Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y48E1B_17
         (564 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17537261|ref|NP_496858.1| glutathione S-Transferase (gst-20) ...   364   e-100
gi|39591202|emb|CAE73255.1| Hypothetical protein CBG20671 [Caeno...   296   1e-79
gi|17536525|ref|NP_495967.1| glutathione S-Transferase (gst-13) ...   193   2e-48
gi|39589143|emb|CAE57876.1| Hypothetical protein CBG00918 [Caeno...   191   8e-48
gi|8917596|gb|AAF81283.1| glutathione S-transferase [Haemonchus ...   164   1e-39
gi|47717441|gb|AAT37718.1| glutathione S-transferase [Ancylostom...   162   4e-39
gi|7108568|gb|AAF36480.1| glutathione S-transferase 2 [Nematospi...   146   2e-34
gi|39591173|emb|CAE73226.1| Hypothetical protein CBG20632 [Caeno...   142   4e-33
gi|1170109|sp|P46436|GTS1_ASCSU Glutathione S-transferase 1 (GST...   140   2e-32
gi|17533775|ref|NP_496859.1| glutathione S-Transferase (gst-24) ...   139   5e-32
gi|39596775|emb|CAE59002.1| Hypothetical protein CBG02278 [Caeno...   136   3e-31
gi|17534681|ref|NP_496357.1| glutathione S-Transferase (gst-5) [...   136   3e-31
gi|17537497|ref|NP_497121.1| glutathione S-Transferase (gst-31) ...   134   1e-30
gi|39579272|emb|CAE56959.1| Hypothetical protein CBG24809 [Caeno...   133   2e-30
gi|17534687|ref|NP_494884.1| glutathione S-Transferase (gst-8) [...   132   3e-30
gi|39591201|emb|CAE73254.1| Hypothetical protein CBG20670 [Caeno...   132   4e-30
gi|17534685|ref|NP_494883.1| glutathione S-Transferase (23.0 kD)...   132   4e-30
gi|39591186|emb|CAE73239.1| Hypothetical protein CBG20648 [Caeno...   130   1e-29
gi|17537493|ref|NP_497119.1| glutathione S-transferase family me...   130   1e-29
gi|17533781|ref|NP_496860.1| glutathione S-Transferase (gst-15) ...   130   2e-29
gi|17537489|ref|NP_497117.1| glutathione S-Transferase (gst-28) ...   127   1e-28
gi|39596768|emb|CAE58995.1| Hypothetical protein CBG02268 [Caeno...   127   2e-28
gi|17537487|ref|NP_497116.1| glutathione S-Transferase (gst-27) ...   127   2e-28
gi|17537491|ref|NP_497118.1| glutathione S-Transferase (gst-29) ...   126   3e-28
gi|17541378|ref|NP_501848.1| glutathione S-Transferase (23.9 kD)...   126   3e-28
gi|17537895|ref|NP_494902.1| glutathione S-Transferase (gst-30) ...   125   5e-28
gi|17533789|ref|NP_496864.1| glutathione S-Transferase (gst-19) ...   124   1e-27
gi|17557472|ref|NP_503968.1| glutathione S-Transferase (gst-33) ...   123   2e-27
gi|39591187|emb|CAE73240.1| Hypothetical protein CBG20649 [Caeno...   123   2e-27
gi|39591199|emb|CAE73252.1| Hypothetical protein CBG20668 [Caeno...   123   2e-27
gi|17533779|ref|NP_496861.1| glutathione S-Transferase (gst-14) ...   123   3e-27
gi|17533777|ref|NP_496862.1| glutathione S-Transferase (gst-12) ...   122   3e-27
gi|17565374|ref|NP_503532.1| predicted CDS, glutathione S-Transf...   122   3e-27
gi|39584542|emb|CAE74620.1| Hypothetical protein CBG22411 [Caeno...   122   4e-27
gi|39587305|emb|CAE74959.1| Hypothetical protein CBG22850 [Caeno...   121   1e-26
gi|17535437|ref|NP_494887.1| glutathione S-Transferase (gst-9) [...   120   1e-26
gi|32565684|ref|NP_497123.2| predicted CDS, glutathione S-Transf...   120   1e-26
gi|39592704|emb|CAE62318.1| Hypothetical protein CBG06384 [Caeno...   119   3e-26
gi|17560538|ref|NP_506983.1| glutathione S-Transferase (gst-38) ...   119   4e-26
gi|17537485|ref|NP_497115.1| glutathione S-Transferase (gst-26) ...   119   4e-26
gi|32564842|ref|NP_741061.2| glutathione S-Transferase (gst-35) ...   119   5e-26
gi|39585760|emb|CAE59962.1| Hypothetical protein CBG03452 [Caeno...   117   2e-25
gi|39585759|emb|CAE59961.1| Hypothetical protein CBG03451 [Caeno...   116   3e-25
gi|17560032|ref|NP_507095.1| glutathione S-Transferase (gst-22) ...   114   2e-24
gi|7498934|pir||T29984 hypothetical protein F11G11.3 - Caenorhab...   112   3e-24
gi|32564637|ref|NP_494882.2| glutathione S-Transferase (23.6 kD)...   112   3e-24
gi|39579271|emb|CAE56958.1| Hypothetical protein CBG24808 [Caeno...   112   5e-24
gi|17533783|ref|NP_496863.1| glutathione S-Transferase (gst-16) ...   111   1e-23
gi|17535439|ref|NP_494889.1| glutathione S-Transferase (gst-9) [...   107   1e-22
gi|32565758|ref|NP_741060.2| predicted CDS, glutathione S-Transf...   107   2e-22
gi|39585761|emb|CAE59963.1| Hypothetical protein CBG03453 [Caeno...   107   2e-22
gi|17540932|ref|NP_501847.1| glutathione S-Transferase (21.8 kD)...   105   6e-22
gi|17540934|ref|NP_501846.1| glutathione S-Transferase (23.7 kD)...   103   2e-21
gi|39585723|emb|CAE59925.1| Hypothetical protein CBG03411 [Caeno...   102   6e-21
gi|39591200|emb|CAE73253.1| Hypothetical protein CBG20669 [Caeno...   101   1e-20
gi|39592701|emb|CAE62315.1| Hypothetical protein CBG06381 [Caeno...    99   7e-20
gi|7505572|pir||T23484 hypothetical protein K08F4.6 - Caenorhabd...    97   2e-19
gi|1170107|sp|P46429|GTS2_MANSE GLUTATHIONE S-TRANSFERASE 2 (GST...    95   7e-19
gi|49900017|gb|AAH77016.1| Unknown (protein for MGC:89746) [Xeno...    94   1e-18
gi|21952442|gb|AAM82563.1| glutathione s-transferase [Xenopus la...    94   1e-18
gi|32450087|gb|AAH53774.1| MGC64301 protein [Xenopus laevis]           94   1e-18
gi|32330663|gb|AAP79878.1| glutathione S-transferase [Solenopsis...    93   3e-18
gi|38051840|gb|AAH60462.1| MGC68589 protein [Xenopus laevis]           93   4e-18
gi|17566902|ref|NP_503492.1| glutathione S-Transferase (gst-21) ...    92   6e-18
gi|2326190|gb|AAB72147.1| allergen Bla g 5 [Blattella germanica]       92   8e-18
gi|6225491|sp|O18598|GTS1_BLAGE Glutathione S-transferase (GST c...    92   8e-18
gi|134283|sp|P27012|SC4_OCTDO S-CRYSTALLIN 4 (OL4) >gnl|BL_ORD_I...    91   1e-17
gi|45384344|ref|NP_990342.1| prostaglandin-D synthase [Gallus ga...    91   1e-17
gi|17533787|ref|NP_496866.1| glutathione S-Transferase (gst-18) ...    91   1e-17
gi|1170110|sp|P46437|GTS_MUSDO GLUTATHIONE S-TRANSFERASE (GST CL...    91   2e-17
gi|3514020|gb|AAC34097.1| glutathione transferase; PiGSTII [Plat...    91   2e-17
gi|49532926|dbj|BAD26698.1| Glutathione S transferase 2-like pro...    89   4e-17
gi|7505567|pir||T23485 hypothetical protein K08F4.11 - Caenorhab...    89   5e-17
gi|134271|sp|P27009|SC1_OCTDO S-CRYSTALLIN 1 (OL1) >gnl|BL_ORD_I...    88   9e-17
gi|39597765|emb|CAE68457.1| Hypothetical protein CBG14247 [Caeno...    88   1e-16
gi|24654347|ref|NP_725653.1| CG8938-PA [Drosophila melanogaster]...    87   2e-16
gi|31980908|ref|NP_062328.2| prostaglandin D2 synthase 2, hemato...    85   8e-16
gi|134280|sp|P27014|SC2_OCTVU S-crystallin 2 >gnl|BL_ORD_ID|1015...    84   1e-15
gi|2495111|sp|Q25626|SC3_OCTVU S-CRYSTALLIN 3 >gnl|BL_ORD_ID|170...    84   2e-15
gi|625079|gb|AAA97540.1| S-crystallin                                  84   2e-15
gi|134261|sp|P18426|SC11_OMMSL S-CRYSTALLIN SL11 (MAJOR LENS POL...    84   2e-15
gi|25152187|ref|NP_509652.2| glutathione S-Transferase (23.9 kD)...    84   2e-15
gi|13928888|ref|NP_113832.1| prostaglandin D2 synthase 2; prosta...    84   2e-15
gi|159838|gb|AAA29403.1| S-crystallin                                  83   3e-15
gi|17569381|ref|NP_508625.1| glutathione S-Transferase (gst-11) ...    83   3e-15
gi|31559115|gb|AAP50848.1| glutathione S-transferase 2 [Bombyx m...    83   3e-15
gi|39590943|emb|CAE58723.1| Hypothetical protein CBG01908 [Caeno...    83   4e-15
gi|20139191|sp|Q9JHF7|PGD2_MOUSE Glutathione-requiring prostagla...    83   4e-15
gi|48095724|ref|XP_394518.1| similar to glutathione S-transferas...    83   4e-15
gi|134279|sp|P27010|SC2_OCTDO S-CRYSTALLIN 2 (OL2) >gnl|BL_ORD_I...    82   5e-15
gi|7657457|ref|NP_055300.1| prostaglandin-D synthase; hematopoie...    80   2e-14
gi|134281|sp|P27011|SC3_OCTDO S-CRYSTALLIN 3 (OL3) >gnl|BL_ORD_I...    80   2e-14
gi|30749298|pdb|1IYH|A Chain A, Crystal Structure Of Hematopoiet...    79   4e-14
gi|134268|sp|P27016|SC18_OMMSL S-CRYSTALLIN SL18 >gnl|BL_ORD_ID|...    78   1e-13
gi|624302|gb|AAA97541.1| S-crystallin                                  75   6e-13
gi|40362717|gb|AAR84628.1| glutathione S-transferase [Gryllotalp...    75   8e-13
gi|1170111|sp|P46088|GTS_OMMSL Glutathione S-transferase (GST cl...    75   8e-13
gi|1065021|pdb|1GSQ|  Glutathione S-Transferase (Gst) (E.C.2.5.1...    75   8e-13
gi|624328|gb|AAB01055.1| S-crystallin                                  75   1e-12
gi|31205195|ref|XP_311546.1| ENSANGP00000023017 [Anopheles gambi...    74   2e-12
gi|21435011|gb|AAM53611.1| glutathione S-transferase S1-2 [Anoph...    73   3e-12
gi|31205193|ref|XP_311545.1| ENSANGP00000010247 [Anopheles gambi...    73   3e-12
gi|7506384|pir||T23994 hypothetical protein R07B1.4 - Caenorhabd...    73   4e-12
gi|481923|pir||S40165 glutathione transferase (EC 2.5.1.18) - ne...    73   4e-12
gi|1170077|sp|P46434|GT1_ONCVO GLUTATHIONE S-TRANSFERASE 1 >gnl|...    73   4e-12
gi|12005978|gb|AAG44695.1| glutathione S-transferase Ia [Onchoce...    73   4e-12
gi|624318|gb|AAA97549.1| S-crystallin                                  73   4e-12
gi|17533785|ref|NP_496865.1| glutathione S-Transferase (gst-17) ...    72   5e-12
gi|12005980|gb|AAG44696.1| glutathione S-transferase Ib [Onchoce...    72   7e-12
gi|1170108|sp|P46428|GTS_ANOGA GLUTATHIONE S-TRANSFERASE (GST CL...    71   2e-11
gi|624322|gb|AAA97551.1| S-crystallin                                  70   3e-11
gi|624332|gb|AAB01057.1| S-crystallin                                  69   6e-11
gi|477414|pir||A48982 glutathione transferase (EC 2.5.1.18) 2 - ...    68   1e-10
gi|624312|gb|AAA97546.1| S-crystallin                                  67   2e-10
gi|624324|gb|AAB01053.1| S-crystallin                                  67   2e-10
gi|624306|gb|AAA97543.1| S-crystallin                                  67   3e-10
gi|624336|gb|AAB01059.1| S-crystallin                                  67   3e-10
gi|32965121|gb|AAP91748.1| glutathione-requiring prostaglandin D...    66   4e-10
gi|28630830|gb|AAO45827.1| glutathione S-transferase [Wuchereria...    66   5e-10
gi|624330|gb|AAB01056.1| S-crystallin                                  65   6e-10
gi|624320|gb|AAA97550.1| S-crystallin                                  65   6e-10
gi|23428564|gb|AAL23713.1| glutathione S-transferase [Opisthorch...    64   1e-09
gi|624334|gb|AAB01058.1| S-crystallin                                  64   2e-09
gi|134275|sp|P18425|SC20_OMMSL S-CRYSTALLIN SL20-1 (MAJOR LENS P...    64   2e-09
gi|624308|gb|AAA97544.1| S-crystallin                                  64   2e-09
gi|624326|gb|AAB01054.1| S-crystallin                                  64   2e-09
gi|624316|gb|AAA97548.1| S-crystallin                                  64   2e-09
gi|84595|pir||S06442 crystallin (clone pSl20) - Sloane's squid >...    64   2e-09
gi|2058287|emb|CAA73325.1| glutathione transferase [Brugia malayi]     63   3e-09
gi|913849|gb|AAA73508.1| lens-specific S-crystallin {SL20-1} [oc...    63   3e-09
gi|159831|gb|AAA29402.1| S-crystallin                                  63   3e-09
gi|23480514|gb|EAA17054.1| glutathione s-transferase [Plasmodium...    62   7e-09
gi|39588670|emb|CAE58194.1| Hypothetical protein CBG01288 [Caeno...    62   7e-09
gi|39583549|emb|CAE65653.1| Hypothetical protein CBG10717 [Caeno...    62   9e-09
gi|34536838|gb|AAQ73932.1| GST-like hemolymph protein [Corcyra c...    62   9e-09
gi|624314|gb|AAA97547.1| S-crystallin                                  62   9e-09
gi|161013|gb|AAA29892.1| 28kDa glutathione-S transferase               61   2e-08
gi|624310|gb|AAA97545.1| S-crystallin                                  61   2e-08
gi|544443|sp|P30113|GT28_SCHBO GLUTATHIONE S-TRANSFERASE 28 KD (...    61   2e-08
gi|624304|gb|AAA97542.1| S-crystallin                                  61   2e-08
gi|232199|sp|P30114|GT28_SCHHA Glutathione S-transferase 28 kDa ...    61   2e-08
gi|4335859|gb|AAD17488.1| 28 kDa glutathione S-transferase; 28GS...    60   2e-08
gi|121700|sp|P09792|GT28_SCHMA Glutathione S-transferase 28 kDa ...    60   2e-08
gi|1389744|gb|AAB03573.1| glutathione-S-transferase                    60   2e-08
gi|121699|sp|P26624|GT28_SCHJA Glutathione S-transferase 28 kDa ...    60   3e-08
gi|12859396|dbj|BAB31640.1| unnamed protein product [Mus musculus]     60   3e-08
gi|7387485|gb|AAB33637.2| glutathione S-transferase; GST [Nemato...    59   5e-08
gi|39588668|emb|CAE58192.1| Hypothetical protein CBG01286 [Caeno...    59   5e-08
gi|6137390|pdb|1B48|A Chain A, Crystal Structure Of Mgsta4-4 In ...    59   5e-08
gi|20141353|sp|P24472|GTA4_MOUSE Glutathione S-transferase 5.7 (...    59   5e-08
gi|12848219|dbj|BAB27873.1| unnamed protein product [Mus musculus]     59   5e-08
gi|6754082|ref|NP_034487.1| glutathione S-transferase, alpha 4 [...    59   5e-08
gi|49532912|dbj|BAD26691.1| Glutathione S-transferase [Plutella ...    59   5e-08
gi|2829287|gb|AAC00518.1| glutathione S-transferase [Schistosoma...    59   6e-08
gi|6671050|gb|AAF23078.1| glutathione S-transferase [Choristoneu...    59   8e-08
gi|17565768|ref|NP_503701.1| glutathione S-Transferase (24.8 kD)...    58   1e-07
gi|48106995|ref|XP_393084.1| similar to Glutathione-requiring pr...    57   3e-07
gi|17553834|ref|NP_499006.1| glutathione S-Transferase, P subuni...    56   4e-07
gi|34539115|gb|AAQ74441.1| glutathione S-transferase [Haemaphysa...    56   5e-07
gi|17564840|ref|NP_503889.1| glutathione S-Transferase (gst-23) ...    56   5e-07
gi|4322274|gb|AAD15991.1| glutathione S-transferase [Boophilus m...    55   9e-07
gi|50744870|ref|XP_419913.1| PREDICTED: glutathione S-transferas...    55   9e-07
gi|5360517|dbj|BAA82038.1| glutathione s-transferase [Cavia porc...    55   9e-07
gi|8928140|sp|P81706|GTA1_CAVPO Glutathione S-transferase A (GST...    55   9e-07
gi|45387463|gb|AAS60226.1| glutathione S-transferase pi [Mytilus...    55   1e-06
gi|49169816|ref|NP_001001777.1| glutathione S-transferase [Gallu...    55   1e-06
gi|11177841|gb|AAG32475.1| putative glutathione S-transferase Os...    55   1e-06
gi|34914740|ref|NP_918717.1| putative glutathione S-transferase ...    55   1e-06
gi|39588669|emb|CAE58193.1| Hypothetical protein CBG01287 [Caeno...    55   1e-06
gi|1170101|sp|P46426|GTP_DIRIM Glutathione S-transferase (GST cl...    54   1e-06
gi|7025464|gb|AAF35893.1| glutathione S-transferase GST-pi [Myti...    54   1e-06
gi|34539117|gb|AAQ74442.1| glutathione S-transferase [Rhipicepha...    52   6e-06
gi|22094809|gb|AAM91994.1| glutathione S-transferase GSTpi1 [Myt...    52   6e-06
gi|16518972|gb|AAL25087.1| glutathione s-transferase [Plasmodium...    52   6e-06
gi|4630882|dbj|BAA76974.1| glutathione S-transferase [Oncorhynch...    52   6e-06
gi|23509408|ref|NP_702075.1| glutathione s-transferase, putative...    52   6e-06
gi|39585029|emb|CAE62680.1| Hypothetical protein CBG06825 [Caeno...    52   9e-06
gi|34859224|ref|XP_234810.2| similar to GLUTATHIONE S-TRANSFERAS...    52   9e-06
gi|17563170|ref|NP_504894.1| glutathione S-Transferase (25.0 kD)...    52   9e-06
gi|22671705|gb|AAN04481.1| glutathione S-transferase GSTP2-2 [Bu...    51   1e-05
gi|2465439|gb|AAB72099.1| glutathione-dependent prostaglandin D ...    51   1e-05
gi|21450105|ref|NP_659118.1| cDNA sequence BC021614 [Mus musculu...    50   4e-05
gi|46329897|gb|AAH68854.1| Unknown (protein for IMAGE:3399306) [...    49   6e-05
gi|50400547|sp|Q8JFZ2|GTP1_XENLA Glutathione S-transferase P 1 (...    49   6e-05
gi|34861384|ref|XP_215189.2| similar to hypothetical protein MGC...    49   8e-05
gi|5822511|pdb|3GTU|B Chain B, Ligand-Free Heterodimeric Human G...    48   1e-04
gi|108301|pir||S13780 glutathione transferase (EC 2.5.1.18) clas...    48   1e-04
gi|1943418|pdb|2GSR|A Chain A, Structure Of Porcine Class Pi Glu...    48   1e-04
gi|544445|sp|P80031|GTP_PIG Glutathione S-transferase P (GST P1-...    48   1e-04
gi|23065552|ref|NP_000840.2| glutathione S-transferase M3; gluta...    48   1e-04
gi|14250650|gb|AAH08790.1| Glutathione S-transferase M3 [Homo sa...    48   1e-04
gi|23504743|emb|CAD29477.1| glutathione transferase F4 [Triticum...    48   1e-04
gi|32346216|gb|AAN85429.1| glutathione-S-transferase [Pyrocystis...    47   2e-04
gi|46120432|ref|XP_385039.1| hypothetical protein FG04863.1 [Gib...    47   2e-04
gi|50400626|sp|Q9BEA9|GTM3_MACFU Glutathione S-transferase Mu 3 ...    47   2e-04
gi|47228894|emb|CAG09409.1| unnamed protein product [Tetraodon n...    47   2e-04
gi|6680121|ref|NP_032209.1| glutathione S-transferase, mu 2; glu...    47   2e-04
gi|3402001|pdb|1FHE|  Glutathione Transferase (Fh47) From Fascio...    47   2e-04
gi|384152|prf||1905266C glutathione S transferase:ISOTYPE=GST47        47   2e-04
gi|159060|gb|AAA29140.1| mu-glutathione transferase [Fasciola he...    47   2e-04
gi|1170098|sp|P46409|GTMU_RABIT Glutathione S-transferase Mu 1 (...    47   2e-04
gi|3915723|sp|P31670|GT27_FASHE Glutathione S-transferase 26 kDa...    47   2e-04
gi|18858197|ref|NP_571809.1| glutathione S-transferase pi [Danio...    47   3e-04
gi|13936373|dbj|BAB47185.1| glutathione S-transferase subunit gY...    47   3e-04
gi|4574306|gb|AAD23997.1| glutathione S-transferase [Fasciola gi...    45   7e-04
gi|6754086|ref|NP_034490.1| glutathione S-transferase, mu 5; glu...    45   9e-04
gi|106129|pir||A35295 glutathione transferase (EC 2.5.1.18) clas...    45   9e-04
gi|2264324|gb|AAB63382.1| 28 kDa glutathione-S transferase             45   9e-04
gi|4557966|pdb|2GTU|A Chain A, Ligand-Free Human Glutathione S-T...    45   0.001
gi|494185|pdb|1HNA|  Glutathione S-Transferase (Human, Class Mu)...    45   0.001
gi|46126843|ref|XP_387975.1| hypothetical protein FG07799.1 [Gib...    45   0.001
gi|4504175|ref|NP_000839.1| glutathione S-transferase M2; glutat...    45   0.001
gi|232206|sp|P30116|GTMU_MESAU GLUTATHIONE S-TRANSFERASE (GST CL...    45   0.001
gi|207692|gb|AAA42351.1| glutathione S-transferase Yb2 subunit         44   0.002
gi|22218855|pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutat...    44   0.002
gi|28933457|ref|NP_803175.1| glutathione S-transferase, mu 2; gl...    44   0.002
gi|28828694|gb|AAO51292.1| similar to Xenopus laevis (African cl...    44   0.002
gi|1170081|sp|Q08863|GTA1_RABIT Glutathione S-transferase alpha ...    44   0.002
gi|1943433|pdb|6GSV|A Chain A, First-Sphere And Second-Sphere El...    44   0.002
gi|1943435|pdb|6GSW|A Chain A, First-Sphere And Second-Sphere El...    44   0.002
gi|1943397|pdb|6GSX|A Chain A, First-Sphere And Second-Sphere El...    44   0.002
gi|442967|pdb|1GSB|A Chain A, Glutathione S-Transferase (Isoenzy...    44   0.002
gi|1943431|pdb|6GSU|A Chain A, First-Sphere And Second-Sphere El...    44   0.002
gi|204501|gb|AAA41286.1| glutathione S-transferase (EC 2.5.1.18)       44   0.002
gi|25282395|ref|NP_742035.1| glutathione-S-transferase, mu 5 [Ra...    44   0.002
gi|8393502|ref|NP_058710.1| glutathione S-transferase, mu 1; glu...    44   0.002
gi|32188134|gb|AAP75791.1| glutathione S-transferase [Helicoverp...    44   0.002
gi|47076115|emb|CAD90167.1| mu class glutathione S-transferase [...    44   0.003
gi|4388890|pdb|1GTU|A Chain A, Ligand-Free Human Glutathione S-T...    43   0.003
gi|204499|gb|AAA41285.1| glutathione S-transferase Y-b subunit (...    43   0.003
gi|33356830|pdb|1B4P|A Chain A, Crystal Structures Of Class Mu C...    43   0.003
gi|11385467|gb|AAG34816.1| glutathione S-transferase GST 8 [Zea ...    43   0.003
gi|23065544|ref|NP_000552.2| glutathione S-transferase M1 isofor...    43   0.003
gi|1346208|sp|P47954|GTP_CRIMI Glutathione S-transferase P (GST ...    43   0.003
gi|4388948|pdb|5FWG|A Chain A, Tetra-(5-Fluorotryptophanyl)-Glut...    43   0.004
gi|29726512|pdb|1MTC|A Chain A, Glutathione Transferase Mutant Y...    43   0.004
gi|13516447|dbj|BAB40442.1| glutathione transferase M2 [Macaca f...    43   0.004
gi|38047983|gb|AAR09894.1| similar to Drosophila melanogaster CG...    43   0.004
gi|544442|sp|P35661|GT27_SCHMA GLUTATHIONE S-TRANSFERASE 26 KD (...    43   0.004
gi|306812|gb|AAA59203.1| glutathione transferase M1 >gnl|BL_ORD_...    43   0.004
gi|50400684|sp|Q9TSM4|GTM2_MACFA Glutathione S-transferase Mu 2 ...    43   0.004
gi|32188136|gb|AAP75792.1| glutathione S-transferase [Helicoverp...    43   0.004
gi|32188132|gb|AAP75790.1| glutathione S-transferase [Helicoverp...    42   0.006
gi|423912|pir||A46143 mu-class glutathione S-transferase hGSTYBX...    42   0.006
gi|15218641|ref|NP_171793.1| glutathione S-transferase, putative...    42   0.007
gi|25518742|pir||H86159 hypothetical protein F22D16.6 - Arabidop...    42   0.007
gi|6754084|ref|NP_034488.1| glutathione S-transferase, mu 1; glu...    42   0.007
gi|49900006|gb|AAH77010.1| Unknown (protein for MGC:89704) [Xeno...    42   0.007
gi|204503|gb|AAA41287.1| glutathione S-transferase Yb-1 subunit ...    42   0.010
gi|28461273|ref|NP_787019.1| glutathione S-transferase M1 [Bos t...    42   0.010
gi|23065563|ref|NP_000842.2| glutathione S-transferase M5; gluta...    42   0.010
gi|1170097|sp|P46439|GTM5_HUMAN Glutathione S-transferase Mu 5 (...    42   0.010
gi|25153666|ref|NP_503673.2| glutathione S-transferase, N-termin...    41   0.013
gi|15237931|ref|NP_197224.1| glutathione S-transferase, putative...    41   0.013
gi|21263651|sp|P81942|GTP1_BUFBU Glutathione S-transferase P 1 (...    41   0.013
gi|2624495|pdb|1BAY|A Chain A, Glutathione S-Transferase Yfyf Cy...    41   0.017
gi|18391048|ref|NP_563848.1| elongation factor 1B-gamma, putativ...    41   0.017
gi|26347823|dbj|BAC37560.1| unnamed protein product [Mus musculus]     41   0.017
gi|22671702|gb|AAN04480.1| glutathione S-transferase GSTP1-1 [Bu...    41   0.017
gi|4557944|pdb|1GTI|A Chain A, Modified Glutathione S-Transferas...    41   0.017
gi|576133|pdb|1GLP|A Chain A, Glutathione S-Transferase Yfyf (Cl...    41   0.017
gi|161007|gb|AAA29889.1| glutathione S-transferase                     41   0.017
gi|37748321|gb|AAH58881.1| Glutathione S-transferase M5 [Homo sa...    41   0.017
gi|121698|sp|P15964|GT26_SCHMA Glutathione S-transferase 26 kDa ...    41   0.017
gi|21618868|gb|AAH31818.1| Gstm6 protein [Mus musculus]                41   0.017
gi|10092608|ref|NP_038569.1| glutathione S-transferase, pi 1; Gs...    41   0.017
gi|28900906|ref|NP_800561.1| putative glutathione S-transferase ...    40   0.022
gi|193690|gb|AAA37748.1| glutathione transferase (EC 2.5.1.18)         40   0.022
gi|1083336|pir||A55140 glutathione transferase (EC 2.5.1.18) piA...    40   0.022
gi|33468899|ref|NP_034489.1| glutathione S-transferase, mu 3; gl...    40   0.022
gi|25453412|ref|NP_620430.1| glutathione S-transferase, pi 2 [Ra...    40   0.022
gi|32401425|ref|NP_861461.1| glutathione S-transferase, pi 2; Gs...    40   0.022
gi|208305|gb|AAA72682.1| glutathione transferase                       40   0.028
gi|4929901|pdb|1B8X|A Chain A, Glutathione S-Transferase Fused W...    40   0.028
gi|595742|gb|AAA57113.1| glutathione S-transferase                     40   0.028
gi|84402|pir||A26484 glutathione transferase (EC 2.5.1.18) - flu...    40   0.028
gi|595738|gb|AAA57110.1| glutathione S-transferase                     40   0.028
gi|1814366|gb|AAB41882.1| GST-6his [Expression vector pGEX-2T-6H]      40   0.028
gi|595714|gb|AAA57092.1| glutathione S-transferase                     40   0.028
gi|1699069|gb|AAB37352.1| glutathione S-transferase [Cloning vec...    40   0.028
gi|595722|gb|AAA57098.1| glutathione S-transferase                     40   0.028
gi|3983117|gb|AAC83809.1| glutathione S-transferase [Expression ...    40   0.028
gi|1850359|gb|AAB48035.1| GST-fusion protein [Expression vector ...    40   0.028
gi|6980848|pdb|1DUG|A Chain A, Structure Of The Fibrinogen G Cha...    40   0.028
gi|4389298|pdb|1BG5|  Crystal Structure Of The Ankyrin Binding D...    40   0.028
gi|3002500|gb|AAC08718.1| GSTmFra2/79-242 [Expression vector pGH...    40   0.028
gi|1699065|gb|AAB37349.1| glutathione S-transferase [Cloning vec...    40   0.028
gi|34914756|ref|NP_918725.1| putative glutathione S-transferase ...    40   0.028
gi|20385949|gb|AAM21516.1| GST-M.SPRX methyltransferase fusion p...    40   0.028
gi|3002516|gb|AAC08730.1| GSTmFra2/2-327 [Expression vector pGH/...    40   0.028
gi|15099967|gb|AAK84183.1| glutathione-S-transferase-nitroreduct...    40   0.028
gi|21666485|gb|AAM73721.1| glutathione-S-transferase/nitroreduct...    40   0.028
gi|232200|sp|P30111|GTH2_WHEAT GLUTATHIONE S-TRANSFERASE 2 (GST ...    40   0.028
gi|3184404|dbj|BAA28713.1| GST-stuffer fusion protein [Cloning v...    40   0.028
gi|467623|emb|CAA55122.1| fusion peptide [synthetic construct]         40   0.028
gi|3002496|gb|AAC08715.1| GSTmFra2/2-163 [Expression vector pGH/...    40   0.028
gi|477190|pir||A48388 glutathione S-transferase - liver fluke (f...    40   0.028
gi|31208165|ref|XP_313049.1| ENSANGP00000011661 [Anopheles gambi...    40   0.028
gi|3242311|emb|CAA11559.1| glutathione-S-transferase [synthetic ...    40   0.028
gi|809436|pdb|1GNE|  Glutathione S-Transferase (E.C.2.5.1.18) Fu...    40   0.028
gi|595710|gb|AAA57089.1| glutathione S-transferase                     40   0.028
gi|595718|gb|AAA57095.1| glutathione S-transferase                     40   0.028
gi|595730|gb|AAA57104.1| glutathione S-transferase                     40   0.028
gi|595734|gb|AAA57107.1| glutathione S-transferase                     40   0.028
gi|1850357|gb|AAB48034.1| GST-fusion protein [Expression vector ...    40   0.028
gi|208443|gb|AAB59734.1| glutathione transferase                       40   0.028
gi|15216974|gb|AAK92454.1| GST-loxP-cre recombinase fusion prote...    40   0.028
gi|31208161|ref|XP_313047.1| ENSANGP00000023440 [Anopheles gambi...    40   0.028
gi|3002512|gb|AAC08727.1| GSTmFra2/79-327 [Expression vector pGH...    40   0.028
gi|121697|sp|P08515|GT26_SCHJA Glutathione S-transferase 26 kDa ...    40   0.028
gi|232197|sp|P30112|GT26_FASHE GLUTATHIONE S-TRANSFERASE 26 KD 5...    40   0.028
gi|1170093|sp|P42769|GTH5_ARATH Glutathione S-transferase PM239X...    40   0.028
gi|15099965|gb|AAK84182.1| glutathione-S-transferase-nitroreduct...    40   0.028
gi|3002508|gb|AAC08724.1| GSTmFra2/2-242 [Expression vector pGH/...    40   0.028
gi|38081896|ref|XP_124621.2| similar to Glutathione S-transferas...    40   0.028
gi|595726|gb|AAA57101.1| glutathione S-transferase                     40   0.028
gi|23821204|emb|CAD53317.1| glutathione-S-transferase [Cloning v...    40   0.028
gi|1527195|gb|AAB88910.1| glutathione S-transferase [Expression ...    40   0.028
gi|1699061|gb|AAB37346.1| glutathione S-transferase [Cloning vec...    40   0.028
gi|1850361|gb|AAB48036.1| GST-fusion protein [Expression vector ...    40   0.028
gi|595706|gb|AAA57086.1| glutathione S-transferase                     40   0.028
gi|3002504|gb|AAC08721.1| GSTmFra2/159-327 [Expression vector pG...    40   0.028
gi|3023905|sp|Q60550|GTP_MESAU Glutathione S-transferase P (GST ...    40   0.028
gi|38155842|gb|AAR12690.1| glutathione S-transferase [Expression...    40   0.028
gi|1814368|gb|AAB41883.1| GST-6his [Expression vector pGEX-2T-6H...    40   0.028
gi|11385457|gb|AAG34811.1| glutathione S-transferase GST 21 [Gly...    40   0.037
gi|6625558|gb|AAF19264.1| glutathione S-transferase [Psoroptes o...    40   0.037
gi|18150415|gb|AAL61612.1| glutathione S-transferase [Allium cepa]     40   0.037
gi|20386063|gb|AAM21563.1| glutathione S-transferase [Nilaparvat...    40   0.037
gi|10120486|ref|NP_065415.1| glutathione S-transferase Yb4 gene ...    40   0.037
gi|1526622|emb|CAA68944.1| 26kD glutathione S-transferase [Schis...    40   0.037
gi|7110613|ref|NP_032210.1| glutathione S-transferase, mu 6; glu...    40   0.037
gi|2842717|sp|Q93112|GTT5_ANOGA GLUTATHIONE S-TRANSFERASE 1-5 (G...    39   0.049
gi|20138154|sp|O35660|GTM6_MOUSE Glutathione S-transferase Mu 6 ...    39   0.049
gi|34859803|ref|XP_215682.2| similar to glutathione transferase ...    39   0.049
gi|46204955|ref|ZP_00049243.2| COG0625: Glutathione S-transferas...    39   0.063
gi|384151|prf||1905266B glutathione S transferase:ISOTYPE=GST7         39   0.063
gi|27462836|gb|AAO15607.1| glutathione S-transferase [Sarcoptes ...    39   0.063
gi|3915724|sp|P31671|GT28_FASHE GLUTATHIONE S-TRANSFERASE 26 KD ...    39   0.063
gi|159058|gb|AAA29139.1| mu-glutathione transferase [Fasciola he...    39   0.063
gi|66615|pir||XUZM1 glutathione transferase (EC 2.5.1.18) I - maize    39   0.083
gi|232196|sp|P30110|GTH1_WHEAT Glutathione S-transferase 1 (GST ...    38   0.11
gi|39592078|emb|CAE75298.1| Hypothetical protein CBG23268 [Caeno...    38   0.14
gi|20130115|ref|NP_611329.1| CG17531-PA [Drosophila melanogaster...    37   0.18
gi|21591409|gb|AAM64045.1| glutathione S-transferase [Taenia sol...    37   0.18
gi|34914764|ref|NP_918729.1| putative glutathione S-transferase ...    37   0.18
gi|21483372|gb|AAM52661.1| LD04004p [Drosophila melanogaster]          37   0.18
gi|477946|pir||C46681 glutathione transferase (EC 2.5.1.18) D24 ...    37   0.18
gi|45549270|ref|NP_524914.3| CG12242-PA [Drosophila melanogaster...    37   0.18
gi|50540310|ref|NP_001002621.1| zgc:92254 [Danio rerio] >gnl|BL_...    37   0.18
gi|2316076|gb|AAB66318.1| glutathione S-transferase [Echinococcu...    37   0.24
gi|47228778|emb|CAG07510.1| unnamed protein product [Tetraodon n...    37   0.24
gi|1004227|emb|CAA59739.1| glutathione transferase [Echinococcus...    37   0.24
gi|3023918|sp|Q52828|GSTA_RHILE GSTA PROTEIN >gnl|BL_ORD_ID|1716...    37   0.24
gi|3582502|gb|AAC35245.1| glutathione S-transferase isozyme 3 [P...    37   0.24
gi|47205768|emb|CAF91521.1| unnamed protein product [Tetraodon n...    37   0.24
gi|28076911|ref|NP_081040.1| glutathione S-transferase, mu 4; gl...    37   0.24
gi|50400685|sp|Q9TSM5|GTM1_MACFA Glutathione S-transferase Mu 1 ...    37   0.24
gi|28828399|gb|AAO51029.1| similar to Rattus norvegicus (Rat). G...    37   0.31
gi|6980588|pdb|4GTU|A Chain A, Ligand-Free Homodimeric Human Glu...    36   0.41
gi|46139051|ref|XP_391216.1| hypothetical protein FG11040.1 [Gib...    36   0.41
gi|38100531|gb|EAA47645.1| hypothetical protein MG02888.4 [Magna...    36   0.41
gi|4504179|ref|NP_000841.1| glutathione S-transferase M4 isoform...    36   0.41
gi|306817|gb|AAA57346.1| glutathione transferase M4                    36   0.41
gi|422842|pir||S32425 glutathione transferase (EC 2.5.1.18) clas...    36   0.41
gi|34785909|gb|AAH57757.1| MGC69150 protein [Xenopus laevis]           36   0.41
gi|17561414|ref|NP_505972.1| glutathione S-transferase, C-termin...    36   0.41
gi|16271819|ref|NP_438156.1| hypothetical protein [Temperate pha...    36   0.54
gi|34534082|dbj|BAC86900.1| unnamed protein product [Homo sapiens]     35   0.70
gi|47086689|ref|NP_997841.1| Unknown (protein for MGC:66370); gl...    35   0.70
gi|11990261|emb|CAC19630.1| dichloromethane dehalogenase [uniden...    35   0.70
gi|11990255|emb|CAC19576.1| dichloromethane dehalogenase [Hyphom...    35   0.70
gi|11990259|emb|CAC19577.1| dichloromethane dehalogenase [Hyphom...    35   0.70
gi|118339|sp|P21161|DCMA_METDI Dichloromethane dehalogenase (DCM...    35   0.70
gi|11990163|emb|CAC19546.1| dichloromethane dehalogenase [bacter...    35   0.70
gi|11990165|emb|CAC19545.1| dichloromethane dehalogenase [dichlo...    35   0.70
gi|11990257|emb|CAC19600.1| dichloromethane dehalogenase [Methyl...    35   0.70
gi|24654975|ref|NP_611325.2| CG17524-PA [Drosophila melanogaster...    35   0.70
gi|50402815|gb|AAT76630.1| glutathione-S-transferase M3 [Felis c...    35   0.70
gi|21956654|gb|AAL02369.3| class gamma glutathione S-transferase...    35   0.70
gi|399829|sp|Q00285|GTMU_CRILO GLUTATHIONE S-TRANSFERASE Y1 (CHA...    35   0.70
gi|50421503|ref|XP_459302.1| unnamed protein product [Debaryomyc...    35   0.92
gi|11139989|emb|CAC16080.1| glutathione S-transferase [Pichia an...    35   0.92
gi|15888177|ref|NP_353858.1| AGR_C_1530p [Agrobacterium tumefaci...    35   0.92
gi|27381775|ref|NP_773304.1| glutathione S-transferase [Bradyrhi...    35   0.92
gi|630505|pir||S44745 C02D5.3 protein - Caenorhabditis elegans         35   0.92
gi|17864594|ref|NP_524913.1| CG11512-PA [Drosophila melanogaster...    35   0.92
gi|31208159|ref|XP_313046.1| ENSANGP00000011261 [Anopheles gambi...    35   0.92
gi|5880849|gb|AAD54937.1| glutathione S-transferase 6A [Musca do...    35   0.92
gi|32565776|ref|NP_871705.1| glutathione S-transferase, N-termin...    35   0.92
gi|3549272|gb|AAC79997.1| glutathione S-transferase D7 [Anophele...    35   0.92
gi|31208169|ref|XP_313051.1| ENSANGP00000025279 [Anopheles gambi...    35   1.2
gi|25287116|pir||T52085 glutathione transferase (EC 2.5.1.18) GS...    35   1.2
gi|31208167|ref|XP_313050.1| ENSANGP00000024808 [Anopheles gambi...    35   1.2
gi|14517793|gb|AAK64362.1| glutathione-S-transferase-like protei...    35   1.2
gi|24643530|ref|NP_728347.1| CG1702-PA [Drosophila melanogaster]...    34   1.6
gi|3023699|sp|Q91375|EF1H_XENLA Elongation factor 1-gamma type 2...    34   1.6
gi|25287117|pir||T52087 glutathione transferase (EC 2.5.1.18) GS...    34   1.6
gi|31239111|ref|XP_319969.1| ENSANGP00000025069 [Anopheles gambi...    34   1.6
gi|28630336|gb|AAM93480.1| eukaryotic translation elongation fac...    34   1.6
gi|28571670|ref|NP_788656.1| CG4381-PA [Drosophila melanogaster]...    34   1.6
gi|50260616|gb|EAL23269.1| hypothetical protein CNBA3850 [Crypto...    34   1.6
gi|23504741|emb|CAD29476.1| glutathione transferase F3 [Triticum...    34   1.6
gi|15228488|ref|NP_186969.1| glutathione S-transferase, putative...    34   1.6
gi|478137|pir||E46681 glutathione transferase (EC 2.5.1.18) D23 ...    34   1.6
gi|23469076|ref|ZP_00124411.1| COG0625: Glutathione S-transferas...    34   1.6
gi|30145756|emb|CAA96662.2| Hypothetical protein F55A11.6 [Caeno...    34   2.0
gi|13472292|ref|NP_103859.1| probable glutathione S-transferase ...    34   2.0
gi|23504745|emb|CAD29478.1| glutathione transferase F5 [Triticum...    34   2.0
gi|36959131|gb|AAQ87556.1| Glutathione S-transferase [Rhizobium ...    34   2.0
gi|13592152|ref|NP_112416.1| glutathione S-transferase, mu type ...    34   2.0
gi|31239117|ref|XP_319972.1| ENSANGP00000016648 [Anopheles gambi...    33   2.7
gi|17944983|gb|AAL48554.1| RE03226p [Drosophila melanogaster]          33   2.7
gi|21406640|gb|AAL48788.2| RE21095p [Drosophila melanogaster]          33   2.7
gi|17933730|ref|NP_525114.1| CG4371-PA [Drosophila melanogaster]...    33   2.7
gi|31933|emb|CAA48636.1| glutathione S-transferase [Homo sapiens]      33   2.7
gi|45518067|ref|ZP_00169618.1| COG0625: Glutathione S-transferas...    33   2.7
gi|1353751|gb|AAB01781.1| glutathione S-transferase III homolog        33   2.7
gi|31197105|ref|XP_307500.1| ENSANGP00000015332 [Anopheles gambi...    33   2.7
gi|21434999|gb|AAM53606.1| glutathione S-transferase D5 [Anophel...    33   2.7
gi|31208185|ref|XP_313059.1| ENSANGP00000011770 [Anopheles gambi...    33   2.7
gi|19922532|ref|NP_611328.1| CG17530-PA [Drosophila melanogaster...    33   2.7
gi|24654965|ref|NP_611322.1| CG17522-PA [Drosophila melanogaster...    33   3.5
gi|1524316|emb|CAA68993.1| glutathione S-transferase [Petunia x ...    33   3.5
gi|27382286|ref|NP_773815.1| hypothetical glutathione S-transfer...    33   3.5
gi|28494710|ref|XP_289885.1| RIKEN cDNA 0610005A07 [Mus musculus...    33   3.5
gi|134272|sp|P27013|SC1_OCTVU S-CRYSTALLIN 1 >gnl|BL_ORD_ID|3860...    33   3.5
gi|37534016|ref|NP_921310.1| putative Bronze-2 protein [Oryza sa...    33   3.5
gi|729399|sp|P40921|EF1G_SCHPO Elongation factor 1-gamma (EF-1-g...    33   4.5
gi|19115792|ref|NP_594880.1| elongation factor 1-gamma [Schizosa...    33   4.5
gi|48731293|ref|ZP_00265038.1| COG0625: Glutathione S-transferas...    33   4.5
gi|18158596|gb|AAL59658.1| glutathione S-transferase E1 [Anophel...    33   4.5
gi|18874391|gb|AAL78751.1| translation elongation factor-1 gamma...    33   4.5
gi|39937374|ref|NP_949650.1| possible glutathione S-transferase ...    33   4.5
gi|19745802|ref|NP_606938.1| hypothetical phage protein [Strepto...    33   4.5
gi|21910466|ref|NP_664734.1| conserved hypothetical protein - ph...    33   4.5
gi|84408|pir||S02458 glutathione transferase (EC 2.5.1.18) s.m.1...    33   4.5
gi|28869236|ref|NP_791855.1| glutathione S-transferase family pr...    33   4.5
gi|15222832|ref|NP_175408.1| glutathione S-transferase, putative...    32   5.9
gi|24651001|ref|NP_652000.1| CG11901-PA [Drosophila melanogaster...    32   5.9
gi|50304393|ref|XP_452146.1| unnamed protein product [Kluyveromy...    32   5.9
gi|46915784|emb|CAG22555.1| putative glutathione S-transferase [...    32   5.9
gi|12853535|dbj|BAB29771.1| unnamed protein product [Mus musculus]     32   5.9
gi|46187538|ref|ZP_00127362.2| COG0625: Glutathione S-transferas...    32   5.9
gi|39591658|emb|CAE71235.1| Hypothetical protein CBG18105 [Caeno...    32   5.9
gi|23124961|ref|ZP_00106917.1| COG0625: Glutathione S-transferas...    32   5.9
gi|46409184|gb|AAS93749.1| RE15368p [Drosophila melanogaster]          32   5.9
gi|25012528|gb|AAN71367.1| RE32823p [Drosophila melanogaster]          32   5.9
gi|1170092|sp|P46420|GTH4_MAIZE Glutathione S-transferase IV (GS...    32   7.7
gi|19922528|ref|NP_611324.1| CG17523-PA [Drosophila melanogaster...    32   7.7
gi|10120620|pdb|1C72|A Chain A, Tyr115, Gln165 And Trp209 Contri...    32   7.7
gi|2981970|pdb|1GSU|A Chain A, An Avian Class-Mu Glutathione S-T...    32   7.7
gi|25405037|pir||G96827 protein F20B17.10 [imported] - Arabidops...    32   7.7
gi|104677|pir||S18464 glutathione transferase (EC 2.5.1.18) mu2 ...    32   7.7
gi|46447169|ref|YP_008534.1| putative heat shock protein HtpG [P...    32   7.7
gi|46048786|ref|NP_990421.1| glutathione S-transferases CL2 [Gal...    32   7.7
gi|49091862|ref|XP_407392.1| hypothetical protein AN3255.2 [Aspe...    32   7.7
gi|39934646|ref|NP_946922.1| putative glutathione S-transferase ...    32   7.7
gi|15219447|ref|NP_178086.1| wall-associated kinase, putative [A...    32   7.7
gi|18202336|sp|P70102|MCA3_CRIGR Multisynthetase complex auxilia...    32   7.7


>gi|17537261|ref|NP_496858.1| glutathione S-Transferase (gst-20)
           [Caenorhabditis elegans]
 gi|7510009|pir||T21905 hypothetical protein Y48E1B.10 -
           Caenorhabditis elegans
 gi|31044411|emb|CAB02297.3| Hypothetical protein Y48E1B.10
           [Caenorhabditis elegans]
 gi|31044412|emb|CAB07700.3| Hypothetical protein Y48E1B.10
           [Caenorhabditis elegans]
          Length = 207

 Score =  364 bits (935), Expect = e-100
 Identities = 178/187 (95%), Positives = 178/187 (95%)
 Frame = -1

Query: 564 LFALSGTKYEDIRIEHADWPAQKPKMPFGQMPVLELSSGLQIPQSMAIARYLAKKFGYAG 385
           LFALSGTKYEDIRIEHADWPAQKPKMPFGQMPVLELSSGLQIPQSMAIARYLAKKFGYAG
Sbjct: 21  LFALSGTKYEDIRIEHADWPAQKPKMPFGQMPVLELSSGLQIPQSMAIARYLAKKFGYAG 80

Query: 384 KTXXXXXXXXXLIDQFKDFYAEIKPYYYAKIGVLQNDTEEEKKKTLIPARDKFLTIIGKF 205
           KT         LIDQFKDFYAEIKPYYYAKIGVLQNDTEEEKKKTLIPARDKFLTIIGKF
Sbjct: 81  KTDEEAALADALIDQFKDFYAEIKPYYYAKIGVLQNDTEEEKKKTLIPARDKFLTIIGKF 140

Query: 204 LKLSISGFLFSGGLTYADLMICDNMRTLIAWWPEYLNEYPDIKAWYQKVDGIPEIRKHLE 25
           LKLSISGFLFSGGLTYADLMICDNMRTLIAWWPEYLNEYPDIKAWYQKVDGIPEIRKHLE
Sbjct: 141 LKLSISGFLFSGGLTYADLMICDNMRTLIAWWPEYLNEYPDIKAWYQKVDGIPEIRKHLE 200

Query: 24  SSPDKGF 4
           SSPDKGF
Sbjct: 201 SSPDKGF 207




[DB home][top]