 44 0.020
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus] 44 0.020
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor... 44 0.020
gi|13810902|gb|AAK40085.1| brevican soluble core protein precurs... 43 0.026
gi|33391736|gb|AAQ17468.1| factor X activator light chain 1 prec... 43 0.026
gi|33417124|gb|AAH56052.1| Colec11-prov protein [Xenopus laevis] 43 0.026
gi|1478015|gb|AAB36402.1| ECLV IX/X-bp beta subunit=Ca(2+)-depen... 43 0.026
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus] 43 0.026
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga... 43 0.026
gi|34013700|gb|AAQ56013.1| lectin protein type II [Hippocampus c... 43 0.026
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B... 43 0.026
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma... 43 0.026
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;... 43 0.026
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma... 43 0.026
gi|47228322|emb|CAG07717.1| unnamed protein product [Tetraodon n... 43 0.034
gi|33243072|gb|AAQ01206.1| C-type lectin CTL-1 [Bitis arietans] 43 0.034
gi|33341212|gb|AAQ15167.1| stejaggregin-A beta chain-1 [Trimeres... 43 0.034
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa] 43 0.034
gi|1902921|dbj|BAA18917.1| lectin-related protein [Periplaneta a... 43 0.034
gi|18858041|ref|NP_572269.1| CG15765-PA [Drosophila melanogaster... 42 0.044
gi|27465527|ref|NP_775120.1| pancreatitis-associated protein 3 [... 42 0.044
gi|5381157|dbj|BAA82266.1| Cockroach lectin-like protein CL3 [Pe... 42 0.044
gi|39593116|emb|CAE64585.1| Hypothetical protein CBG09340 [Caeno... 42 0.044
gi|47228554|emb|CAG05374.1| unnamed protein product [Tetraodon n... 42 0.044
gi|5381159|dbj|BAA82267.1| Chockroach lectin-like protein CL2 [P... 42 0.044
gi|42716324|gb|AAS37670.1| dectin-1 [Mus musculus] 42 0.044
gi|9910160|ref|NP_064392.1| C-type lectin, superfamily member 12... 42 0.044
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|... 42 0.057
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [... 42 0.057
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote... 42 0.057
gi|2144278|pir||S43922 versican - pig-tailed macaque (fragments) 42 0.057
gi|47219432|emb|CAG10796.1| unnamed protein product [Tetraodon n... 42 0.057
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID... 42 0.057
gi|30580858|sp||Q28858_3 [Segment 3 of 3] Versican core protein ... 42 0.057
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ... 42 0.057
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ... 42 0.057
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens] 42 0.057
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ... 42 0.057
gi|17560132|ref|NP_504500.1| receptor II precursor (19.9 kD) (5G... 42 0.057
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p... 42 0.057
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens] 42 0.057
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi... 42 0.057
gi|33341210|gb|AAQ15166.1| stejaggregin-A alpha chain [Trimeresu... 42 0.057
gi|833853|gb|AAA67565.1| versican V2 core protein precursor 42 0.057
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr... 42 0.057
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [... 42 0.057
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus] 42 0.057
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ... 42 0.057
gi|31542313|ref|NP_525126.2| C-type lectin, superfamily member 8... 42 0.075
gi|17226268|gb|AAL37713.1| C-type lectin-like receptor CLEC-6 [H... 42 0.075
gi|21260584|gb|AAM43809.1| C-type lectin-like protein TMVA B cha... 42 0.075
gi|2134245|pir||JC5059 bitiscetin beta chain - puff adder >gnl|B... 42 0.075
gi|3287904|sp|P81398|RHCB_AGKRH Rhodocetin beta subunit 42 0.075
gi|33341216|gb|AAQ15169.1| stejaggregin-A beta chain-3 [Trimeres... 42 0.075
gi|40363429|dbj|BAD06213.1| pancreatitis-associated protein [Can... 42 0.075
gi|691755|dbj|BAA06445.1| phospholipase A2 receptor [Rattus sp.] 42 0.075
gi|33341184|gb|AAQ15153.1| factor IX/X binding protein alpha cha... 42 0.075
gi|7542470|gb|AAF63468.1| mannose binding-like lectin precursor ... 42 0.075
gi|37360054|dbj|BAC98005.1| mKIAA0709 protein [Mus musculus] 42 0.075
gi|32450776|gb|AAP41219.2| echicetin B-chain [Echis carinatus] 41 0.098
gi|47551243|ref|NP_999802.1| receptor for egg jelly 2 protein [S... 41 0.098
gi|1478014|gb|AAB36401.1| ECLV IX/X-bp alpha subunit=coagulation... 41 0.098
gi|48476214|gb|AAT44382.1| REJ3CRD [Allocentrotus fragilis] 41 0.098
gi|625318|pir||LNRC1 lectin BRA3-1 precursor - barnacle (Megabal... 41 0.098
gi|625317|pir||LNRC3 lectin BRA3-2 precursor - barnacle (Megabal... 41 0.098
gi|1730116|sp|P07439|LEC3_MEGRO Lectin BRA-3 precursor >gnl|BL_O... 41 0.098
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B... 41 0.098
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus] 41 0.098
gi|1143285|gb|AAA87847.1| brevican core protein 41 0.098
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_... 41 0.098
gi|17561482|ref|NP_503676.1| c-type lectin precursor family memb... 41 0.098
gi|665485|gb|AAA96811.1| tetranectin 41 0.098
gi|17542436|ref|NP_500843.1| core protein (4G419) [Caenorhabditi... 41 0.098
gi|6754728|ref|NP_034949.1| C-type lectin, superfamily member 8;... 41 0.098
gi|26354554|dbj|BAC40905.1| unnamed protein product [Mus musculus] 41 0.098
gi|34858419|ref|XP_232393.2| similar to dendritic cell immunorec... 41 0.098
gi|39655009|pdb|1V4L|A Chain A, Crystal Structure Of A Platelet ... 41 0.098
gi|37723174|gb|AAR02097.1| macrophage C-type lectin [Rattus norv... 41 0.098
gi|49066141|gb|AAT49142.1| lectin29Ca [Drosophila simulans] 41 0.098
gi|37575443|gb|AAQ93686.1| mucrocetin alpha chain [Protobothrops... 41 0.098
gi|21260582|gb|AAM43808.1| C-type lectin-like protein TMVA A cha... 41 0.098
gi|33332305|gb|AAQ11364.1| crotocetin-1 [Crotalus durissus terri... 41 0.098
gi|15420808|gb|AAK97466.1| NKG2-A [Macaca mulatta] 41 0.098
gi|27530341|dbj|BAC53954.1| collectin-L1 [Mus musculus] 41 0.098
gi|27734138|ref|NP_775598.1| collectin liver 1; collectin-L1 [Mu... 41 0.098
gi|225342|prf||1301209A lectin 41 0.098
gi|47203231|emb|CAF92548.1| unnamed protein product [Tetraodon n... 41 0.13
gi|48476222|gb|AAT44386.1| REJ3CRD [Strongylocentrotus pallidus] 41 0.13
gi|34858421|ref|XP_342754.1| similar to C-type lectin [Rattus no... 41 0.13
gi|6755310|ref|NP_035390.1| regenerating islet-derived 3 gamma; ... 41 0.13
gi|24137227|gb|AAN47097.1| dendritic cell-associated C-type lect... 41 0.13
gi|6671523|ref|NP_031450.1| aggrecan 1; aggrecan, structural pro... 41 0.13
gi|13876735|gb|AAK43584.1| C-type lectin-like protein 1 [Bungaru... 41 0.13
gi|49066143|gb|AAT49143.1| lectin29Ca [Drosophila simulans] 41 0.13
gi|49066149|gb|AAT49146.1| lectin29Ca [Drosophila simulans] 41 0.13
gi|49066147|gb|AAT49145.1| lectin29Ca [Drosophila simulans] 41 0.13
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens] 41 0.13
gi|40889261|pdb|1OZ7|B Chain B, Crystal Structure Of Echicetin F... 40 0.17
gi|3023232|sp|P81114|ABA4_TRIAB Alboaggregin A subunit 4 40 0.17
gi|6633971|dbj|BAA88562.1| Reg III delta [Mus musculus] 40 0.17
gi|283849|pir||B42972 coagulation factor X activating enzyme (EC... 40 0.17
gi|2781225|pdb|1HTN| Human Tetranectin, A Trimeric Plasminogen ... 40 0.17
gi|47230594|emb|CAF99787.1| unnamed protein product [Tetraodon n... 40 0.17
gi|33341214|gb|AAQ15168.1| stejaggregin-A beta chain-2 [Trimeres... 40 0.17
gi|33332307|gb|AAQ11365.1| crotocetin [Crotalus durissus terrifi... 40 0.17
gi|21426887|ref|NP_038921.1| islet neogenesis associated protein... 40 0.17
gi|38176036|gb|AAB66231.2| Hypothetical protein R07C3.1 [Caenorh... 40 0.17
gi|6633974|dbj|BAA88564.1| Reg III delta [Mus musculus] >gnl|BL_... 40 0.17
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h... 40 0.17
gi|17535525|ref|NP_493859.1| c-type lectin and CUB domain contai... 40 0.17
gi|31212883|ref|XP_312182.1| ENSANGP00000010271 [Anopheles gambi... 40 0.17
gi|25245561|gb|AAN72438.1| flavocetin-A alpha chain [Trimeresuru... 40 0.17
gi|24266774|gb|AAN52336.1| nematocyst outer wall antigen precurs... 40 0.17
gi|321190|pir||A45751 pancreatic stone protein precursor - human... 40 0.22
gi|29725633|ref|NP_002900.2| regenerating islet-derived 1 alpha ... 40 0.22
gi|17017253|gb|AAL33584.1| SIGNR3 [Mus musculus] 40 0.22
gi|28628342|gb|AAO43608.1| serum lectin isoform 4 precursor [Sal... 40 0.22
gi|28628340|gb|AAO43607.1| serum lectin isoform 3 precursor [Sal... 40 0.22
gi|48476220|gb|AAT44385.1| REJ3CRD [Strongylocentrotus francisca... 40 0.22
gi|5869813|emb|CAB55571.1| putative NK receptor [Gallus gallus] 40 0.22
gi|46019640|emb|CAG25422.1| NK receptor [Gallus gallus] 40 0.22
gi|26340010|dbj|BAC33668.1| unnamed protein product [Mus musculus] 40 0.22
gi|15928688|gb|AAH14811.1| Macrophage galactose N-acetyl-galacto... 40 0.22
gi|21755922|dbj|BAC04786.1| unnamed protein product [Homo sapiens] 40 0.22
gi|27721871|ref|XP_236746.1| similar to tetranectin [Rattus norv... 40 0.22
gi|47778940|ref|NP_775806.2| C-type lectin, superfamily member 1... 40 0.22
gi|4507557|ref|NP_003269.1| tetranectin (plasminogen binding pro... 40 0.22
gi|46395875|sp|Q8HY02|C209_HYLSY CD209 antigen (Dendritic cell-s... 40 0.22
gi|7677475|gb|AAF67179.1| dectin-2 gamma isoform [Mus musculus] 40 0.22
gi|28628336|gb|AAO43605.1| serum lectin isoform 1 precursor [Sal... 40 0.22
gi|7677472|gb|AAF67178.1| dectin-2 beta isoform [Mus musculus] 40 0.22
gi|28628334|gb|AAO43604.1| serum lectin isoform 5 precursor [Sal... 40 0.22
gi|18777736|ref|NP_570974.1| CD209d antigen [Mus musculus] >gnl|... 40 0.22
gi|34979184|gb|AAQ83725.1| dendritic cell-associated lectin 2 [H... 40 0.22
gi|9910158|ref|NP_064385.1| C-type (calcium dependent, carbohydr... 40 0.22
gi|1942639|pdb|1LIT| Human Lithostathine 40 0.22
gi|6980876|pdb|1QDD|A Chain A, Crystal Structure Of Human Lithos... 40 0.22
gi|49066137|gb|AAT49140.1| lectin29Ca [Drosophila simulans] >gnl... 40 0.22
gi|4502683|ref|NP_001773.1| CD72 antigen [Homo sapiens] >gnl|BL_... 40 0.22
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]... 40 0.22
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus] 40 0.22
gi|11967287|gb|AAG42041.1| agkicetin beta subunit precursor [Dei... 40 0.28
gi|129887|sp|P07897|PGCA_RAT Aggrecan core protein precursor (Ca... 40 0.28
gi|18157520|dbj|BAB83835.1| supported by GENSCAN and partially h... 40 0.28
gi|18252678|gb|AAL66390.1| antithrombin 1 B chain [Deinagkistrod... 40 0.28
gi|17552510|ref|NP_498023.1| predicted CDS, c-type lectin and CU... 40 0.28
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas... 40 0.28
gi|206105|gb|AAA41836.1| proteoglycan 40 0.28
gi|20273044|gb|AAF26286.2| agkisacutacin A chain [Deinagkistrodo... 40 0.28
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr... 40 0.28
gi|50750998|ref|XP_422224.1| PREDICTED: similar to regenerating ... 40 0.28
gi|47223875|emb|CAG06052.1| unnamed protein product [Tetraodon n... 40 0.28
gi|6981470|ref|NP_036773.1| regenerating islet-derived 1; RATLIT... 40 0.28
gi|37183194|gb|AAQ89397.1| COLEC10 [Homo sapiens] 40 0.28
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ... 40 0.28
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ... 40 0.28
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]... 40 0.28
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s... 40 0.28
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu... 40 0.28
gi|26351787|dbj|BAC39530.1| unnamed protein product [Mus musculus] 39 0.37
gi|18426877|ref|NP_550436.1| asialoglycoprotein receptor 2 isofo... 39 0.37
gi|4502253|ref|NP_001172.1| asialoglycoprotein receptor 2 isofor... 39 0.37
gi|33341192|gb|AAQ15157.1| factor IX/X binding protein beta chai... 39 0.37
gi|7245413|pdb|1C3A|B Chain B, Crystal Structure Of Flavocetin-A... 39 0.37
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ... 39 0.37
gi|17534515|ref|NP_494043.1| putative protein family member (2B9... 39 0.37
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ... 39 0.37
gi|25245527|gb|AAN72437.1| flavocetin-A beta chain [Trimeresurus... 39 0.37
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat... 39 0.37
gi|15218209|ref|NP_175641.1| protein kinase family protein / C-t... 39 0.37
gi|47208881|emb|CAF98183.1| unnamed protein product [Tetraodon n... 39 0.37
gi|33328316|gb|AAQ09608.1| HBxAg-binding protein [Homo sapiens] 39 0.37
gi|11277028|pir||JC7134 agkisacutacin alpha chain precursor - sh... 39 0.37
gi|21553093|ref|NP_660119.1| macrophage galactose N-acetyl-galac... 39 0.37
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ... 39 0.37
gi|18426875|ref|NP_550435.1| asialoglycoprotein receptor 2 isofo... 39 0.37
gi|27356910|gb|AAL89542.1| putative CD209 protein [Pongo pygmaeus] 39 0.37
gi|46395873|sp|Q8HY00|C209_PONPY CD209 antigen (Dendritic cell-s... 39 0.37
gi|46395899|sp|Q8MIS5|209P_MACMU CD209 antigen-like protein 2 >g... 39 0.37
gi|7804476|dbj|BAA95671.1| C-type lectin [Cyprinus carpio] 39 0.37
gi|40555946|ref|NP_955031.1| CNPV008 C-type lectin-like protein ... 39 0.37
gi|5453619|ref|NP_006429.1| collectin sub-family member 10; coll... 39 0.37
gi|34098771|sp|Q9YI92|MMHB_AGKHA Mamushigin beta chain precursor... 39 0.48
gi|12841992|dbj|BAB25429.1| unnamed protein product [Mus musculu... 39 0.48
gi|46395876|sp|Q8HY03|C209_HYLLA CD209 antigen (Dendritic cell-s... 39 0.48
gi|13385824|ref|NP_080604.1| regenerating islet-derived family, ... 39 0.48
gi|47225543|emb|CAG12026.1| unnamed protein product [Tetraodon n... 39 0.48
gi|14719570|pdb|1IOD|A Chain A, Crystal Structure Of The Complex... 39 0.48
gi|23498708|emb|CAD28399.1| putative mannose-binding C-type lect... 39 0.48
gi|38493056|pdb|1UKM|B Chain B, Crystal Structure Of Ems16, An A... 39 0.48
gi|7542474|gb|AAF63470.1| mannose binding-like lectin precursor ... 39 0.48
gi|33243078|gb|AAQ01209.1| C-type lectin CTL-6 [Bitis arietans] 39 0.48
gi|6754688|ref|NP_034926.1| macrophage galactose N-acetyl-galact... 39 0.48
gi|34870068|ref|XP_341025.1| similar to SIGNR4 [Rattus norvegicus] 39 0.48
gi|46395877|sp|Q8HY04|C209_PAPHA CD209 antigen (Dendritic cell-s... 39 0.48
gi|46395660|sp|P60883|C209_CERAE CD209 antigen (Dendritic cell-s... 39 0.48
gi|18652791|gb|AAK74185.1| type II membrane protein CD209 [Macac... 39 0.48
gi|16118475|gb|AAL14438.1| dendritic cell-specific ICAM-3 grabbi... 39 0.48
gi|31560464|ref|NP_058031.2| C-type lectin, superfamily member 1... 39 0.48
gi|2497642|sp|P70194|KUCR_MOUSE C-type lectin 13 (Kupffer cell r... 39 0.48
gi|27806705|ref|NP_776439.1| CD69 antigen (p60, early T-cell act... 39 0.48
gi|19263791|gb|AAH25069.1| 4930572L20Rik protein [Mus musculus] 39 0.48
gi|38089047|ref|XP_110691.2| RIKEN cDNA 4930572L20 [Mus musculus... 39 0.48
gi|46395874|sp|Q8HY01|C209_HYLCO CD209 antigen (Dendritic cell-s... 39 0.48
gi|3510719|gb|AAC33576.1| immunolectin-A precursor [Manduca sexta] 39 0.48
gi|46396751|sp|P83515|STR2_STRCA Struthiocalcin-2 (SCA-2) 39 0.48
gi|31879371|dbj|BAC77707.1| EMS16 B chain [Echis multisquamatus] 39 0.63
gi|26349637|dbj|BAC38458.1| unnamed protein product [Mus musculus] 39 0.63
gi|17544698|ref|NP_502451.1| phospholipase A2 receptor precursor... 39 0.63
gi|27734229|sp|P81509|CHBB_CROHO CHH-B beta subunit 39 0.63
gi|38493076|pdb|1UOS|B Chain B, The Crystal Structure Of The Sna... 39 0.63
gi|39654959|pdb|1UMR|C Chain C, Crystal Structure Of The Platele... 39 0.63
gi|48476206|gb|AAT44378.1| REJ2CRD [Hemicentrotus pulcherrimus] 39 0.63
gi|47215081|emb|CAG04535.1| unnamed protein product [Tetraodon n... 39 0.63
gi|23321265|gb|AAN23127.1| agglucetin-beta 2 subunit precursor [... 39 0.63
gi|20562941|gb|AAM22788.1| C-type lectin [Deinagkistrodon acutus] 39 0.63
gi|25395663|pir||B88392 protein R06B10.3 [imported] - Caenorhabd... 39 0.63
gi|33332301|gb|AAQ11362.1| convulxin subunit b [Crotalus durissu... 39 0.63
gi|33243086|gb|AAQ01213.1| C-type lectin CTL-3 [Echis carinatus ... 39 0.63
gi|33243080|gb|AAQ01210.1| C-type lectin CTL-8 [Bitis arietans] ... 39 0.63
gi|25090034|sp|O93427|CVXB_CRODU Convulxin beta precursor (CVX b... 39 0.63
gi|37675373|ref|NP_922938.1| C-type lectin, superfamily member 1... 39 0.63
gi|7512228|pir||T28140 natural killer cell receptor homolog - ch... 39 0.63
gi|17554488|ref|NP_497312.1| pancreatitis-associated protein pre... 39 0.63
gi|6755821|ref|NP_035736.1| tetranectin (plasminogen binding pro... 39 0.63
gi|23272041|gb|AAH35043.1| Tetranectin (plasminogen binding prot... 39 0.63
gi|6677705|ref|NP_033069.1| regenerating islet-derived 2; rat re... 39 0.63
gi|38049424|ref|XP_283054.2| collectin sub-family member 11 [Mus... 39 0.63
gi|39587020|emb|CAE62955.1| Hypothetical protein CBG07169 [Caeno... 39 0.63
gi|7245412|pdb|1C3A|A Chain A, Crystal Structure Of Flavocetin-A... 39 0.63
gi|33341186|gb|AAQ15154.1| factor IX/X binding protein beta chai... 39 0.63
gi|8163745|gb|AAF73837.1| NKG2-B [Macaca mulatta] 38 0.83
gi|13384604|ref|NP_072092.2| C-type lectin, superfamily member 1... 38 0.83
gi|33341190|gb|AAQ15156.1| factor IX/X binding protein beta chai... 38 0.83
gi|39655010|pdb|1V4L|B Chain B, Crystal Structure Of A Platelet ... 38 0.83
gi|31559111|gb|AAP50846.1| immulectin [Bombyx mori] 38 0.83
gi|48476204|gb|AAT44377.1| REJ2CRD [Allocentrotus fragilis] 38 0.83
gi|42543880|pdb|1UV0|A Chain A, Pancreatitis-Associated Protein ... 38 0.83
gi|47213064|emb|CAF91578.1| unnamed protein product [Tetraodon n... 38 0.83
gi|17561188|ref|NP_507258.1| predicted CDS, c-type lectin family... 38 0.83
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_... 38 0.83
gi|8850225|ref|NP_058666.1| killer cell lectin-like receptor sub... 38 0.83
gi|189601|gb|AAA36415.1| pancreatitis associated protein 38 0.83
gi|4505605|ref|NP_002571.1| pancreatitis-associated protein prec... 38 0.83
gi|25050261|ref|XP_194289.1| similar to C-type lectin, superfami... 38 0.83
gi|13876739|gb|AAK43586.1| C-type lectin-like protein 1 [Bungaru... 38 0.83
gi|50730821|ref|XP_417032.1| PREDICTED: similar to antithrombin ... 38 0.83
gi|17535547|ref|NP_493851.1| predicted CDS, receptor for egg jel... 38 1.1
gi|47208698|emb|CAF89942.1| unnamed protein product [Tetraodon n... 38 1.1
gi|190981|gb|AAA36559.1| regenerating protein (reg) 38 1.1
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ... 38 1.1
gi|7993934|sp|P81996|ECHB_ECHCA Echicetin beta subunit >gnl|BL_O... 38 1.1
gi|48476212|gb|AAT44381.1| REJ2CRD [Strongylocentrotus pallidus] 38 1.1
gi|33243082|gb|AAQ01211.1| C-type lectin CTL-1 [Echis ocellatus] 38 1.1
gi|477362|pir||A48925 mannose receptor precursor, macrophage - m... 38 1.1
gi|6678932|ref|NP_032651.1| mannose receptor, C type 1 [Mus musc... 38 1.1
gi|34877265|ref|XP_225585.2| similar to macrophage mannose recep... 38 1.1
gi|20833065|ref|XP_132898.1| similar to killer cell lectin-like ... 38 1.1
gi|39583088|emb|CAE60628.1| Hypothetical protein CBG04271 [Caeno... 38 1.1
gi|46195838|ref|NP_996866.1| yolk sac IgY receptor [Gallus gallu... 38 1.1
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (... 38 1.1
gi|21357551|ref|NP_652637.1| CG3410-PA [Drosophila melanogaster]... 38 1.1
gi|40548420|ref|NP_954705.1| collectin sub-family member 11 isof... 37 1.4
gi|13128972|ref|NP_076932.1| collectin sub-family member 11 isof... 37 1.4
gi|46395872|sp|Q8HXZ8|C209_GORGO CD209 antigen (Dendritic cell-s... 37 1.4
gi|2851436|sp|P23807|IXB_TRIFL Coagulation factor IX/factor X-bi... 37 1.4
gi|21361222|ref|NP_444384.1| killer cell lectin-like receptor, s... 37 1.4
gi|21357549|ref|NP_652636.1| CG7106-PA [Drosophila melanogaster]... 37 1.4
gi|15281093|gb|AAK91856.1| sDC-SIGN1B type II isoform [Homo sapi... 37 1.4
gi|33243098|gb|AAQ01219.1| C-type lectin CTL-4 [Echis pyramidum ... 37 1.4
gi|37575445|gb|AAQ93687.1| mucrocetin beta chain [Protobothrops ... 37 1.4
gi|33243090|gb|AAQ01215.1| C-type lectin CTL-8 [Echis carinatus ... 37 1.4
gi|15383618|gb|AAK91865.1| sDC-SIGN2 type III isoform [Homo sapi... 37 1.4
gi|9256549|ref|NP_038822.3| killer cell lectin-like receptor, su... 37 1.4
gi|37577115|ref|NP_919429.1| C-type lectin, superfamily member 6... 37 1.4
gi|13879298|gb|AAH06623.1| Clecsf6 protein [Mus musculus] 37 1.4
gi|47230199|emb|CAG10613.1| unnamed protein product [Tetraodon n... 37 1.4
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec... 37 1.4
gi|13928898|ref|NP_113837.1| killer cell lectin-like receptor su... 37 1.4
gi|31335113|gb|AAO32796.1| polycystic kidney disease 1-like 2 [H... 37 1.4
gi|26387827|dbj|BAC25626.1| unnamed protein product [Mus musculus] 37 1.4
gi|17386090|gb|AAL38593.1| SR protein kinase 1 [Cricetulus longi... 37 1.4
gi|46395879|sp|Q8HY10|209L_HYLCO CD209 antigen-like protein 1 >g... 37 1.4
gi|34863397|ref|XP_345653.1| similar to hypothetical protein MGC... 37 1.4
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica] 37 1.4
gi|6753442|ref|NP_036129.1| C-type (calcium dependent, carbohydr... 37 1.4
gi|6633978|dbj|BAA88566.1| Islet neogenesis associated protein [... 37 1.4
gi|34555889|emb|CAB63316.2| Hypothetical protein T20B3.13 [Caeno... 37 1.8
gi|27802445|gb|AAO21369.1| maturase [Peganum harmala] 37 1.8
gi|2627436|gb|AAB86683.1| PKD1 gene product [Takifugu rubripes] 37 1.8
gi|45382787|ref|NP_989997.1| tetranectin [Gallus gallus] >gnl|BL... 37 1.8
gi|47523028|ref|NP_999275.1| lung surfactant protein D [Sus scro... 37 1.8
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ... 37 1.8
gi|48476216|gb|AAT44383.1| REJ3CRD [Hemicentrotus pulcherrimus] 37 1.8
gi|3212544|pdb|1IXX|B Chain B, Crystal Structure Of Coagulation ... 37 1.8
gi|34392369|dbj|BAC82506.1| C-type lectin B-lec homologous [Cotu... 37 1.8
gi|20562945|gb|AAM22790.1| antithrombin A A-chain [Deinagkistrod... 37 1.8
gi|1352705|sp|P49260|PA2R_RABIT 180 kDa secretory phospholipase ... 37 1.8
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab... 37 1.8
gi|9801839|gb|AAF99548.1| natural killer cell receptor Ly49P1 [M... 37 1.8
gi|23498707|emb|CAD28398.1| putative mannose-binding C-type lect... 37 1.8
gi|46395942|sp|Q95LC6|C209_MACNE CD209 antigen (Dendritic cell-s... 37 1.8
gi|28628338|gb|AAO43606.1| serum lectin isoform 2 precursor [Sal... 37 1.8
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor... 37 1.8
gi|17564476|ref|NP_507252.1| c-type lectin family member (5R320)... 37 1.8
gi|15383614|gb|AAK91863.1| sDC-SIGN2 type I isoform [Homo sapiens] 37 1.8
gi|46395941|sp|Q95J96|C209_MACMU CD209 antigen (Dendritic cell-s... 37 1.8
gi|15420784|gb|AAK97459.1| dendritic cell-specific ICAM-3 grabbi... 37 1.8
gi|8347159|gb|AAF74531.1| NKG2-C [Macaca mulatta] >gnl|BL_ORD_ID... 37 1.8
gi|27718901|ref|XP_235330.1| similar to collectin liver 1; colle... 37 1.8
gi|27545360|ref|NP_775413.1| lymphocye antigen 49 complex [Rattu... 37 2.4
gi|1514682|gb|AAB86497.1| pancreatic beta cell growth factor [Me... 37 2.4
gi|11967285|gb|AAG42040.1| agkicetin alpha subunit precursor [De... 37 2.4
gi|11120724|ref|NP_068537.1| N-sulfotransferase; tyrosine-ester ... 37 2.4
gi|50728376|ref|XP_416114.1| PREDICTED: similar to protein tyros... 37 2.4
gi|6686332|sp|Q92778|PBCG_MESAU Pancreatic beta cell growth fact... 37 2.4
gi|33598942|ref|NP_443124.2| polycystin 1-like 2 isoform a [Homo... 37 2.4
gi|37993391|gb|AAR06851.1| C-type lectin-1 [Bitis gabonica] 37 2.4
gi|28981404|gb|AAH48780.1| Similar to phospholipase A2, group IB... 37 2.4
gi|33598940|ref|NP_877417.1| polycystin 1-like 2 isoform b [Homo... 37 2.4
gi|46395880|sp|Q8HY11|209L_HYLSY CD209 antigen-like protein 1 >g... 37 2.4
gi|20141529|sp|P26717|NKGC_HUMAN NKG2-C type II integral membran... 37 2.4
gi|9295441|gb|AAF86972.1| NK cell receptor C [Homo sapiens] 37 2.4
gi|8163747|gb|AAF73838.1| NKG2-Adtm [Macaca mulatta] 36 3.1
gi|4432917|dbj|BAA21067.1| similar to LPS-binding protein [Perip... 36 3.1
gi|40889260|pdb|1OZ7|A Chain A, Crystal Structure Of Echicetin F... 36 3.1
gi|31789967|gb|AAP58741.1| C-type lectin receptor [Oreochromis n... 36 3.1
gi|1902917|dbj|BAA18915.1| lectin-related protein [Periplaneta a... 36 3.1
gi|9295431|gb|AAF86968.1| NK cell receptor C [Pan troglodytes] 36 3.1
gi|10946714|ref|NP_067353.1| killer cell lectin-like receptor su... 36 3.1
gi|8163751|gb|AAF73840.1| NKG2-Bdtm [Macaca mulatta] 36 3.1
gi|6754654|ref|NP_034905.1| mannose binding lectin, liver (A) [M... 36 3.1
gi|45430003|ref|NP_991356.1| pancreatic thread protein [Bos taur... 36 3.1
gi|9295433|gb|AAF86969.1| NK cell receptor C [Pan troglodytes] 36 3.1
gi|4504883|ref|NP_002251.1| killer cell lectin-like receptor sub... 36 3.1
gi|23397421|ref|NP_694877.1| RIKEN cDNA 3110037K17 [Mus musculus... 36 3.1
gi|11344850|gb|AAG34501.1| NKG2-C [Macaca mulatta] 36 3.1
gi|9295429|gb|AAF86967.1| NK cell receptor C [Pan troglodytes] 36 3.1
gi|15420810|gb|AAK97467.1| NKG2-A [Macaca mulatta] 36 3.1
gi|1902915|dbj|BAA18914.1| lectin-related protein [Periplaneta a... 36 3.1
gi|38503187|sp|Q9GME8|NKGC_PANTR NKG2-C type II integral membran... 36 3.1
gi|20978528|sp|Q9MZJ3|NKGA_MACMU NKG2-A/NKG2-B type II integral ... 36 3.1
gi|46395878|sp|Q8HY06|209L_GORGO CD209 antigen-like protein 1 >g... 36 3.1
gi|46118092|ref|ZP_00174642.2| COG3209: Rhs family protein [Croc... 36 4.1
gi|7512196|pir||JC7105 aggretin beta chain - Malayan pit viper >... 36 4.1
gi|5453684|ref|NP_006335.1| C-type (calcium dependent, carbohydr... 36 4.1
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus] 36 4.1
gi|691753|dbj|BAA06444.1| phospholipase A2 receptor [Homo sapiens] 36 4.1
gi|27734228|sp|P81508|CHBA_CROHO CHH-B alpha subunit 36 4.1
gi|3023231|sp|P81113|ABA3_TRIAB Alboaggregin A subunit 3 36 4.1
gi|22475160|gb|AAM95599.1| REG-like protein splice variant 1 [Ho... 36 4.1
gi|2073146|dbj|BAA19863.1| Incilarin C [Incilaria fruhstorferi] 36 4.1
gi|33341200|gb|AAQ15161.1| stejaggregin-B alpha chain-2 [Trimere... 36 4.1
gi|26382731|dbj|BAC25504.1| unnamed protein product [Mus musculus] 36 4.1
gi|33341208|gb|AAQ15165.1| stejaggregin-B alpha chain-4 [Trimere... 36 4.1
gi|33341198|gb|AAQ15160.1| stejaggregin-B alpha chain-1 [Trimere... 36 4.1
gi|34870697|ref|XP_340795.1| similar to RUN and FYVE domain cont... 36 4.1
gi|33667103|ref|NP_878910.1| C-type lectin, superfamily member 1... 36 4.1
gi|50744990|ref|XP_426207.1| PREDICTED: similar to collectin sub... 36 4.1
gi|47230198|emb|CAG10612.1| unnamed protein product [Tetraodon n... 36 4.1
gi|7416081|dbj|BAA93690.1| haustellum specific protein A [Sarcop... 36 4.1
gi|6754980|ref|NP_035166.1| pancreatitis-associated protein; Reg... 36 4.1
gi|49456831|emb|CAG46736.1| UNQ429 [Homo sapiens] 36 4.1
gi|38348213|ref|NP_940850.1| LPPM429 [Homo sapiens] >gnl|BL_ORD_... 36 4.1
gi|46395881|sp|Q8HY12|209L_HYLLA CD209 antigen-like protein 1 >g... 36 4.1
gi|47213476|emb|CAF91133.1| unnamed protein product [Tetraodon n... 36 4.1
gi|22024114|ref|NP_610685.2| CG7763-PA [Drosophila melanogaster]... 36 4.1
gi|14042980|ref|NP_114433.1| regenerating islet-derived family, ... 36 4.1
gi|21902281|gb|AAM78495.1| natural killer cell lectin-like recep... 36 4.1
gi|21902285|gb|AAM78497.1| natural killer cell lectin-like recep... 36 4.1
gi|21902277|gb|AAM78493.1| natural killer cell lectin-like recep... 36 4.1
gi|21902279|gb|AAM78494.1| natural killer cell lectin-like recep... 36 4.1
gi|21902273|gb|AAM78491.1| natural killer cell lectin-like recep... 36 4.1
gi|4096440|gb|AAC99889.1| tyrosine-ester sulfotransferase [Mus m... 36 4.1
gi|126449|sp|P26305|LPSB_PERAM Hemolymph lipopolysaccharide-bind... 36 4.1
gi|50749166|ref|XP_421514.1| PREDICTED: similar to surfactant pr... 36 4.1
gi|50757014|ref|XP_415359.1| PREDICTED: similar to C-type lectin... 36 4.1
gi|2842719|sp|Q93118|A16_ANOGA Protein A16 precursor >gnl|BL_ORD... 35 5.4
gi|790819|gb|AAB59488.1| polycystic kidney disease-associated pr... 35 5.4
gi|3023251|sp|P81116|ABBB_TRIAB Alboaggregin B beta subunit 35 5.4
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ... 35 5.4
gi|799335|gb|AAC50128.1| autosomal dominant polycystic kidney di... 35 5.4
gi|32450274|gb|AAH53817.1| MGC64513 protein [Xenopus laevis] 35 5.4
gi|45645177|sp|P98161|PKD1_HUMAN Polycystin 1 precursor (Autosom... 35 5.4
gi|50803192|ref|XP_428659.1| PREDICTED: similar to C-type lectin... 35 5.4
gi|34784974|gb|AAH57069.1| C330001K17Rik protein [Mus musculus] 35 5.4
gi|21361220|ref|NP_444383.1| killer cell lectin-like receptor, s... 35 5.4
gi|32469210|dbj|BAC78901.1| C-type lectin [Gymnothorax flavimarg... 35 5.4
gi|37813574|gb|AAR04559.1| L-SIGN variant [Homo sapiens] 35 5.4
gi|444786|prf||1908220B pancreatitis-associated protein 35 5.4
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro... 35 5.4
gi|47214702|emb|CAG01055.1| unnamed protein product [Tetraodon n... 35 5.4
gi|34922645|sp|Q9PSN0|LECG_BITAR Galactose-specific lectin (PAL)... 35 5.4
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo... 35 5.4
gi|4583163|gb|AAD24969.1| natural killer cell receptor NKG2A [Mu... 35 5.4
gi|31228107|ref|XP_317999.1| ENSANGP00000011434 [Anopheles gambi... 35 5.4
gi|903758|gb|AAC41765.1| polycystic kidney disease 1 protein 35 5.4
gi|2135939|pir||A38971 polycystic kidney disease protein 1 precu... 35 5.4
gi|1586345|prf||2203412A polycystin 35 5.4
gi|31200355|ref|XP_309125.1| ENSANGP00000020518 [Anopheles gambi... 35 7.0
gi|1083928|pir||JP0075 lectin CEL-IV, C-type - Cucumaria echinat... 35 7.0
gi|13386214|ref|NP_081494.1| RIKEN cDNA 1810046I24; DCAR alpha; ... 35 7.0
>gi|17537259|ref|NP_496854.1| agkisacutacin like (2N882)
[Caenorhabditis elegans]
gi|7510021|pir||T27020 hypothetical protein Y48E1B.9 - Caenorhabditis
elegans
Length = 688
Score = 1273 bits (3295), Expect = 0.0
Identities = 642/688 (93%), Positives = 642/688 (93%)
Frame = -1
Query: 2067 MRIESLRYDYTTWFDCLRARPFETAEVDFVGMDYLILAEPVIYSAKKLCIKSSRAIPIRA 1888
MRIESLRYDYTTWFDCLRARPFETAEVDFVGMDYLILAEPVIYSAKKLCIKSSRAIPIRA
Sbjct: 1 MRIESLRYDYTTWFDCLRARPFETAEVDFVGMDYLILAEPVIYSAKKLCIKSSRAIPIRA 60
Query: 1887 ISNLQSPWIFLDYNMTSPKVVNLCENWIQDKKPMGTTLTLFVFREKFELVNQAIDNRFEA 1708
ISNLQSPWIFLDYNMTSPKVVNLCENWIQDKKPMGTTLTLFVFREKFELVNQAIDNRFEA
Sbjct: 61 ISNLQSPWIFLDYNMTSPKVVNLCENWIQDKKPMGTTLTLFVFREKFELVNQAIDNRFEA 120
Query: 1707 SSVQRSVEDREQVIVTSKDTNLELLSNKLVLHRGRRRQRECSFCLIVFGALSSNLCNFAE 1528
SSVQRSVEDREQVIVTSKDTNLELLSNKLVLHRGRRRQRECSFCLIVFGALSSNLCNFAE
Sbjct: 121 SSVQRSVEDREQVIVTSKDTNLELLSNKLVLHRGRRRQRECSFCLIVFGALSSNLCNFAE 180
Query: 1527 KKEVIFESVNFQNFHGMRSFFSTDEEFPTQLQNFEGRTETEIRTLKEKVARLEKLIDGLQ 1348
KKEVIFESVNFQNFHGMRSFFSTDEEFPTQLQNFEGRTETEIRTLKEKVARLEKLIDGLQ
Sbjct: 181 KKEVIFESVNFQNFHGMRSFFSTDEEFPTQLQNFEGRTETEIRTLKEKVARLEKLIDGLQ 240
Query: 1347 SVLMKEWNTTESGSKYRLFEERKSWDNAERHCQGFGAHLAIIDNEAKNGFVTNLINSSET 1168
SVLMKEWNTTESGSKYRLFEERKSWDNAERHCQGFGAHLAIIDNEAKNGFVTNLINSSET
Sbjct: 241 SVLMKEWNTTESGSKYRLFEERKSWDNAERHCQGFGAHLAIIDNEAKNGFVTNLINSSET 300
Query: 1167 SDFAWIGMKXXXXXXXXXXXTNFDSESPIDGCAVMDAKGVWSIRSCIQLRPFVCQIIKND 988
SDFAWIGMK TNFDSESPIDGCAVMDAKGVWSIRSCIQLRPFVCQIIKND
Sbjct: 301 SDFAWIGMKTKTTTQTSTPFTNFDSESPIDGCAVMDAKGVWSIRSCIQLRPFVCQIIKND 360
Query: 987 IESRKVTQXXXXXXXXKNDKSWVRSKIDSAKEKYHAGKEKLKTKISDVKSKLRGXXXXXX 808
IESRKVTQ KNDKSWVRSKIDSAKEKYHAGKEKLKTKISDVKSKLRG
Sbjct: 361 IESRKVTQKPAAPPPPKNDKSWVRSKIDSAKEKYHAGKEKLKTKISDVKSKLRGPAPTPQ 420
Query: 807 XXXXXQNNLPKSQYGWNXXXXXXXXXXXXXXXXQYGVPAPRAPQPTIPALTTKKSVFERL 628
QNNLPKSQYGWN QYGVPAPRAPQPTIPALTTKKSVFERL
Sbjct: 421 PRPPAQNNLPKSQYGWNTQAPGPRAPAPAPTRPQYGVPAPRAPQPTIPALTTKKSVFERL 480
Query: 627 KEKAKGKEKYVGKAVGWAKKDLGIGVEGPKKPSKILKFGKKAKTPKTQNPALVHSSGQIV 448
KEKAKGKEKYVGKAVGWAKKDLGIGVEGPKKPSKILKFGKKAKTPKTQNPALVHSSGQIV
Sbjct: 481 KEKAKGKEKYVGKAVGWAKKDLGIGVEGPKKPSKILKFGKKAKTPKTQNPALVHSSGQIV 540
Query: 447 GQVASGSHGLDRKVEYLKSRLDIMQSEIQGTWNTSESGTKYKIFEERMNWNDAQLHCEEL 268
GQVASGSHGLDRKVEYLKSRLDIMQSEIQGTWNTSESGTKYKIFEERMNWNDAQLHCEEL
Sbjct: 541 GQVASGSHGLDRKVEYLKSRLDIMQSEIQGTWNTSESGTKYKIFEERMNWNDAQLHCEEL 600
Query: 267 GSHLAYLDSESKNTYATSLIDSQNISMVWFGLRTEVGLGSGSDTYSNFSNLDGCGVVDRN 88
GSHLAYLDSESKNTYATSLIDSQNISMVWFGLRTEVGLGSGSDTYSNFSNLDGCGVVDRN
Sbjct: 601 GSHLAYLDSESKNTYATSLIDSQNISMVWFGLRTEVGLGSGSDTYSNFSNLDGCGVVDRN 660
Query: 87 GTWSISSCAIELPYLCQAFRFNVLVEIP 4
GTWSISSCAIELPYLCQAFRFNVLVEIP
Sbjct: 661 GTWSISSCAIELPYLCQAFRFNVLVEIP 688