Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y48E1B_17
(564 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17537261|ref|NP_496858.1| glutathione S-Transferase (gst-20) ... 364 e-100
gi|39591202|emb|CAE73255.1| Hypothetical protein CBG20671 [Caeno... 296 1e-79
gi|17536525|ref|NP_495967.1| glutathione S-Transferase (gst-13) ... 193 2e-48
gi|39589143|emb|CAE57876.1| Hypothetical protein CBG00918 [Caeno... 191 8e-48
gi|8917596|gb|AAF81283.1| glutathione S-transferase [Haemonchus ... 164 1e-39
gi|47717441|gb|AAT37718.1| glutathione S-transferase [Ancylostom... 162 4e-39
gi|7108568|gb|AAF36480.1| glutathione S-transferase 2 [Nematospi... 146 2e-34
gi|39591173|emb|CAE73226.1| Hypothetical protein CBG20632 [Caeno... 142 4e-33
gi|1170109|sp|P46436|GTS1_ASCSU Glutathione S-transferase 1 (GST... 140 2e-32
gi|17533775|ref|NP_496859.1| glutathione S-Transferase (gst-24) ... 139 5e-32
gi|39596775|emb|CAE59002.1| Hypothetical protein CBG02278 [Caeno... 136 3e-31
gi|17534681|ref|NP_496357.1| glutathione S-Transferase (gst-5) [... 136 3e-31
gi|17537497|ref|NP_497121.1| glutathione S-Transferase (gst-31) ... 134 1e-30
gi|39579272|emb|CAE56959.1| Hypothetical protein CBG24809 [Caeno... 133 2e-30
gi|17534687|ref|NP_494884.1| glutathione S-Transferase (gst-8) [... 132 3e-30
gi|39591201|emb|CAE73254.1| Hypothetical protein CBG20670 [Caeno... 132 4e-30
gi|17534685|ref|NP_494883.1| glutathione S-Transferase (23.0 kD)... 132 4e-30
gi|39591186|emb|CAE73239.1| Hypothetical protein CBG20648 [Caeno... 130 1e-29
gi|17537493|ref|NP_497119.1| glutathione S-transferase family me... 130 1e-29
gi|17533781|ref|NP_496860.1| glutathione S-Transferase (gst-15) ... 130 2e-29
gi|17537489|ref|NP_497117.1| glutathione S-Transferase (gst-28) ... 127 1e-28
gi|39596768|emb|CAE58995.1| Hypothetical protein CBG02268 [Caeno... 127 2e-28
gi|17537487|ref|NP_497116.1| glutathione S-Transferase (gst-27) ... 127 2e-28
gi|17537491|ref|NP_497118.1| glutathione S-Transferase (gst-29) ... 126 3e-28
gi|17541378|ref|NP_501848.1| glutathione S-Transferase (23.9 kD)... 126 3e-28
gi|17537895|ref|NP_494902.1| glutathione S-Transferase (gst-30) ... 125 5e-28
gi|17533789|ref|NP_496864.1| glutathione S-Transferase (gst-19) ... 124 1e-27
gi|17557472|ref|NP_503968.1| glutathione S-Transferase (gst-33) ... 123 2e-27
gi|39591187|emb|CAE73240.1| Hypothetical protein CBG20649 [Caeno... 123 2e-27
gi|39591199|emb|CAE73252.1| Hypothetical protein CBG20668 [Caeno... 123 2e-27
gi|17533779|ref|NP_496861.1| glutathione S-Transferase (gst-14) ... 123 3e-27
gi|17533777|ref|NP_496862.1| glutathione S-Transferase (gst-12) ... 122 3e-27
gi|17565374|ref|NP_503532.1| predicted CDS, glutathione S-Transf... 122 3e-27
gi|39584542|emb|CAE74620.1| Hypothetical protein CBG22411 [Caeno... 122 4e-27
gi|39587305|emb|CAE74959.1| Hypothetical protein CBG22850 [Caeno... 121 1e-26
gi|17535437|ref|NP_494887.1| glutathione S-Transferase (gst-9) [... 120 1e-26
gi|32565684|ref|NP_497123.2| predicted CDS, glutathione S-Transf... 120 1e-26
gi|39592704|emb|CAE62318.1| Hypothetical protein CBG06384 [Caeno... 119 3e-26
gi|17560538|ref|NP_506983.1| glutathione S-Transferase (gst-38) ... 119 4e-26
gi|17537485|ref|NP_497115.1| glutathione S-Transferase (gst-26) ... 119 4e-26
gi|32564842|ref|NP_741061.2| glutathione S-Transferase (gst-35) ... 119 5e-26
gi|39585760|emb|CAE59962.1| Hypothetical protein CBG03452 [Caeno... 117 2e-25
gi|39585759|emb|CAE59961.1| Hypothetical protein CBG03451 [Caeno... 116 3e-25
gi|17560032|ref|NP_507095.1| glutathione S-Transferase (gst-22) ... 114 2e-24
gi|7498934|pir||T29984 hypothetical protein F11G11.3 - Caenorhab... 112 3e-24
gi|32564637|ref|NP_494882.2| glutathione S-Transferase (23.6 kD)... 112 3e-24
gi|39579271|emb|CAE56958.1| Hypothetical protein CBG24808 [Caeno... 112 5e-24
gi|17533783|ref|NP_496863.1| glutathione S-Transferase (gst-16) ... 111 1e-23
gi|17535439|ref|NP_494889.1| glutathione S-Transferase (gst-9) [... 107 1e-22
gi|32565758|ref|NP_741060.2| predicted CDS, glutathione S-Transf... 107 2e-22
gi|39585761|emb|CAE59963.1| Hypothetical protein CBG03453 [Caeno... 107 2e-22
gi|17540932|ref|NP_501847.1| glutathione S-Transferase (21.8 kD)... 105 6e-22
gi|17540934|ref|NP_501846.1| glutathione S-Transferase (23.7 kD)... 103 2e-21
gi|39585723|emb|CAE59925.1| Hypothetical protein CBG03411 [Caeno... 102 6e-21
gi|39591200|emb|CAE73253.1| Hypothetical protein CBG20669 [Caeno... 101 1e-20
gi|39592701|emb|CAE62315.1| Hypothetical protein CBG06381 [Caeno... 99 7e-20
gi|7505572|pir||T23484 hypothetical protein K08F4.6 - Caenorhabd... 97 2e-19
gi|1170107|sp|P46429|GTS2_MANSE GLUTATHIONE S-TRANSFERASE 2 (GST... 95 7e-19
gi|49900017|gb|AAH77016.1| Unknown (protein for MGC:89746) [Xeno... 94 1e-18
gi|21952442|gb|AAM82563.1| glutathione s-transferase [Xenopus la... 94 1e-18
gi|32450087|gb|AAH53774.1| MGC64301 protein [Xenopus laevis] 94 1e-18
gi|32330663|gb|AAP79878.1| glutathione S-transferase [Solenopsis... 93 3e-18
gi|38051840|gb|AAH60462.1| MGC68589 protein [Xenopus laevis] 93 4e-18
gi|17566902|ref|NP_503492.1| glutathione S-Transferase (gst-21) ... 92 6e-18
gi|2326190|gb|AAB72147.1| allergen Bla g 5 [Blattella germanica] 92 8e-18
gi|6225491|sp|O18598|GTS1_BLAGE Glutathione S-transferase (GST c... 92 8e-18
gi|134283|sp|P27012|SC4_OCTDO S-CRYSTALLIN 4 (OL4) >gnl|BL_ORD_I... 91 1e-17
gi|45384344|ref|NP_990342.1| prostaglandin-D synthase [Gallus ga... 91 1e-17
gi|17533787|ref|NP_496866.1| glutathione S-Transferase (gst-18) ... 91 1e-17
gi|1170110|sp|P46437|GTS_MUSDO GLUTATHIONE S-TRANSFERASE (GST CL... 91 2e-17
gi|3514020|gb|AAC34097.1| glutathione transferase; PiGSTII [Plat... 91 2e-17
gi|49532926|dbj|BAD26698.1| Glutathione S transferase 2-like pro... 89 4e-17
gi|7505567|pir||T23485 hypothetical protein K08F4.11 - Caenorhab... 89 5e-17
gi|134271|sp|P27009|SC1_OCTDO S-CRYSTALLIN 1 (OL1) >gnl|BL_ORD_I... 88 9e-17
gi|39597765|emb|CAE68457.1| Hypothetical protein CBG14247 [Caeno... 88 1e-16
gi|24654347|ref|NP_725653.1| CG8938-PA [Drosophila melanogaster]... 87 2e-16
gi|31980908|ref|NP_062328.2| prostaglandin D2 synthase 2, hemato... 85 8e-16
gi|134280|sp|P27014|SC2_OCTVU S-crystallin 2 >gnl|BL_ORD_ID|1015... 84 1e-15
gi|2495111|sp|Q25626|SC3_OCTVU S-CRYSTALLIN 3 >gnl|BL_ORD_ID|170... 84 2e-15
gi|625079|gb|AAA97540.1| S-crystallin 84 2e-15
gi|134261|sp|P18426|SC11_OMMSL S-CRYSTALLIN SL11 (MAJOR LENS POL... 84 2e-15
gi|25152187|ref|NP_509652.2| glutathione S-Transferase (23.9 kD)... 84 2e-15
gi|13928888|ref|NP_113832.1| prostaglandin D2 synthase 2; prosta... 84 2e-15
gi|159838|gb|AAA29403.1| S-crystallin 83 3e-15
gi|17569381|ref|NP_508625.1| glutathione S-Transferase (gst-11) ... 83 3e-15
gi|31559115|gb|AAP50848.1| glutathione S-transferase 2 [Bombyx m... 83 3e-15
gi|39590943|emb|CAE58723.1| Hypothetical protein CBG01908 [Caeno... 83 4e-15
gi|20139191|sp|Q9JHF7|PGD2_MOUSE Glutathione-requiring prostagla... 83 4e-15
gi|48095724|ref|XP_394518.1| similar to glutathione S-transferas... 83 4e-15
gi|134279|sp|P27010|SC2_OCTDO S-CRYSTALLIN 2 (OL2) >gnl|BL_ORD_I... 82 5e-15
gi|7657457|ref|NP_055300.1| prostaglandin-D synthase; hematopoie... 80 2e-14
gi|134281|sp|P27011|SC3_OCTDO S-CRYSTALLIN 3 (OL3) >gnl|BL_ORD_I... 80 2e-14
gi|30749298|pdb|1IYH|A Chain A, Crystal Structure Of Hematopoiet... 79 4e-14
gi|134268|sp|P27016|SC18_OMMSL S-CRYSTALLIN SL18 >gnl|BL_ORD_ID|... 78 1e-13
gi|624302|gb|AAA97541.1| S-crystallin 75 6e-13
gi|40362717|gb|AAR84628.1| glutathione S-transferase [Gryllotalp... 75 8e-13
gi|1170111|sp|P46088|GTS_OMMSL Glutathione S-transferase (GST cl... 75 8e-13
gi|1065021|pdb|1GSQ| Glutathione S-Transferase (Gst) (E.C.2.5.1... 75 8e-13
gi|624328|gb|AAB01055.1| S-crystallin 75 1e-12
gi|31205195|ref|XP_311546.1| ENSANGP00000023017 [Anopheles gambi... 74 2e-12
gi|21435011|gb|AAM53611.1| glutathione S-transferase S1-2 [Anoph... 73 3e-12
gi|31205193|ref|XP_311545.1| ENSANGP00000010247 [Anopheles gambi... 73 3e-12
gi|7506384|pir||T23994 hypothetical protein R07B1.4 - Caenorhabd... 73 4e-12
gi|481923|pir||S40165 glutathione transferase (EC 2.5.1.18) - ne... 73 4e-12
gi|1170077|sp|P46434|GT1_ONCVO GLUTATHIONE S-TRANSFERASE 1 >gnl|... 73 4e-12
gi|12005978|gb|AAG44695.1| glutathione S-transferase Ia [Onchoce... 73 4e-12
gi|624318|gb|AAA97549.1| S-crystallin 73 4e-12
gi|17533785|ref|NP_496865.1| glutathione S-Transferase (gst-17) ... 72 5e-12
gi|12005980|gb|AAG44696.1| glutathione S-transferase Ib [Onchoce... 72 7e-12
gi|1170108|sp|P46428|GTS_ANOGA GLUTATHIONE S-TRANSFERASE (GST CL... 71 2e-11
gi|624322|gb|AAA97551.1| S-crystallin 70 3e-11
gi|624332|gb|AAB01057.1| S-crystallin 69 6e-11
gi|477414|pir||A48982 glutathione transferase (EC 2.5.1.18) 2 - ... 68 1e-10
gi|624312|gb|AAA97546.1| S-crystallin 67 2e-10
gi|624324|gb|AAB01053.1| S-crystallin 67 2e-10
gi|624306|gb|AAA97543.1| S-crystallin 67 3e-10
gi|624336|gb|AAB01059.1| S-crystallin 67 3e-10
gi|32965121|gb|AAP91748.1| glutathione-requiring prostaglandin D... 66 4e-10
gi|28630830|gb|AAO45827.1| glutathione S-transferase [Wuchereria... 66 5e-10
gi|624330|gb|AAB01056.1| S-crystallin 65 6e-10
gi|624320|gb|AAA97550.1| S-crystallin 65 6e-10
gi|23428564|gb|AAL23713.1| glutathione S-transferase [Opisthorch... 64 1e-09
gi|624334|gb|AAB01058.1| S-crystallin 64 2e-09
gi|134275|sp|P18425|SC20_OMMSL S-CRYSTALLIN SL20-1 (MAJOR LENS P... 64 2e-09
gi|624308|gb|AAA97544.1| S-crystallin 64 2e-09
gi|624326|gb|AAB01054.1| S-crystallin 64 2e-09
gi|624316|gb|AAA97548.1| S-crystallin 64 2e-09
gi|84595|pir||S06442 crystallin (clone pSl20) - Sloane's squid >... 64 2e-09
gi|2058287|emb|CAA73325.1| glutathione transferase [Brugia malayi] 63 3e-09
gi|913849|gb|AAA73508.1| lens-specific S-crystallin {SL20-1} [oc... 63 3e-09
gi|159831|gb|AAA29402.1| S-crystallin 63 3e-09
gi|23480514|gb|EAA17054.1| glutathione s-transferase [Plasmodium... 62 7e-09
gi|39588670|emb|CAE58194.1| Hypothetical protein CBG01288 [Caeno... 62 7e-09
gi|39583549|emb|CAE65653.1| Hypothetical protein CBG10717 [Caeno... 62 9e-09
gi|34536838|gb|AAQ73932.1| GST-like hemolymph protein [Corcyra c... 62 9e-09
gi|624314|gb|AAA97547.1| S-crystallin 62 9e-09
gi|161013|gb|AAA29892.1| 28kDa glutathione-S transferase 61 2e-08
gi|624310|gb|AAA97545.1| S-crystallin 61 2e-08
gi|544443|sp|P30113|GT28_SCHBO GLUTATHIONE S-TRANSFERASE 28 KD (... 61 2e-08
gi|624304|gb|AAA97542.1| S-crystallin 61 2e-08
gi|232199|sp|P30114|GT28_SCHHA Glutathione S-transferase 28 kDa ... 61 2e-08
gi|4335859|gb|AAD17488.1| 28 kDa glutathione S-transferase; 28GS... 60 2e-08
gi|121700|sp|P09792|GT28_SCHMA Glutathione S-transferase 28 kDa ... 60 2e-08
gi|1389744|gb|AAB03573.1| glutathione-S-transferase 60 2e-08
gi|121699|sp|P26624|GT28_SCHJA Glutathione S-transferase 28 kDa ... 60 3e-08
gi|12859396|dbj|BAB31640.1| unnamed protein product [Mus musculus] 60 3e-08
gi|7387485|gb|AAB33637.2| glutathione S-transferase; GST [Nemato... 59 5e-08
gi|39588668|emb|CAE58192.1| Hypothetical protein CBG01286 [Caeno... 59 5e-08
gi|6137390|pdb|1B48|A Chain A, Crystal Structure Of Mgsta4-4 In ... 59 5e-08
gi|20141353|sp|P24472|GTA4_MOUSE Glutathione S-transferase 5.7 (... 59 5e-08
gi|12848219|dbj|BAB27873.1| unnamed protein product [Mus musculus] 59 5e-08
gi|6754082|ref|NP_034487.1| glutathione S-transferase, alpha 4 [... 59 5e-08
gi|49532912|dbj|BAD26691.1| Glutathione S-transferase [Plutella ... 59 5e-08
gi|2829287|gb|AAC00518.1| glutathione S-transferase [Schistosoma... 59 6e-08
gi|6671050|gb|AAF23078.1| glutathione S-transferase [Choristoneu... 59 8e-08
gi|17565768|ref|NP_503701.1| glutathione S-Transferase (24.8 kD)... 58 1e-07
gi|48106995|ref|XP_393084.1| similar to Glutathione-requiring pr... 57 3e-07
gi|17553834|ref|NP_499006.1| glutathione S-Transferase, P subuni... 56 4e-07
gi|34539115|gb|AAQ74441.1| glutathione S-transferase [Haemaphysa... 56 5e-07
gi|17564840|ref|NP_503889.1| glutathione S-Transferase (gst-23) ... 56 5e-07
gi|4322274|gb|AAD15991.1| glutathione S-transferase [Boophilus m... 55 9e-07
gi|50744870|ref|XP_419913.1| PREDICTED: glutathione S-transferas... 55 9e-07
gi|5360517|dbj|BAA82038.1| glutathione s-transferase [Cavia porc... 55 9e-07
gi|8928140|sp|P81706|GTA1_CAVPO Glutathione S-transferase A (GST... 55 9e-07
gi|45387463|gb|AAS60226.1| glutathione S-transferase pi [Mytilus... 55 1e-06
gi|49169816|ref|NP_001001777.1| glutathione S-transferase [Gallu... 55 1e-06
gi|11177841|gb|AAG32475.1| putative glutathione S-transferase Os... 55 1e-06
gi|34914740|ref|NP_918717.1| putative glutathione S-transferase ... 55 1e-06
gi|39588669|emb|CAE58193.1| Hypothetical protein CBG01287 [Caeno... 55 1e-06
gi|1170101|sp|P46426|GTP_DIRIM Glutathione S-transferase (GST cl... 54 1e-06
gi|7025464|gb|AAF35893.1| glutathione S-transferase GST-pi [Myti... 54 1e-06
gi|34539117|gb|AAQ74442.1| glutathione S-transferase [Rhipicepha... 52 6e-06
gi|22094809|gb|AAM91994.1| glutathione S-transferase GSTpi1 [Myt... 52 6e-06
gi|16518972|gb|AAL25087.1| glutathione s-transferase [Plasmodium... 52 6e-06
gi|4630882|dbj|BAA76974.1| glutathione S-transferase [Oncorhynch... 52 6e-06
gi|23509408|ref|NP_702075.1| glutathione s-transferase, putative... 52 6e-06
gi|39585029|emb|CAE62680.1| Hypothetical protein CBG06825 [Caeno... 52 9e-06
gi|34859224|ref|XP_234810.2| similar to GLUTATHIONE S-TRANSFERAS... 52 9e-06
gi|17563170|ref|NP_504894.1| glutathione S-Transferase (25.0 kD)... 52 9e-06
gi|22671705|gb|AAN04481.1| glutathione S-transferase GSTP2-2 [Bu... 51 1e-05
gi|2465439|gb|AAB72099.1| glutathione-dependent prostaglandin D ... 51 1e-05
gi|21450105|ref|NP_659118.1| cDNA sequence BC021614 [Mus musculu... 50 4e-05
gi|46329897|gb|AAH68854.1| Unknown (protein for IMAGE:3399306) [... 49 6e-05
gi|50400547|sp|Q8JFZ2|GTP1_XENLA Glutathione S-transferase P 1 (... 49 6e-05
gi|34861384|ref|XP_215189.2| similar to hypothetical protein MGC... 49 8e-05
gi|5822511|pdb|3GTU|B Chain B, Ligand-Free Heterodimeric Human G... 48 1e-04
gi|108301|pir||S13780 glutathione transferase (EC 2.5.1.18) clas... 48 1e-04
gi|1943418|pdb|2GSR|A Chain A, Structure Of Porcine Class Pi Glu... 48 1e-04
gi|544445|sp|P80031|GTP_PIG Glutathione S-transferase P (GST P1-... 48 1e-04
gi|23065552|ref|NP_000840.2| glutathione S-transferase M3; gluta... 48 1e-04
gi|14250650|gb|AAH08790.1| Glutathione S-transferase M3 [Homo sa... 48 1e-04
gi|23504743|emb|CAD29477.1| glutathione transferase F4 [Triticum... 48 1e-04
gi|32346216|gb|AAN85429.1| glutathione-S-transferase [Pyrocystis... 47 2e-04
gi|46120432|ref|XP_385039.1| hypothetical protein FG04863.1 [Gib... 47 2e-04
gi|50400626|sp|Q9BEA9|GTM3_MACFU Glutathione S-transferase Mu 3 ... 47 2e-04
gi|47228894|emb|CAG09409.1| unnamed protein product [Tetraodon n... 47 2e-04
gi|6680121|ref|NP_032209.1| glutathione S-transferase, mu 2; glu... 47 2e-04
gi|3402001|pdb|1FHE| Glutathione Transferase (Fh47) From Fascio... 47 2e-04
gi|384152|prf||1905266C glutathione S transferase:ISOTYPE=GST47 47 2e-04
gi|159060|gb|AAA29140.1| mu-glutathione transferase [Fasciola he... 47 2e-04
gi|1170098|sp|P46409|GTMU_RABIT Glutathione S-transferase Mu 1 (... 47 2e-04
gi|3915723|sp|P31670|GT27_FASHE Glutathione S-transferase 26 kDa... 47 2e-04
gi|18858197|ref|NP_571809.1| glutathione S-transferase pi [Danio... 47 3e-04
gi|13936373|dbj|BAB47185.1| glutathione S-transferase subunit gY... 47 3e-04
gi|4574306|gb|AAD23997.1| glutathione S-transferase [Fasciola gi... 45 7e-04
gi|6754086|ref|NP_034490.1| glutathione S-transferase, mu 5; glu... 45 9e-04
gi|106129|pir||A35295 glutathione transferase (EC 2.5.1.18) clas... 45 9e-04
gi|2264324|gb|AAB63382.1| 28 kDa glutathione-S transferase 45 9e-04
gi|4557966|pdb|2GTU|A Chain A, Ligand-Free Human Glutathione S-T... 45 0.001
gi|494185|pdb|1HNA| Glutathione S-Transferase (Human, Class Mu)... 45 0.001
gi|46126843|ref|XP_387975.1| hypothetical protein FG07799.1 [Gib... 45 0.001
gi|4504175|ref|NP_000839.1| glutathione S-transferase M2; glutat... 45 0.001
gi|232206|sp|P30116|GTMU_MESAU GLUTATHIONE S-TRANSFERASE (GST CL... 45 0.001
gi|207692|gb|AAA42351.1| glutathione S-transferase Yb2 subunit 44 0.002
gi|22218855|pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutat... 44 0.002
gi|28933457|ref|NP_803175.1| glutathione S-transferase, mu 2; gl... 44 0.002
gi|28828694|gb|AAO51292.1| similar to Xenopus laevis (African cl... 44 0.002
gi|1170081|sp|Q08863|GTA1_RABIT Glutathione S-transferase alpha ... 44 0.002
gi|1943433|pdb|6GSV|A Chain A, First-Sphere And Second-Sphere El... 44 0.002
gi|1943435|pdb|6GSW|A Chain A, First-Sphere And Second-Sphere El... 44 0.002
gi|1943397|pdb|6GSX|A Chain A, First-Sphere And Second-Sphere El... 44 0.002
gi|442967|pdb|1GSB|A Chain A, Glutathione S-Transferase (Isoenzy... 44 0.002
gi|1943431|pdb|6GSU|A Chain A, First-Sphere And Second-Sphere El... 44 0.002
gi|204501|gb|AAA41286.1| glutathione S-transferase (EC 2.5.1.18) 44 0.002
gi|25282395|ref|NP_742035.1| glutathione-S-transferase, mu 5 [Ra... 44 0.002
gi|8393502|ref|NP_058710.1| glutathione S-transferase, mu 1; glu... 44 0.002
gi|32188134|gb|AAP75791.1| glutathione S-transferase [Helicoverp... 44 0.002
gi|47076115|emb|CAD90167.1| mu class glutathione S-transferase [... 44 0.003
gi|4388890|pdb|1GTU|A Chain A, Ligand-Free Human Glutathione S-T... 43 0.003
gi|204499|gb|AAA41285.1| glutathione S-transferase Y-b subunit (... 43 0.003
gi|33356830|pdb|1B4P|A Chain A, Crystal Structures Of Class Mu C... 43 0.003
gi|11385467|gb|AAG34816.1| glutathione S-transferase GST 8 [Zea ... 43 0.003
gi|23065544|ref|NP_000552.2| glutathione S-transferase M1 isofor... 43 0.003
gi|1346208|sp|P47954|GTP_CRIMI Glutathione S-transferase P (GST ... 43 0.003
gi|4388948|pdb|5FWG|A Chain A, Tetra-(5-Fluorotryptophanyl)-Glut... 43 0.004
gi|29726512|pdb|1MTC|A Chain A, Glutathione Transferase Mutant Y... 43 0.004
gi|13516447|dbj|BAB40442.1| glutathione transferase M2 [Macaca f... 43 0.004
gi|38047983|gb|AAR09894.1| similar to Drosophila melanogaster CG... 43 0.004
gi|544442|sp|P35661|GT27_SCHMA GLUTATHIONE S-TRANSFERASE 26 KD (... 43 0.004
gi|306812|gb|AAA59203.1| glutathione transferase M1 >gnl|BL_ORD_... 43 0.004
gi|50400684|sp|Q9TSM4|GTM2_MACFA Glutathione S-transferase Mu 2 ... 43 0.004
gi|32188136|gb|AAP75792.1| glutathione S-transferase [Helicoverp... 43 0.004
gi|32188132|gb|AAP75790.1| glutathione S-transferase [Helicoverp... 42 0.006
gi|423912|pir||A46143 mu-class glutathione S-transferase hGSTYBX... 42 0.006
gi|15218641|ref|NP_171793.1| glutathione S-transferase, putative... 42 0.007
gi|25518742|pir||H86159 hypothetical protein F22D16.6 - Arabidop... 42 0.007
gi|6754084|ref|NP_034488.1| glutathione S-transferase, mu 1; glu... 42 0.007
gi|49900006|gb|AAH77010.1| Unknown (protein for MGC:89704) [Xeno... 42 0.007
gi|204503|gb|AAA41287.1| glutathione S-transferase Yb-1 subunit ... 42 0.010
gi|28461273|ref|NP_787019.1| glutathione S-transferase M1 [Bos t... 42 0.010
gi|23065563|ref|NP_000842.2| glutathione S-transferase M5; gluta... 42 0.010
gi|1170097|sp|P46439|GTM5_HUMAN Glutathione S-transferase Mu 5 (... 42 0.010
gi|25153666|ref|NP_503673.2| glutathione S-transferase, N-termin... 41 0.013
gi|15237931|ref|NP_197224.1| glutathione S-transferase, putative... 41 0.013
gi|21263651|sp|P81942|GTP1_BUFBU Glutathione S-transferase P 1 (... 41 0.013
gi|2624495|pdb|1BAY|A Chain A, Glutathione S-Transferase Yfyf Cy... 41 0.017
gi|18391048|ref|NP_563848.1| elongation factor 1B-gamma, putativ... 41 0.017
gi|26347823|dbj|BAC37560.1| unnamed protein product [Mus musculus] 41 0.017
gi|22671702|gb|AAN04480.1| glutathione S-transferase GSTP1-1 [Bu... 41 0.017
gi|4557944|pdb|1GTI|A Chain A, Modified Glutathione S-Transferas... 41 0.017
gi|576133|pdb|1GLP|A Chain A, Glutathione S-Transferase Yfyf (Cl... 41 0.017
gi|161007|gb|AAA29889.1| glutathione S-transferase 41 0.017
gi|37748321|gb|AAH58881.1| Glutathione S-transferase M5 [Homo sa... 41 0.017
gi|121698|sp|P15964|GT26_SCHMA Glutathione S-transferase 26 kDa ... 41 0.017
gi|21618868|gb|AAH31818.1| Gstm6 protein [Mus musculus] 41 0.017
gi|10092608|ref|NP_038569.1| glutathione S-transferase, pi 1; Gs... 41 0.017
gi|28900906|ref|NP_800561.1| putative glutathione S-transferase ... 40 0.022
gi|193690|gb|AAA37748.1| glutathione transferase (EC 2.5.1.18) 40 0.022
gi|1083336|pir||A55140 glutathione transferase (EC 2.5.1.18) piA... 40 0.022
gi|33468899|ref|NP_034489.1| glutathione S-transferase, mu 3; gl... 40 0.022
gi|25453412|ref|NP_620430.1| glutathione S-transferase, pi 2 [Ra... 40 0.022
gi|32401425|ref|NP_861461.1| glutathione S-transferase, pi 2; Gs... 40 0.022
gi|208305|gb|AAA72682.1| glutathione transferase 40 0.028
gi|4929901|pdb|1B8X|A Chain A, Glutathione S-Transferase Fused W... 40 0.028
gi|595742|gb|AAA57113.1| glutathione S-transferase 40 0.028
gi|84402|pir||A26484 glutathione transferase (EC 2.5.1.18) - flu... 40 0.028
gi|595738|gb|AAA57110.1| glutathione S-transferase 40 0.028
gi|1814366|gb|AAB41882.1| GST-6his [Expression vector pGEX-2T-6H] 40 0.028
gi|595714|gb|AAA57092.1| glutathione S-transferase 40 0.028
gi|1699069|gb|AAB37352.1| glutathione S-transferase [Cloning vec... 40 0.028
gi|595722|gb|AAA57098.1| glutathione S-transferase 40 0.028
gi|3983117|gb|AAC83809.1| glutathione S-transferase [Expression ... 40 0.028
gi|1850359|gb|AAB48035.1| GST-fusion protein [Expression vector ... 40 0.028
gi|6980848|pdb|1DUG|A Chain A, Structure Of The Fibrinogen G Cha... 40 0.028
gi|4389298|pdb|1BG5| Crystal Structure Of The Ankyrin Binding D... 40 0.028
gi|3002500|gb|AAC08718.1| GSTmFra2/79-242 [Expression vector pGH... 40 0.028
gi|1699065|gb|AAB37349.1| glutathione S-transferase [Cloning vec... 40 0.028
gi|34914756|ref|NP_918725.1| putative glutathione S-transferase ... 40 0.028
gi|20385949|gb|AAM21516.1| GST-M.SPRX methyltransferase fusion p... 40 0.028
gi|3002516|gb|AAC08730.1| GSTmFra2/2-327 [Expression vector pGH/... 40 0.028
gi|15099967|gb|AAK84183.1| glutathione-S-transferase-nitroreduct... 40 0.028
gi|21666485|gb|AAM73721.1| glutathione-S-transferase/nitroreduct... 40 0.028
gi|232200|sp|P30111|GTH2_WHEAT GLUTATHIONE S-TRANSFERASE 2 (GST ... 40 0.028
gi|3184404|dbj|BAA28713.1| GST-stuffer fusion protein [Cloning v... 40 0.028
gi|467623|emb|CAA55122.1| fusion peptide [synthetic construct] 40 0.028
gi|3002496|gb|AAC08715.1| GSTmFra2/2-163 [Expression vector pGH/... 40 0.028
gi|477190|pir||A48388 glutathione S-transferase - liver fluke (f... 40 0.028
gi|31208165|ref|XP_313049.1| ENSANGP00000011661 [Anopheles gambi... 40 0.028
gi|3242311|emb|CAA11559.1| glutathione-S-transferase [synthetic ... 40 0.028
gi|809436|pdb|1GNE| Glutathione S-Transferase (E.C.2.5.1.18) Fu... 40 0.028
gi|595710|gb|AAA57089.1| glutathione S-transferase 40 0.028
gi|595718|gb|AAA57095.1| glutathione S-transferase 40 0.028
gi|595730|gb|AAA57104.1| glutathione S-transferase 40 0.028
gi|595734|gb|AAA57107.1| glutathione S-transferase 40 0.028
gi|1850357|gb|AAB48034.1| GST-fusion protein [Expression vector ... 40 0.028
gi|208443|gb|AAB59734.1| glutathione transferase 40 0.028
gi|15216974|gb|AAK92454.1| GST-loxP-cre recombinase fusion prote... 40 0.028
gi|31208161|ref|XP_313047.1| ENSANGP00000023440 [Anopheles gambi... 40 0.028
gi|3002512|gb|AAC08727.1| GSTmFra2/79-327 [Expression vector pGH... 40 0.028
gi|121697|sp|P08515|GT26_SCHJA Glutathione S-transferase 26 kDa ... 40 0.028
gi|232197|sp|P30112|GT26_FASHE GLUTATHIONE S-TRANSFERASE 26 KD 5... 40 0.028
gi|1170093|sp|P42769|GTH5_ARATH Glutathione S-transferase PM239X... 40 0.028
gi|15099965|gb|AAK84182.1| glutathione-S-transferase-nitroreduct... 40 0.028
gi|3002508|gb|AAC08724.1| GSTmFra2/2-242 [Expression vector pGH/... 40 0.028
gi|38081896|ref|XP_124621.2| similar to Glutathione S-transferas... 40 0.028
gi|595726|gb|AAA57101.1| glutathione S-transferase 40 0.028
gi|23821204|emb|CAD53317.1| glutathione-S-transferase [Cloning v... 40 0.028
gi|1527195|gb|AAB88910.1| glutathione S-transferase [Expression ... 40 0.028
gi|1699061|gb|AAB37346.1| glutathione S-transferase [Cloning vec... 40 0.028
gi|1850361|gb|AAB48036.1| GST-fusion protein [Expression vector ... 40 0.028
gi|595706|gb|AAA57086.1| glutathione S-transferase 40 0.028
gi|3002504|gb|AAC08721.1| GSTmFra2/159-327 [Expression vector pG... 40 0.028
gi|3023905|sp|Q60550|GTP_MESAU Glutathione S-transferase P (GST ... 40 0.028
gi|38155842|gb|AAR12690.1| glutathione S-transferase [Expression... 40 0.028
gi|1814368|gb|AAB41883.1| GST-6his [Expression vector pGEX-2T-6H... 40 0.028
gi|11385457|gb|AAG34811.1| glutathione S-transferase GST 21 [Gly... 40 0.037
gi|6625558|gb|AAF19264.1| glutathione S-transferase [Psoroptes o... 40 0.037
gi|18150415|gb|AAL61612.1| glutathione S-transferase [Allium cepa] 40 0.037
gi|20386063|gb|AAM21563.1| glutathione S-transferase [Nilaparvat... 40 0.037
gi|10120486|ref|NP_065415.1| glutathione S-transferase Yb4 gene ... 40 0.037
gi|1526622|emb|CAA68944.1| 26kD glutathione S-transferase [Schis... 40 0.037
gi|7110613|ref|NP_032210.1| glutathione S-transferase, mu 6; glu... 40 0.037
gi|2842717|sp|Q93112|GTT5_ANOGA GLUTATHIONE S-TRANSFERASE 1-5 (G... 39 0.049
gi|20138154|sp|O35660|GTM6_MOUSE Glutathione S-transferase Mu 6 ... 39 0.049
gi|34859803|ref|XP_215682.2| similar to glutathione transferase ... 39 0.049
gi|46204955|ref|ZP_00049243.2| COG0625: Glutathione S-transferas... 39 0.063
gi|384151|prf||1905266B glutathione S transferase:ISOTYPE=GST7 39 0.063
gi|27462836|gb|AAO15607.1| glutathione S-transferase [Sarcoptes ... 39 0.063
gi|3915724|sp|P31671|GT28_FASHE GLUTATHIONE S-TRANSFERASE 26 KD ... 39 0.063
gi|159058|gb|AAA29139.1| mu-glutathione transferase [Fasciola he... 39 0.063
gi|66615|pir||XUZM1 glutathione transferase (EC 2.5.1.18) I - maize 39 0.083
gi|232196|sp|P30110|GTH1_WHEAT Glutathione S-transferase 1 (GST ... 38 0.11
gi|39592078|emb|CAE75298.1| Hypothetical protein CBG23268 [Caeno... 38 0.14
gi|20130115|ref|NP_611329.1| CG17531-PA [Drosophila melanogaster... 37 0.18
gi|21591409|gb|AAM64045.1| glutathione S-transferase [Taenia sol... 37 0.18
gi|34914764|ref|NP_918729.1| putative glutathione S-transferase ... 37 0.18
gi|21483372|gb|AAM52661.1| LD04004p [Drosophila melanogaster] 37 0.18
gi|477946|pir||C46681 glutathione transferase (EC 2.5.1.18) D24 ... 37 0.18
gi|45549270|ref|NP_524914.3| CG12242-PA [Drosophila melanogaster... 37 0.18
gi|50540310|ref|NP_001002621.1| zgc:92254 [Danio rerio] >gnl|BL_... 37 0.18
gi|2316076|gb|AAB66318.1| glutathione S-transferase [Echinococcu... 37 0.24
gi|47228778|emb|CAG07510.1| unnamed protein product [Tetraodon n... 37 0.24
gi|1004227|emb|CAA59739.1| glutathione transferase [Echinococcus... 37 0.24
gi|3023918|sp|Q52828|GSTA_RHILE GSTA PROTEIN >gnl|BL_ORD_ID|1716... 37 0.24
gi|3582502|gb|AAC35245.1| glutathione S-transferase isozyme 3 [P... 37 0.24
gi|47205768|emb|CAF91521.1| unnamed protein product [Tetraodon n... 37 0.24
gi|28076911|ref|NP_081040.1| glutathione S-transferase, mu 4; gl... 37 0.24
gi|50400685|sp|Q9TSM5|GTM1_MACFA Glutathione S-transferase Mu 1 ... 37 0.24
gi|28828399|gb|AAO51029.1| similar to Rattus norvegicus (Rat). G... 37 0.31
gi|6980588|pdb|4GTU|A Chain A, Ligand-Free Homodimeric Human Glu... 36 0.41
gi|46139051|ref|XP_391216.1| hypothetical protein FG11040.1 [Gib... 36 0.41
gi|38100531|gb|EAA47645.1| hypothetical protein MG02888.4 [Magna... 36 0.41
gi|4504179|ref|NP_000841.1| glutathione S-transferase M4 isoform... 36 0.41
gi|306817|gb|AAA57346.1| glutathione transferase M4 36 0.41
gi|422842|pir||S32425 glutathione transferase (EC 2.5.1.18) clas... 36 0.41
gi|34785909|gb|AAH57757.1| MGC69150 protein [Xenopus laevis] 36 0.41
gi|17561414|ref|NP_505972.1| glutathione S-transferase, C-termin... 36 0.41
gi|16271819|ref|NP_438156.1| hypothetical protein [Temperate pha... 36 0.54
gi|34534082|dbj|BAC86900.1| unnamed protein product [Homo sapiens] 35 0.70
gi|47086689|ref|NP_997841.1| Unknown (protein for MGC:66370); gl... 35 0.70
gi|11990261|emb|CAC19630.1| dichloromethane dehalogenase [uniden... 35 0.70
gi|11990255|emb|CAC19576.1| dichloromethane dehalogenase [Hyphom... 35 0.70
gi|11990259|emb|CAC19577.1| dichloromethane dehalogenase [Hyphom... 35 0.70
gi|118339|sp|P21161|DCMA_METDI Dichloromethane dehalogenase (DCM... 35 0.70
gi|11990163|emb|CAC19546.1| dichloromethane dehalogenase [bacter... 35 0.70
gi|11990165|emb|CAC19545.1| dichloromethane dehalogenase [dichlo... 35 0.70
gi|11990257|emb|CAC19600.1| dichloromethane dehalogenase [Methyl... 35 0.70
gi|24654975|ref|NP_611325.2| CG17524-PA [Drosophila melanogaster... 35 0.70
gi|50402815|gb|AAT76630.1| glutathione-S-transferase M3 [Felis c... 35 0.70
gi|21956654|gb|AAL02369.3| class gamma glutathione S-transferase... 35 0.70
gi|399829|sp|Q00285|GTMU_CRILO GLUTATHIONE S-TRANSFERASE Y1 (CHA... 35 0.70
gi|50421503|ref|XP_459302.1| unnamed protein product [Debaryomyc... 35 0.92
gi|11139989|emb|CAC16080.1| glutathione S-transferase [Pichia an... 35 0.92
gi|15888177|ref|NP_353858.1| AGR_C_1530p [Agrobacterium tumefaci... 35 0.92
gi|27381775|ref|NP_773304.1| glutathione S-transferase [Bradyrhi... 35 0.92
gi|630505|pir||S44745 C02D5.3 protein - Caenorhabditis elegans 35 0.92
gi|17864594|ref|NP_524913.1| CG11512-PA [Drosophila melanogaster... 35 0.92
gi|31208159|ref|XP_313046.1| ENSANGP00000011261 [Anopheles gambi... 35 0.92
gi|5880849|gb|AAD54937.1| glutathione S-transferase 6A [Musca do... 35 0.92
gi|32565776|ref|NP_871705.1| glutathione S-transferase, N-termin... 35 0.92
gi|3549272|gb|AAC79997.1| glutathione S-transferase D7 [Anophele... 35 0.92
gi|31208169|ref|XP_313051.1| ENSANGP00000025279 [Anopheles gambi... 35 1.2
gi|25287116|pir||T52085 glutathione transferase (EC 2.5.1.18) GS... 35 1.2
gi|31208167|ref|XP_313050.1| ENSANGP00000024808 [Anopheles gambi... 35 1.2
gi|14517793|gb|AAK64362.1| glutathione-S-transferase-like protei... 35 1.2
gi|24643530|ref|NP_728347.1| CG1702-PA [Drosophila melanogaster]... 34 1.6
gi|3023699|sp|Q91375|EF1H_XENLA Elongation factor 1-gamma type 2... 34 1.6
gi|25287117|pir||T52087 glutathione transferase (EC 2.5.1.18) GS... 34 1.6
gi|31239111|ref|XP_319969.1| ENSANGP00000025069 [Anopheles gambi... 34 1.6
gi|28630336|gb|AAM93480.1| eukaryotic translation elongation fac... 34 1.6
gi|28571670|ref|NP_788656.1| CG4381-PA [Drosophila melanogaster]... 34 1.6
gi|50260616|gb|EAL23269.1| hypothetical protein CNBA3850 [Crypto... 34 1.6
gi|23504741|emb|CAD29476.1| glutathione transferase F3 [Triticum... 34 1.6
gi|15228488|ref|NP_186969.1| glutathione S-transferase, putative... 34 1.6
gi|478137|pir||E46681 glutathione transferase (EC 2.5.1.18) D23 ... 34 1.6
gi|23469076|ref|ZP_00124411.1| COG0625: Glutathione S-transferas... 34 1.6
gi|30145756|emb|CAA96662.2| Hypothetical protein F55A11.6 [Caeno... 34 2.0
gi|13472292|ref|NP_103859.1| probable glutathione S-transferase ... 34 2.0
gi|23504745|emb|CAD29478.1| glutathione transferase F5 [Triticum... 34 2.0
gi|36959131|gb|AAQ87556.1| Glutathione S-transferase [Rhizobium ... 34 2.0
gi|13592152|ref|NP_112416.1| glutathione S-transferase, mu type ... 34 2.0
gi|31239117|ref|XP_319972.1| ENSANGP00000016648 [Anopheles gambi... 33 2.7
gi|17944983|gb|AAL48554.1| RE03226p [Drosophila melanogaster] 33 2.7
gi|21406640|gb|AAL48788.2| RE21095p [Drosophila melanogaster] 33 2.7
gi|17933730|ref|NP_525114.1| CG4371-PA [Drosophila melanogaster]... 33 2.7
gi|31933|emb|CAA48636.1| glutathione S-transferase [Homo sapiens] 33 2.7
gi|45518067|ref|ZP_00169618.1| COG0625: Glutathione S-transferas... 33 2.7
gi|1353751|gb|AAB01781.1| glutathione S-transferase III homolog 33 2.7
gi|31197105|ref|XP_307500.1| ENSANGP00000015332 [Anopheles gambi... 33 2.7
gi|21434999|gb|AAM53606.1| glutathione S-transferase D5 [Anophel... 33 2.7
gi|31208185|ref|XP_313059.1| ENSANGP00000011770 [Anopheles gambi... 33 2.7
gi|19922532|ref|NP_611328.1| CG17530-PA [Drosophila melanogaster... 33 2.7
gi|24654965|ref|NP_611322.1| CG17522-PA [Drosophila melanogaster... 33 3.5
gi|1524316|emb|CAA68993.1| glutathione S-transferase [Petunia x ... 33 3.5
gi|27382286|ref|NP_773815.1| hypothetical glutathione S-transfer... 33 3.5
gi|28494710|ref|XP_289885.1| RIKEN cDNA 0610005A07 [Mus musculus... 33 3.5
gi|134272|sp|P27013|SC1_OCTVU S-CRYSTALLIN 1 >gnl|BL_ORD_ID|3860... 33 3.5
gi|37534016|ref|NP_921310.1| putative Bronze-2 protein [Oryza sa... 33 3.5
gi|729399|sp|P40921|EF1G_SCHPO Elongation factor 1-gamma (EF-1-g... 33 4.5
gi|19115792|ref|NP_594880.1| elongation factor 1-gamma [Schizosa... 33 4.5
gi|48731293|ref|ZP_00265038.1| COG0625: Glutathione S-transferas... 33 4.5
gi|18158596|gb|AAL59658.1| glutathione S-transferase E1 [Anophel... 33 4.5
gi|18874391|gb|AAL78751.1| translation elongation factor-1 gamma... 33 4.5
gi|39937374|ref|NP_949650.1| possible glutathione S-transferase ... 33 4.5
gi|19745802|ref|NP_606938.1| hypothetical phage protein [Strepto... 33 4.5
gi|21910466|ref|NP_664734.1| conserved hypothetical protein - ph... 33 4.5
gi|84408|pir||S02458 glutathione transferase (EC 2.5.1.18) s.m.1... 33 4.5
gi|28869236|ref|NP_791855.1| glutathione S-transferase family pr... 33 4.5
gi|15222832|ref|NP_175408.1| glutathione S-transferase, putative... 32 5.9
gi|24651001|ref|NP_652000.1| CG11901-PA [Drosophila melanogaster... 32 5.9
gi|50304393|ref|XP_452146.1| unnamed protein product [Kluyveromy... 32 5.9
gi|46915784|emb|CAG22555.1| putative glutathione S-transferase [... 32 5.9
gi|12853535|dbj|BAB29771.1| unnamed protein product [Mus musculus] 32 5.9
gi|46187538|ref|ZP_00127362.2| COG0625: Glutathione S-transferas... 32 5.9
gi|39591658|emb|CAE71235.1| Hypothetical protein CBG18105 [Caeno... 32 5.9
gi|23124961|ref|ZP_00106917.1| COG0625: Glutathione S-transferas... 32 5.9
gi|46409184|gb|AAS93749.1| RE15368p [Drosophila melanogaster] 32 5.9
gi|25012528|gb|AAN71367.1| RE32823p [Drosophila melanogaster] 32 5.9
gi|1170092|sp|P46420|GTH4_MAIZE Glutathione S-transferase IV (GS... 32 7.7
gi|19922528|ref|NP_611324.1| CG17523-PA [Drosophila melanogaster... 32 7.7
gi|10120620|pdb|1C72|A Chain A, Tyr115, Gln165 And Trp209 Contri... 32 7.7
gi|2981970|pdb|1GSU|A Chain A, An Avian Class-Mu Glutathione S-T... 32 7.7
gi|25405037|pir||G96827 protein F20B17.10 [imported] - Arabidops... 32 7.7
gi|104677|pir||S18464 glutathione transferase (EC 2.5.1.18) mu2 ... 32 7.7
gi|46447169|ref|YP_008534.1| putative heat shock protein HtpG [P... 32 7.7
gi|46048786|ref|NP_990421.1| glutathione S-transferases CL2 [Gal... 32 7.7
gi|49091862|ref|XP_407392.1| hypothetical protein AN3255.2 [Aspe... 32 7.7
gi|39934646|ref|NP_946922.1| putative glutathione S-transferase ... 32 7.7
gi|15219447|ref|NP_178086.1| wall-associated kinase, putative [A... 32 7.7
gi|18202336|sp|P70102|MCA3_CRIGR Multisynthetase complex auxilia... 32 7.7
>gi|17537261|ref|NP_496858.1| glutathione S-Transferase (gst-20)
[Caenorhabditis elegans]
gi|7510009|pir||T21905 hypothetical protein Y48E1B.10 -
Caenorhabditis elegans
gi|31044411|emb|CAB02297.3| Hypothetical protein Y48E1B.10
[Caenorhabditis elegans]
gi|31044412|emb|CAB07700.3| Hypothetical protein Y48E1B.10
[Caenorhabditis elegans]
Length = 207
Score = 364 bits (935), Expect = e-100
Identities = 178/187 (95%), Positives = 178/187 (95%)
Frame = -1
Query: 564 LFALSGTKYEDIRIEHADWPAQKPKMPFGQMPVLELSSGLQIPQSMAIARYLAKKFGYAG 385
LFALSGTKYEDIRIEHADWPAQKPKMPFGQMPVLELSSGLQIPQSMAIARYLAKKFGYAG
Sbjct: 21 LFALSGTKYEDIRIEHADWPAQKPKMPFGQMPVLELSSGLQIPQSMAIARYLAKKFGYAG 80
Query: 384 KTXXXXXXXXXLIDQFKDFYAEIKPYYYAKIGVLQNDTEEEKKKTLIPARDKFLTIIGKF 205
KT LIDQFKDFYAEIKPYYYAKIGVLQNDTEEEKKKTLIPARDKFLTIIGKF
Sbjct: 81 KTDEEAALADALIDQFKDFYAEIKPYYYAKIGVLQNDTEEEKKKTLIPARDKFLTIIGKF 140
Query: 204 LKLSISGFLFSGGLTYADLMICDNMRTLIAWWPEYLNEYPDIKAWYQKVDGIPEIRKHLE 25
LKLSISGFLFSGGLTYADLMICDNMRTLIAWWPEYLNEYPDIKAWYQKVDGIPEIRKHLE
Sbjct: 141 LKLSISGFLFSGGLTYADLMICDNMRTLIAWWPEYLNEYPDIKAWYQKVDGIPEIRKHLE 200
Query: 24 SSPDKGF 4
SSPDKGF
Sbjct: 201 SSPDKGF 207