Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y48G10A_5
(686 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17510185|ref|NP_493371.1| esterase D (31.2 kD) (1O83) [Caenor... 471 e-132
gi|39592462|emb|CAE63539.1| Hypothetical protein CBG08020 [Caeno... 416 e-115
gi|28436838|gb|AAH46766.1| Similar to esterase 10 [Mus musculus] 266 2e-70
gi|13937355|ref|NP_058599.1| esterase D/formylglutathione hydrol... 266 2e-70
gi|34874491|ref|XP_214241.2| similar to esterase 10; esterase D ... 265 5e-70
gi|12846304|dbj|BAB27115.1| unnamed protein product [Mus musculus] 265 6e-70
gi|30584415|gb|AAP36460.1| Homo sapiens esterase 10 [synthetic c... 262 4e-69
gi|33413400|ref|NP_001975.1| esterase D/formylglutathione hydrol... 262 4e-69
gi|12654663|gb|AAH01169.1| Esterase D/formylglutathione hydrolas... 262 4e-69
gi|47522936|ref|NP_999225.1| esterase D [Sus scrofa] >gnl|BL_ORD... 259 4e-68
gi|27374310|gb|AAO01059.1| CG4390-PA [Drosophila pseudoobscura] 258 6e-68
gi|7288152|dbj|BAA92850.1| esterase D [Sus scrofa] 258 8e-68
gi|24648347|ref|NP_650864.1| CG4390-PA [Drosophila melanogaster]... 255 5e-67
gi|45551932|ref|NP_732486.2| CG4390-PB [Drosophila melanogaster]... 255 5e-67
gi|31206671|ref|XP_312302.1| ENSANGP00000010587 [Anopheles gambi... 250 2e-65
gi|49129583|ref|XP_412919.1| hypothetical protein AN8782.2 [Aspe... 245 5e-64
gi|15227376|ref|NP_181684.1| esterase, putative [Arabidopsis tha... 241 8e-63
gi|48103820|ref|XP_395656.1| similar to esterase D/formylglutath... 240 2e-62
gi|21593226|gb|AAM65175.1| putative esterase D [Arabidopsis thal... 238 6e-62
gi|48785001|ref|ZP_00281306.1| COG0627: Predicted esterase [Burk... 235 5e-61
gi|33594609|ref|NP_882253.1| putative esterase [Bordetella pertu... 233 3e-60
gi|23105069|ref|ZP_00091527.1| COG0627: Predicted esterase [Azot... 232 6e-60
gi|33598736|ref|NP_886379.1| putative esterase [Bordetella parap... 232 6e-60
gi|45508928|ref|ZP_00161264.1| COG0627: Predicted esterase [Anab... 231 1e-59
gi|46313355|ref|ZP_00213945.1| COG0627: Predicted esterase [Burk... 231 1e-59
gi|17230300|ref|NP_486848.1| S-formylglutathione hydrolase [Nost... 229 3e-59
gi|46318220|ref|ZP_00218702.1| COG0627: Predicted esterase [Burk... 229 3e-59
gi|24378638|ref|NP_720593.1| putative esterase [Streptococcus mu... 227 2e-58
gi|48892797|ref|ZP_00326130.1| COG0627: Predicted esterase [Tric... 226 3e-58
gi|15598824|ref|NP_252318.1| probable esterase [Pseudomonas aeru... 225 7e-58
gi|49083277|gb|AAT50990.1| PA3628 [synthetic construct] 225 7e-58
gi|46130929|ref|ZP_00168898.2| COG0627: Predicted esterase [Rals... 224 2e-57
gi|16272149|ref|NP_438352.1| esterase [Haemophilus influenzae Rd... 224 2e-57
gi|48849128|ref|ZP_00303372.1| COG0627: Predicted esterase [Novo... 224 2e-57
gi|38076466|ref|XP_125266.2| similar to esterase 10; esterase D ... 223 3e-57
gi|46164341|ref|ZP_00137017.2| COG0627: Predicted esterase [Pseu... 223 4e-57
gi|50549161|ref|XP_502051.1| hypothetical protein [Yarrowia lipo... 222 5e-57
gi|27381297|ref|NP_772826.1| esterase D [Bradyrhizobium japonicu... 222 6e-57
gi|21232816|ref|NP_638733.1| esterase [Xanthomonas campestris pv... 221 8e-57
gi|21233675|ref|NP_639973.1| esterase [Proteus vulgaris] >gnl|BL... 221 1e-56
gi|23125947|ref|ZP_00107860.1| COG0627: Predicted esterase [Nost... 221 1e-56
gi|42629148|ref|ZP_00154697.1| COG0627: Predicted esterase [Haem... 220 2e-56
gi|48732746|ref|ZP_00266489.1| COG0627: Predicted esterase [Pseu... 220 2e-56
gi|15677171|ref|NP_274324.1| esterase, putative [Neisseria menin... 220 2e-56
gi|17988105|ref|NP_540739.1| S-FORMYLGLUTATHIONE HYDROLASE [Bruc... 219 3e-56
gi|16263919|ref|NP_436711.1| putative S-formylglutathione hydrol... 219 4e-56
gi|21241507|ref|NP_641089.1| esterase [Xanthomonas axonopodis pv... 219 4e-56
gi|48866881|ref|ZP_00320569.1| COG0627: Predicted esterase [Haem... 219 4e-56
gi|15794413|ref|NP_284235.1| esterase D [Neisseria meningitidis ... 219 4e-56
gi|13475915|ref|NP_107485.1| esterase [Mesorhizobium loti MAFF30... 218 9e-56
gi|28868765|ref|NP_791384.1| esterase, putative [Pseudomonas syr... 218 1e-55
gi|32403292|ref|XP_322259.1| hypothetical protein [Neurospora cr... 218 1e-55
gi|24376368|ref|NP_720476.1| esterase, putative [Shewanella onei... 218 1e-55
gi|17545323|ref|NP_518725.1| PROBABLE HYDROLASE OXIDOREDUCTASE P... 216 3e-55
gi|26988349|ref|NP_743774.1| esterase, putative [Pseudomonas put... 216 4e-55
gi|1002868|gb|AAC44554.1| S-formylglutathione hydrolase 216 4e-55
gi|15888800|ref|NP_354481.1| AGR_C_2723p [Agrobacterium tumefaci... 216 4e-55
gi|42522469|ref|NP_967849.1| Esterase D [Bdellovibrio bacteriovo... 215 6e-55
gi|46912404|emb|CAG19196.1| putative esterase [Photobacterium pr... 215 6e-55
gi|15965144|ref|NP_385497.1| PUTATIVE S-FORMYLGLUTATHIONE HYDROL... 214 1e-54
gi|22958298|ref|ZP_00005972.1| COG0627: Predicted esterase [Rhod... 214 1e-54
gi|23470531|ref|ZP_00125864.1| COG0627: Predicted esterase [Pseu... 213 2e-54
gi|48771700|ref|ZP_00276042.1| COG0627: Predicted esterase [Rals... 213 2e-54
gi|37679024|ref|NP_933633.1| predicted esterase [Vibrio vulnific... 213 3e-54
gi|24373615|ref|NP_717658.1| esterase, putative [Shewanella onei... 213 3e-54
gi|50421931|ref|XP_459524.1| unnamed protein product [Debaryomyc... 213 4e-54
gi|23120469|ref|ZP_00103123.1| COG0627: Predicted esterase [Desu... 212 6e-54
gi|37523995|ref|NP_927372.1| S-formylglutathione hydrolase [Gloe... 212 6e-54
gi|48763995|ref|ZP_00268548.1| COG0627: Predicted esterase [Rhod... 211 8e-54
gi|16329755|ref|NP_440483.1| esterase [Synechocystis sp. PCC 680... 210 2e-53
gi|26246359|ref|NP_752398.1| Hypothetical protein yaiM [Escheric... 210 2e-53
gi|87028|pir||A23543 methylumbelliferyl-acetate deacetylase (EC ... 210 2e-53
gi|28899925|ref|NP_799580.1| putative esterase [Vibrio parahaemo... 209 5e-53
gi|15800086|ref|NP_286098.1| putative esterase (EC 3.1.1.1) [Esc... 208 7e-53
gi|38106297|gb|EAA52625.1| hypothetical protein MG05317.4 [Magna... 208 9e-53
gi|37528163|ref|NP_931508.1| hypothetical protein [Photorhabdus ... 208 9e-53
gi|16128340|ref|NP_414889.1| putative S-formylglutathione hydrol... 207 1e-52
gi|47207795|emb|CAF89790.1| unnamed protein product [Tetraodon n... 206 3e-52
gi|16121774|ref|NP_405087.1| putative esterase [Yersinia pestis]... 206 5e-52
gi|50121639|ref|YP_050806.1| putative esterase [Erwinia carotovo... 205 6e-52
gi|45511895|ref|ZP_00163462.1| COG0627: Predicted esterase [Syne... 205 8e-52
gi|46432588|gb|EAK92063.1| hypothetical protein CaO19.6596 [Cand... 204 1e-51
gi|16761136|ref|NP_456753.1| putative esterase [Salmonella enter... 202 5e-51
gi|16765524|ref|NP_461139.1| putative esterase [Salmonella typhi... 202 7e-51
gi|49076058|ref|XP_402045.1| hypothetical protein UM04430.1 [Ust... 201 1e-50
gi|48864516|ref|ZP_00318409.1| COG0627: Predicted esterase [Micr... 201 1e-50
gi|50254721|gb|EAL17467.1| hypothetical protein CNBM1600 [Crypto... 198 7e-50
gi|46124607|ref|XP_386857.1| hypothetical protein FG06681.1 [Gib... 197 2e-49
gi|16126754|ref|NP_421318.1| esterase [Caulobacter crescentus CB... 197 2e-49
gi|23501041|ref|NP_697168.1| esterase, putative [Brucella suis 1... 196 4e-49
gi|50730861|ref|XP_417051.1| PREDICTED: similar to esterase D [G... 195 6e-49
gi|20161330|dbj|BAB90254.1| putative esterase D [Oryza sativa (j... 195 8e-49
gi|16130092|ref|NP_416659.1| putative esterase (EC 3.1.1.-).; pu... 194 1e-48
gi|26248537|ref|NP_754577.1| Hypothetical protein yeiG [Escheric... 194 1e-48
gi|15802710|ref|NP_288737.1| putative esterase (EC 3.1.1.-). [Es... 194 2e-48
gi|27363817|ref|NP_759345.1| Predicted esterase [Vibrio vulnific... 191 9e-48
gi|30248912|ref|NP_840982.1| probable hydrolase oxidoreductase p... 191 1e-47
gi|46141626|ref|ZP_00146943.2| COG0627: Predicted esterase [Psyc... 189 4e-47
gi|50083909|ref|YP_045419.1| putative esterase [Acinetobacter sp... 189 4e-47
gi|45190451|ref|NP_984705.1| AEL156Wp [Eremothecium gossypii] >g... 189 4e-47
gi|27374397|gb|AAO01133.1| CG4390-PA [Drosophila willistoni] 187 2e-46
gi|34496194|ref|NP_900409.1| probable esterase [Chromobacterium ... 185 6e-46
gi|50310297|ref|XP_455168.1| unnamed protein product [Kluyveromy... 184 2e-45
gi|50291007|ref|XP_447936.1| unnamed protein product [Candida gl... 181 2e-44
gi|24414805|emb|CAD55618.1| putative esterase [Synechococcus sp.... 180 2e-44
gi|6322393|ref|NP_012467.1| Hypothetical ORF; Yjl068cp [Saccharo... 177 1e-43
gi|2665774|gb|AAC04838.1| S-formylglutathione hydrolase [Anabaen... 176 3e-43
gi|895893|emb|CAA61307.1| hypothetical esterase [Saccharomyces c... 175 7e-43
gi|33563036|dbj|BAC81697.1| S-formylglutathione hydrolase [Candi... 161 1e-38
gi|46916663|emb|CAG23428.1| Putative esterase [Photobacterium pr... 157 2e-37
gi|47205829|emb|CAF92503.1| unnamed protein product [Tetraodon n... 115 6e-25
gi|32033917|ref|ZP_00134188.1| COG0627: Predicted esterase [Acti... 94 2e-18
gi|6984138|gb|AAF34769.1| putative esterase D [Euphorbia esula] 88 1e-16
gi|15603316|ref|NP_246390.1| XynC [Pasteurella multocida Pm70] >... 65 1e-09
gi|11385866|gb|AAG34997.1| esterase MesA [Pasteurella multocida] 64 2e-09
gi|2981449|gb|AAC06298.1| esterase D [Homo sapiens] 53 7e-06
gi|28379821|ref|NP_786713.1| acetylesterase [Lactobacillus plant... 51 2e-05
gi|27467144|ref|NP_763781.1| tributyrin esterase [Staphylococcus... 47 3e-04
gi|48849595|ref|ZP_00303838.1| COG0627: Predicted esterase [Novo... 46 6e-04
gi|23003139|ref|ZP_00046807.1| COG0627: Predicted esterase [Lact... 46 8e-04
gi|49484826|ref|YP_042050.1| putative esterase [Staphylococcus a... 45 0.001
gi|15925619|ref|NP_373153.1| hypothetical protein SAV2629 [Staph... 45 0.001
gi|27469131|ref|NP_765768.1| tributyrin esterase [Staphylococcus... 45 0.002
gi|46916665|emb|CAG23430.1| Hypothetical protein [Photobacterium... 42 0.009
gi|48865177|ref|ZP_00319041.1| COG0627: Predicted esterase [Oeno... 42 0.012
gi|46323275|ref|ZP_00223640.1| COG0627: Predicted esterase [Burk... 42 0.015
gi|34540247|ref|NP_904726.1| esterase, putative [Porphyromonas g... 41 0.026
gi|24379842|ref|NP_721797.1| putative tributyrin esterase [Strep... 40 0.033
gi|15899688|ref|NP_344293.1| Conserved hypothetical protein [Sul... 40 0.033
gi|46908604|ref|YP_014993.1| tributyrin esterase [Listeria monoc... 40 0.044
gi|16801589|ref|NP_471857.1| similar to acetylesterase [Listeria... 40 0.044
gi|22779357|dbj|BAC15556.1| acetyl esterase [Abiotrophia para-ad... 40 0.044
gi|16804471|ref|NP_465956.1| similar to acetylesterase [Listeria... 40 0.057
gi|21280513|gb|AAM45148.1| esterase [Lactococcus lactis] 39 0.075
gi|13541380|ref|NP_111068.1| Uncharacterized conserved protein [... 39 0.13
gi|48787008|ref|ZP_00283090.1| COG0627: Predicted esterase [Burk... 39 0.13
gi|22086635|gb|AAM90699.1| carboxylesterase [Lactococcus lactis ... 38 0.17
gi|7453518|gb|AAF62860.1| tributyrin esterase [Lactococcus lacti... 38 0.17
gi|6048346|gb|AAF02201.1| lipase [Lactococcus lactis subsp. crem... 38 0.22
gi|23024809|ref|ZP_00064003.1| COG0627: Predicted esterase [Leuc... 37 0.28
gi|47155019|emb|CAE85218.1| hypothetical protein [Escherichia coli] 37 0.37
gi|46312822|ref|ZP_00213415.1| COG0627: Predicted esterase [Burk... 37 0.48
gi|2147352|pir||S58235 endo-1,4-beta-xylanase (EC 3.2.1.8) 1 pre... 37 0.48
gi|15673753|ref|NP_267928.1| lipase [Lactococcus lactis subsp. l... 37 0.48
gi|48862208|ref|ZP_00316105.1| COG0627: Predicted esterase [Micr... 37 0.48
gi|14518327|ref|NP_116810.1| MS122, putative esterase [Microscil... 36 0.63
gi|8574455|gb|AAF77578.1| pepper esterase [Capsicum annuum] 36 0.82
gi|42523523|ref|NP_968903.1| hypothetical protein predicted by G... 36 0.82
gi|48862718|ref|ZP_00316613.1| COG0400: Predicted esterase [Micr... 35 1.1
gi|48895268|ref|ZP_00328252.1| COG0596: Predicted hydrolases or ... 35 1.1
gi|41410109|ref|NP_962945.1| hypothetical protein MAP4011c [Myco... 35 1.1
gi|15607660|ref|NP_215033.1| hypothetical protein Rv0519c [Mycob... 35 1.4
gi|50309069|ref|XP_454540.1| unnamed protein product [Kluyveromy... 35 1.8
gi|15639936|ref|NP_219389.1| lipase, putative [Treponema pallidu... 35 1.8
gi|47219201|emb|CAG11219.1| unnamed protein product [Tetraodon n... 35 1.8
gi|46365405|ref|ZP_00227893.1| COG0596: Predicted hydrolases or ... 35 1.8
gi|23126850|ref|ZP_00108734.1| COG0596: Predicted hydrolases or ... 34 2.4
gi|29345562|ref|NP_809065.1| acetyl esterase (acetylxylosidase) ... 34 2.4
gi|23098161|ref|NP_691627.1| hypothetical protein OB0706 [Oceano... 34 3.1
gi|2120585|pir||S66261 X-Pro dipeptidyl-peptidase (EC 3.4.14.11)... 34 3.1
gi|37361925|gb|AAQ91190.1| dipeptidyl peptidase-like protein 2 [... 34 3.1
gi|21219041|ref|NP_624820.1| hypothetical protein [Streptomyces ... 34 3.1
gi|8698848|gb|AAF78504.1| P35 protein [Leucania separata nuclear... 34 3.1
gi|21674033|ref|NP_662098.1| conserved hypothetical protein [Chl... 34 3.1
gi|7959245|dbj|BAA96016.1| KIAA1492 protein [Homo sapiens] 33 4.1
gi|37523440|ref|NP_926817.1| probable peptidase [Gloeobacter vio... 33 4.1
gi|16330605|ref|NP_441333.1| unknown protein [Synechocystis sp. ... 33 4.1
gi|23124076|ref|ZP_00106090.1| COG4099: Predicted peptidase [Nos... 33 4.1
gi|24308235|ref|NP_065919.1| dipeptidylpeptidase 10; dipeptidyl ... 33 4.1
gi|34871459|ref|XP_345583.1| similar to CUB and sushi multiple d... 33 5.3
gi|46119423|ref|ZP_00176576.2| COG1193: Mismatch repair ATPase (... 33 5.3
gi|15673548|ref|NP_267722.1| hypothetical protein L7563 [Lactoco... 33 5.3
gi|32477543|ref|NP_870537.1| probable lipase/esterase [Pirellula... 33 5.3
gi|2570829|gb|AAC46184.1| dipeptidyl peptidase IV [Porphyromonas... 33 5.3
gi|34540319|ref|NP_904798.1| dipeptidyl aminopeptidase IV [Porph... 33 5.3
gi|46316969|ref|ZP_00217547.1| COG0596: Predicted hydrolases or ... 33 7.0
gi|30021828|ref|NP_833459.1| IroE protein [Bacillus cereus ATCC ... 33 7.0
gi|46322294|ref|ZP_00222665.1| COG0596: Predicted hydrolases or ... 33 7.0
gi|48865712|ref|ZP_00319571.1| COG0657: Esterase/lipase [Oenococ... 33 7.0
gi|34879496|ref|XP_344134.1| similar to 6430601K09Rik protein [R... 33 7.0
gi|32422039|ref|XP_331463.1| hypothetical protein [Neurospora cr... 33 7.0
gi|45445271|gb|AAS64749.1| Kv4 potassium channel auxiliary subun... 33 7.0
gi|34864214|ref|XP_236345.2| similar to Dipeptidylpeptidase 8 [R... 32 9.1
gi|38648705|gb|AAH63074.1| 6430601K09Rik protein [Mus musculus] 32 9.1
gi|33338056|gb|AAQ13650.1| MSTP135 [Homo sapiens] 32 9.1
gi|20987678|gb|AAH29696.1| 6430601K09Rik protein [Mus musculus] 32 9.1
gi|48770754|ref|ZP_00275097.1| COG0596: Predicted hydrolases or ... 32 9.1
gi|11095190|gb|AAG29767.1| dipeptidyl peptidase 8 [Homo sapiens] 32 9.1
gi|31542571|ref|NP_083182.2| dipeptidylpeptidase 8 [Mus musculus... 32 9.1
gi|26382128|dbj|BAB30295.2| unnamed protein product [Mus musculus] 32 9.1
gi|37577089|ref|NP_932064.1| dipeptidyl peptidase 8 isoform 3; d... 32 9.1
gi|46048414|ref|NP_950186.2| dipeptidylpeptidase 10 [Mus musculu... 32 9.1
gi|27376162|ref|NP_767691.1| NADH dehydrogenase [Bradyrhizobium ... 32 9.1
gi|26007917|gb|AAH40203.1| DPP8 protein [Homo sapiens] 32 9.1
gi|48853526|ref|ZP_00307695.1| COG0596: Predicted hydrolases or ... 32 9.1
gi|18450280|ref|NP_569118.1| dipeptidyl peptidase 8 isoform 1; d... 32 9.1
>gi|17510185|ref|NP_493371.1| esterase D (31.2 kD) (1O83)
[Caenorhabditis elegans]
gi|6580309|emb|CAB60384.2| Hypothetical protein Y48G10A.1
[Caenorhabditis elegans]
gi|6580345|emb|CAB63414.1| Hypothetical protein Y48G10A.1
[Caenorhabditis elegans]
Length = 280
Score = 471 bits (1211), Expect = e-132
Identities = 228/228 (100%), Positives = 228/228 (100%)
Frame = +1
Query: 1 MAATLVSSNRSFKGRQFVYKHASSTTQCEMTFGVYIPDHKPDEKLPALFYLSGLTCTHAN 180
MAATLVSSNRSFKGRQFVYKHASSTTQCEMTFGVYIPDHKPDEKLPALFYLSGLTCTHAN
Sbjct: 1 MAATLVSSNRSFKGRQFVYKHASSTTQCEMTFGVYIPDHKPDEKLPALFYLSGLTCTHAN 60
Query: 181 FMEKSGFQQFASKHRLVVVHPDTSPRGVDVDGDSESWDFGKGAGFYVNATVEKWAKNYRM 360
FMEKSGFQQFASKHRLVVVHPDTSPRGVDVDGDSESWDFGKGAGFYVNATVEKWAKNYRM
Sbjct: 61 FMEKSGFQQFASKHRLVVVHPDTSPRGVDVDGDSESWDFGKGAGFYVNATVEKWAKNYRM 120
Query: 361 YDYIVKELLEEVVPSVAPIDLAKIGIFGHSMGGHGALTIGLRNSSKFQSISAFAPICNPI 540
YDYIVKELLEEVVPSVAPIDLAKIGIFGHSMGGHGALTIGLRNSSKFQSISAFAPICNPI
Sbjct: 121 YDYIVKELLEEVVPSVAPIDLAKIGIFGHSMGGHGALTIGLRNSSKFQSISAFAPICNPI 180
Query: 541 TVPWGQKALTGYLGDEDKSTWNQYDASEVLKAYSGPKREILVDQGAAD 684
TVPWGQKALTGYLGDEDKSTWNQYDASEVLKAYSGPKREILVDQGAAD
Sbjct: 181 TVPWGQKALTGYLGDEDKSTWNQYDASEVLKAYSGPKREILVDQGAAD 228