Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y48G8AL_3
(579 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25151042|ref|NP_740780.1| AdaPTin or adaptin-related protein ... 384 e-106
gi|39582615|emb|CAE63934.1| Hypothetical protein CBG08511 [Caeno... 379 e-104
gi|48142301|ref|XP_397320.1| similar to CG3029-PA [Apis mellifera] 322 3e-87
gi|17985975|ref|NP_536793.1| CG3029-PA [Drosophila melanogaster]... 318 6e-86
gi|47220906|emb|CAG03113.1| unnamed protein product [Tetraodon n... 293 1e-78
gi|27371269|gb|AAH41251.1| Ap3s1-prov protein [Xenopus laevis] 293 1e-78
gi|50540146|ref|NP_001002539.1| zgc:92795 [Danio rerio] >gnl|BL_... 293 2e-78
gi|5031581|ref|NP_005820.1| adaptor-related protein complex 3, s... 291 6e-78
gi|26350839|dbj|BAC39056.1| unnamed protein product [Mus musculus] 291 6e-78
gi|40538814|ref|NP_033812.2| adaptor-related protein complex 3, ... 290 1e-77
gi|26332116|dbj|BAC29788.1| unnamed protein product [Mus musculus] 289 3e-77
gi|4502861|ref|NP_001275.1| adaptor-related protein complex 3, s... 288 4e-77
gi|12832639|dbj|BAB22191.1| unnamed protein product [Mus musculus] 286 2e-76
gi|47227610|emb|CAG09607.1| unnamed protein product [Tetraodon n... 257 1e-67
gi|33871734|gb|AAH07773.1| AP3S2 protein [Homo sapiens] 250 1e-65
gi|50762172|ref|XP_424962.1| PREDICTED: similar to Adapter-relat... 250 1e-65
gi|50417595|gb|AAH77669.1| Unknown (protein for MGC:89782) [Xeno... 249 3e-65
gi|31198817|ref|XP_308356.1| ENSANGP00000019053 [Anopheles gambi... 242 4e-63
gi|34148549|gb|AAP33067.1| adaptin 3 [Mastigamoeba balamuthi] 212 3e-54
gi|49068768|ref|XP_398673.1| hypothetical protein UM01058.1 [Ust... 190 2e-47
gi|22331732|ref|NP_190655.2| clathrin adaptor complex small chai... 174 1e-42
gi|50257344|gb|EAL20053.1| hypothetical protein CNBF3790 [Crypto... 170 2e-41
gi|7484872|pir||T08407 clathrin coat assembly protein homolog F1... 169 3e-41
gi|19114124|ref|NP_593212.1| adaptin complex small chain homolog... 167 1e-40
gi|50554313|ref|XP_504565.1| hypothetical protein [Yarrowia lipo... 155 5e-37
gi|23509177|ref|NP_701845.1| adaptor-related protein complex 3, ... 153 2e-36
gi|50428299|ref|XP_462153.1| unnamed protein product [Debaryomyc... 145 5e-34
gi|32418684|ref|XP_329820.1| hypothetical protein [Neurospora cr... 141 1e-32
gi|20532323|gb|AAM27469.1| Putative clathrin coat assembly prote... 140 1e-32
gi|50311481|ref|XP_455765.1| unnamed protein product [Kluyveromy... 137 1e-31
gi|45184681|ref|NP_982399.1| AAL143Wp [Eremothecium gossypii] >g... 137 2e-31
gi|49096392|ref|XP_409656.1| hypothetical protein AN5519.2 [Aspe... 136 2e-31
gi|38108434|gb|EAA54449.1| hypothetical protein MG02434.4 [Magna... 136 3e-31
gi|46123259|ref|XP_386183.1| conserved hypothetical protein [Gib... 135 5e-31
gi|46433225|gb|EAK92673.1| hypothetical protein CaO19.393 [Candi... 132 5e-30
gi|6322436|ref|NP_012510.1| sigma3-like subunit of the yeast AP-... 131 8e-30
gi|50286269|ref|XP_445563.1| unnamed protein product [Candida gl... 130 2e-29
gi|50753304|ref|XP_413949.1| PREDICTED: similar to Adapter-relat... 130 2e-29
gi|32129329|gb|AAP73856.1| putative clathrin assembly protein [O... 127 1e-28
gi|19112930|ref|NP_596138.1| clathrin coat assembly protein [Sch... 125 6e-28
gi|40253273|dbj|BAD05209.1| putative clathrin coat assembly prot... 122 5e-27
gi|34897116|ref|NP_909904.1| putative clathrin assembly protein ... 119 4e-26
gi|37533546|ref|NP_921075.1| putative clathrin assembly protein ... 117 2e-25
gi|15224841|ref|NP_179569.1| clathrin adaptor complex small chai... 117 2e-25
gi|18398407|ref|NP_565415.1| clathrin assembly protein AP19 [Ara... 117 2e-25
gi|50424993|ref|XP_461088.1| unnamed protein product [Debaryomyc... 117 2e-25
gi|46431440|gb|EAK91004.1| hypothetical protein CaO19.8626 [Cand... 117 2e-25
gi|23480730|gb|EAA17213.1| clathrin assembly protein AP19, small... 117 2e-25
gi|15237005|ref|NP_195267.1| clathrin adaptor complex small chai... 116 3e-25
gi|15220987|ref|NP_175219.1| clathrin coat assembly protein, put... 116 3e-25
gi|31506073|gb|AAP55854.1| clathrin assembly protein AP19-like p... 116 3e-25
gi|23508378|ref|NP_701047.1| clathrin assembly protein AP19, put... 116 3e-25
gi|2231698|gb|AAB96887.1| clathrin assembly protein AP19 [Arabid... 115 7e-25
gi|46228854|gb|EAK89724.1| Aps1p/AP17 like clathrin adaptor prot... 115 7e-25
gi|27924367|gb|AAH45095.1| Ap1s1 protein [Xenopus laevis] 114 1e-24
gi|17149110|gb|AAL35901.1| clathrin assembly protein AP17-like p... 114 1e-24
gi|1762309|gb|AAB39510.1| AP-1 Golgi-related complex component; ... 114 1e-24
gi|49114923|gb|AAH72793.1| Ap1s1 protein [Xenopus laevis] 114 1e-24
gi|50752032|ref|XP_422623.1| PREDICTED: similar to Adaptor-relat... 114 2e-24
gi|50257801|gb|EAL20502.1| hypothetical protein CNBE4230 [Crypto... 113 3e-24
gi|50257802|gb|EAL20503.1| hypothetical protein CNBE4230 [Crypto... 113 3e-24
gi|47123241|gb|AAH70003.1| Unknown (protein for MGC:85689) [Dani... 112 4e-24
gi|21355569|ref|NP_651198.1| CG5864-PA [Drosophila melanogaster]... 112 4e-24
gi|11999126|gb|AAG43051.1| clathrin-associated adaptor complex A... 112 4e-24
gi|12005732|gb|AAG44595.1| DC22 [Homo sapiens] 112 6e-24
gi|30983940|gb|AAP40645.1| clathrin coat assembly protein [Gossy... 112 6e-24
gi|38110386|gb|EAA56111.1| hypothetical protein MG01762.4 [Magna... 111 8e-24
gi|4557471|ref|NP_001274.1| adaptor-related protein complex 1, s... 111 8e-24
gi|17560364|ref|NP_504559.1| AdaPTin or adaptin-related protein ... 111 8e-24
gi|45361523|ref|NP_989338.1| hypothetical protein MGC76308 [Xeno... 111 8e-24
gi|32416434|ref|XP_328695.1| hypothetical protein [Neurospora cr... 110 1e-23
gi|34979801|gb|AAQ83889.1| clathrin-associated adaptor complex A... 110 2e-23
gi|17551440|ref|NP_508767.1| AP-2 Small chain, clathrin associat... 110 2e-23
gi|45433520|ref|NP_991121.1| adaptor-related protein complex 1, ... 110 2e-23
gi|49085482|ref|XP_404859.1| conserved hypothetical protein [Asp... 109 3e-23
gi|5630084|gb|AAD45829.1| clathrin coat assembly protein AP19 [H... 109 3e-23
gi|46121429|ref|XP_385269.1| conserved hypothetical protein [Gib... 109 4e-23
gi|30584435|gb|AAP36470.1| Homo sapiens adaptor-related protein ... 109 4e-23
gi|47085925|ref|NP_998320.1| zgc:65827 [Danio rerio] >gnl|BL_ORD... 109 4e-23
gi|34855189|ref|XP_346535.1| hypothetical protein XP_346534 [Rat... 109 4e-23
gi|49257373|gb|AAH73025.1| Unknown (protein for IMAGE:5048812) [... 108 5e-23
gi|13431288|sp|Q9Y587|A4S1_HUMAN Adapter-related protein complex... 108 5e-23
gi|19110255|gb|AAL82726.1| putative adaptor protein complex smal... 108 5e-23
gi|50312131|ref|XP_456097.1| unnamed protein product [Kluyveromy... 108 5e-23
gi|24648686|ref|NP_650961.2| CG6056-PA [Drosophila melanogaster]... 108 7e-23
gi|4757996|ref|NP_004060.1| adaptor-related protein complex 2, s... 108 7e-23
gi|35215317|ref|NP_898848.1| adaptor-related protein complex AP-... 108 9e-23
gi|21541959|sp|Q96PC3|A1S3_HUMAN Adapter-related protein complex... 107 1e-22
gi|16307060|gb|AAH09606.1| AP1S3 protein [Homo sapiens] 107 1e-22
gi|30584173|gb|AAP36335.1| Homo sapiens adaptor-related protein ... 107 2e-22
gi|22027655|ref|NP_003907.3| adaptor-related protein complex 1 s... 107 2e-22
gi|47228292|emb|CAG07687.1| unnamed protein product [Tetraodon n... 107 2e-22
gi|50730233|ref|XP_416820.1| PREDICTED: similar to DC22 [Gallus ... 107 2e-22
gi|17998681|ref|NP_068356.1| adaptor-related protein complex AP-... 107 2e-22
gi|40254484|ref|NP_081163.2| adaptor-related protein complex 1 s... 107 2e-22
gi|31209179|ref|XP_313556.1| ENSANGP00000013513 [Anopheles gambi... 107 2e-22
gi|27882536|gb|AAH44496.1| Zgc:65824 protein [Danio rerio] 106 3e-22
gi|21541960|sp|Q9DB50|A1S2_MOUSE Adapter-related protein complex... 106 3e-22
gi|34880078|ref|XP_217618.2| similar to Adapter-related protein ... 106 3e-22
gi|47197861|emb|CAF88251.1| unnamed protein product [Tetraodon n... 106 3e-22
gi|49072660|ref|XP_400619.1| hypothetical protein UM03004.1 [Ust... 106 3e-22
gi|31241917|ref|XP_321389.1| ENSANGP00000008517 [Anopheles gambi... 106 3e-22
gi|12621128|ref|NP_075241.1| clathrin-associated protein 17 [Rat... 106 3e-22
gi|47225038|emb|CAF97453.1| unnamed protein product [Tetraodon n... 106 3e-22
gi|38049694|ref|XP_357107.1| similar to Adaptor-related protein ... 106 3e-22
gi|46137037|ref|XP_390210.1| conserved hypothetical protein [Gib... 105 5e-22
gi|31209177|ref|XP_313555.1| ENSANGP00000023452 [Anopheles gambi... 105 6e-22
gi|31324170|gb|AAP47182.1| sigma adaptin [Leishmania mexicana me... 105 8e-22
gi|49111528|ref|XP_411819.1| hypothetical protein AN7682.2 [Aspe... 104 1e-21
gi|23510210|ref|NP_702876.1| clathrin assembly protein, putative... 104 1e-21
gi|49904512|gb|AAH76159.1| Unknown (protein for IMAGE:7073805) [... 104 1e-21
gi|26335903|dbj|BAC31652.1| unnamed protein product [Mus musculus] 103 3e-21
gi|4741996|gb|AAD28793.1| 19 kDa Golgi adaptor protein adaptin [... 103 3e-21
gi|45198642|ref|NP_985671.1| AFR124Wp [Eremothecium gossypii] >g... 102 4e-21
gi|23482798|gb|EAA18673.1| putative clathrin assembly protein [P... 102 5e-21
gi|47115580|sp|O50016|A2S1_MAIZE Clathrin coat assembly protein ... 102 7e-21
gi|46434469|gb|EAK93877.1| hypothetical protein CaO19.1136 [Cand... 101 9e-21
gi|38109895|gb|EAA55695.1| hypothetical protein MG01346.4 [Magna... 101 9e-21
gi|19114322|ref|NP_593410.1| putative clathrin-associated protei... 100 2e-20
gi|30584685|gb|AAP36595.1| Homo sapiens adaptor-related protein ... 100 2e-20
gi|16950628|ref|NP_476430.1| adaptor-related protein complex 1, ... 100 2e-20
gi|50254562|gb|EAL17311.1| hypothetical protein CNBN1380 [Crypto... 100 2e-20
gi|11999128|gb|AAG43052.1| adaptor protein complex AP-2 small ch... 100 2e-20
gi|30690340|ref|NP_849496.1| clathrin adaptor complex small chai... 100 2e-20
gi|50424443|ref|XP_460809.1| unnamed protein product [Debaryomyc... 99 6e-20
gi|47224823|emb|CAG06393.1| unnamed protein product [Tetraodon n... 99 6e-20
gi|50285517|ref|XP_445187.1| unnamed protein product [Candida gl... 98 1e-19
gi|50288901|ref|XP_446880.1| unnamed protein product [Candida gl... 97 2e-19
gi|6323200|ref|NP_013271.1| Involved in a subset of clathrin fun... 97 3e-19
gi|16805060|ref|NP_473089.1| clathrin coat assembly protein, put... 96 5e-19
gi|31873748|emb|CAD97839.1| hypothetical protein [Homo sapiens] 96 6e-19
gi|26788038|emb|CAD58750.1| SI:dZ234G15.5 (novel protein similar... 96 6e-19
gi|38348472|ref|NP_941015.1| adaptor-related protein complex 2, ... 95 8e-19
gi|50748396|ref|XP_421226.1| PREDICTED: similar to Adapter-relat... 93 3e-18
gi|47214821|emb|CAF89648.1| unnamed protein product [Tetraodon n... 93 4e-18
gi|50303761|ref|XP_451826.1| unnamed protein product [Kluyveromy... 92 5e-18
gi|29841297|gb|AAP06329.1| similar to GenBank Accession Number Q... 91 2e-17
gi|50545896|ref|XP_500486.1| hypothetical protein [Yarrowia lipo... 91 2e-17
gi|33991735|gb|AAH56547.1| Zgc:65824 protein [Danio rerio] 91 2e-17
gi|25405904|pir||H96518 protein T2E6.6 [imported] - Arabidopsis ... 89 6e-17
gi|6322518|ref|NP_012592.1| Related to the sigma subunit of the ... 87 2e-16
gi|19070753|gb|AAL83979.1| clathrin coat assembly protein [Oryza... 87 2e-16
gi|20878262|ref|XP_143553.1| similar to Adaptor-related protein ... 86 6e-16
gi|45198888|ref|NP_985917.1| AFR370Cp [Eremothecium gossypii] >g... 82 9e-15
gi|30584831|gb|AAP36668.1| Homo sapiens adaptor-related protein ... 79 5e-14
gi|21361394|ref|NP_009008.2| adaptor-related protein complex 4, ... 79 5e-14
gi|28193130|emb|CAD62307.1| unnamed protein product [Homo sapiens] 79 5e-14
gi|28950037|emb|CAD70792.1| probable clathrin-associated adaptor... 78 1e-13
gi|50810228|ref|XP_429062.1| PREDICTED: similar to Zgc:65827, pa... 78 1e-13
gi|19110262|gb|AAL82727.1| putative adaptor protein complex smal... 75 9e-13
gi|34865552|ref|XP_345669.1| similar to AP-4 adaptor complex sig... 74 1e-12
gi|12805057|gb|AAH01985.1| Ap4s1 protein [Mus musculus] 70 4e-11
gi|30520341|ref|NP_848929.1| adaptor-related protein complex 1, ... 69 5e-11
gi|44889992|emb|CAF32110.1| clathrin coat assembly protein, puta... 69 8e-11
gi|34877178|ref|XP_346067.1| similar to Adapter-related protein ... 68 1e-10
gi|3859992|gb|AAC72946.1| unknown [Homo sapiens] 62 1e-08
gi|50233773|ref|NP_571582.1| zeta2-cop [Danio rerio] >gnl|BL_ORD... 61 1e-08
gi|7259358|dbj|BAA92784.1| nonclathrin coat protein zeta2-COP [D... 61 1e-08
gi|11038643|ref|NP_067586.1| adaptor-related protein complex 2, ... 61 2e-08
gi|47213453|emb|CAF95449.1| unnamed protein product [Tetraodon n... 60 3e-08
gi|49255971|gb|AAH72784.1| Unknown (protein for MGC:80093) [Xeno... 60 4e-08
gi|7705983|ref|NP_057513.1| COPZ2 for nonclathrin coat protein z... 59 8e-08
gi|18858455|ref|NP_571583.1| zeta1-cop [Danio rerio] >gnl|BL_ORD... 59 8e-08
gi|29126980|gb|AAH47988.1| Copz1 protein [Xenopus laevis] 58 1e-07
gi|27805867|ref|NP_776707.1| CGI-120 protein [Bos taurus] >gnl|B... 58 1e-07
gi|33416405|gb|AAH55604.1| Zeta1-cop [Danio rerio] 58 1e-07
gi|34868640|ref|XP_235705.2| similar to Coatomer zeta-1 subunit ... 57 2e-07
gi|12834399|dbj|BAB22895.1| unnamed protein product [Mus musculus] 57 2e-07
gi|9845242|ref|NP_063930.1| coatomer protein complex, subunit ze... 57 2e-07
gi|19264103|gb|AAH25041.1| Copz1 protein [Mus musculus] 57 2e-07
gi|7706337|ref|NP_057141.1| coatomer protein complex, subunit ze... 57 2e-07
gi|41053483|ref|NP_956603.1| similar to adaptor protein complex ... 54 2e-06
gi|34908112|ref|NP_915403.1| putative zeta1-COP [Oryza sativa (j... 50 3e-05
gi|46228345|gb|EAK89244.1| similar to clathrin adaptor complex, ... 49 9e-05
gi|7259348|dbj|BAA92779.1| nonclathrin coat protein zeta1-COP [G... 48 1e-04
gi|7259352|dbj|BAA92781.1| nonclathrin coat protein zeta1-COP [L... 47 2e-04
gi|23487461|gb|EAA21060.1| hypothetical protein [Plasmodium yoel... 47 3e-04
gi|7380910|dbj|BAA93046.1| nonclathrin coat protein zeta1-COP [Z... 46 4e-04
gi|47178101|emb|CAG14347.1| unnamed protein product [Tetraodon n... 46 6e-04
gi|18491175|gb|AAL69490.1| putative coatomer protein [Arabidopsi... 46 6e-04
gi|31218057|ref|XP_316555.1| ENSANGP00000010037 [Anopheles gambi... 45 7e-04
gi|18413126|ref|NP_567337.1| clathrin adaptor complex small chai... 45 7e-04
gi|47207949|emb|CAG07092.1| unnamed protein product [Tetraodon n... 45 0.001
gi|7259346|dbj|BAA92778.1| nonclathrin coat protein zeta1-COP [B... 45 0.001
gi|46389933|dbj|BAD15717.1| putative nonclathrin coat protein ze... 45 0.001
gi|30681014|ref|NP_566358.2| clathrin adaptor complex small chai... 44 0.002
gi|6681338|gb|AAF23255.1| putative coatomer zeta subunit (zeta-c... 44 0.002
gi|23478867|gb|EAA15840.1| nonclathrin coat protein zeta1-COP, p... 44 0.002
gi|50307181|ref|XP_453569.1| unnamed protein product [Kluyveromy... 44 0.003
gi|34873491|ref|XP_340888.1| similar to nonclathrin coat protein... 43 0.005
gi|7363244|dbj|BAA93004.1| nonclathrin coat protein zeta2-COP [G... 42 0.006
gi|20271436|gb|AAH28319.1| Similar to adaptor-related protein co... 42 0.008
gi|21553419|gb|AAM62512.1| putative coatomer protein [Arabidopsi... 42 0.008
gi|45361403|ref|NP_989279.1| hypothetical protein MGC75577 [Xeno... 42 0.008
gi|50312519|ref|XP_456295.1| unnamed protein product [Kluyveromy... 41 0.014
gi|7380908|dbj|BAA93045.1| nonclathrin coat protein zeta2-COP [Z... 40 0.023
gi|7259350|dbj|BAA92780.1| nonclathrin coat protein zeta2-COP [O... 40 0.023
gi|7678766|dbj|BAA95144.1| zeta1-COP [Oryza sativa (japonica cul... 40 0.023
gi|7259354|dbj|BAA92782.1| nonclathrin coat protein zeta2-COP [L... 40 0.040
gi|38084280|ref|XP_357620.1| similar to adaptor-related protein ... 39 0.068
gi|38637615|dbj|BAD03896.1| hypothetical protein [Oryza sativa (... 39 0.068
gi|25347918|pir||C96635 probable coatomer zeta subunit T7P1.11 [... 38 0.15
gi|18406956|ref|NP_564767.1| clathrin adaptor complex small chai... 38 0.15
gi|50285091|ref|XP_444974.1| unnamed protein product [Candida gl... 37 0.20
gi|23478189|gb|EAA15344.1| hypothetical protein [Plasmodium yoel... 37 0.26
gi|15640130|ref|NP_229757.1| methyl-accepting chemotaxis protein... 37 0.34
gi|47228650|emb|CAG07382.1| unnamed protein product [Tetraodon n... 37 0.34
gi|18401727|ref|NP_029426.1| SAND family protein [Arabidopsis th... 36 0.58
gi|47191553|emb|CAF87114.1| unnamed protein product [Tetraodon n... 35 0.98
gi|24943130|ref|NP_733892.1| ORF39 [Callitrichine herpesvirus 3]... 34 1.7
gi|34909068|ref|NP_915881.1| P0702B09.29 [Oryza sativa (japonica... 34 2.2
gi|12804887|gb|AAH01892.1| NPD014 protein, isoform 2 [Homo sapie... 33 2.9
gi|46309849|ref|NP_064713.3| NPD014 protein isoform 2 [Homo sapi... 33 2.9
gi|46309851|ref|NP_996918.1| NPD014 protein isoform 1 [Homo sapi... 33 2.9
gi|47214881|emb|CAG01185.1| unnamed protein product [Tetraodon n... 33 3.7
gi|19921872|ref|NP_610455.1| CG8070-PA [Drosophila melanogaster]... 33 3.7
gi|38707889|ref|NP_944776.1| polyprotein [Heterosigma akashiwo R... 33 3.7
gi|9965980|gb|AAG02574.1| long-distance movement protein [Pea en... 33 3.7
gi|50550153|ref|XP_502549.1| hypothetical protein [Yarrowia lipo... 33 3.7
gi|38109650|gb|EAA55487.1| hypothetical protein MG09294.4 [Magna... 33 4.9
gi|49087394|ref|XP_405636.1| predicted protein [Aspergillus nidu... 33 4.9
gi|48788500|ref|ZP_00284479.1| COG0840: Methyl-accepting chemota... 33 4.9
gi|31231449|ref|XP_318529.1| ENSANGP00000021256 [Anopheles gambi... 33 4.9
gi|30681020|ref|NP_850548.1| clathrin adaptor complex small chai... 33 4.9
gi|38081775|ref|XP_357529.1| similar to pEARLI 4 protein [Mus mu... 33 4.9
gi|19075836|ref|NP_588336.1| putative coatmer delta subunit [Sch... 32 6.4
gi|24667472|ref|NP_649220.1| CG5847-PA [Drosophila melanogaster]... 32 6.4
gi|18921115|ref|NP_569980.1| CG16903-PA [Drosophila melanogaster... 32 6.4
gi|46138471|ref|XP_390926.1| hypothetical protein FG10750.1 [Gib... 32 8.3
gi|48209881|gb|AAT40487.1| putative disease resistance protein [... 32 8.3
gi|23102624|ref|ZP_00089126.1| COG0762: Predicted integral membr... 32 8.3
gi|46136509|ref|XP_389946.1| hypothetical protein FG09770.1 [Gib... 32 8.3
>gi|25151042|ref|NP_740780.1| AdaPTin or adaptin-related protein
(22.1 kD) (apt-8) [Caenorhabditis elegans]
gi|20198901|gb|AAM15614.1| Adaptin or adaptin-related protein
protein 8 [Caenorhabditis elegans]
Length = 192
Score = 384 bits (987), Expect = e-106
Identities = 192/192 (100%), Positives = 192/192 (100%)
Frame = -1
Query: 579 MIKAILVINNHGKPRLLKFYQHYPEEKQQQIVRETFQLVSKRDDNVCNFLEGGTLIDGND 400
MIKAILVINNHGKPRLLKFYQHYPEEKQQQIVRETFQLVSKRDDNVCNFLEGGTLIDGND
Sbjct: 1 MIKAILVINNHGKPRLLKFYQHYPEEKQQQIVRETFQLVSKRDDNVCNFLEGGTLIDGND 60
Query: 399 YRLIYRHYATLYFIFCVDSSESELGILDLIQVFVETLDRCFENVCELDLIFHVDRVHHIL 220
YRLIYRHYATLYFIFCVDSSESELGILDLIQVFVETLDRCFENVCELDLIFHVDRVHHIL
Sbjct: 61 YRLIYRHYATLYFIFCVDSSESELGILDLIQVFVETLDRCFENVCELDLIFHVDRVHHIL 120
Query: 219 GEIVMGGMVLETNMNEILQRIQEQDKIQKQEAGITAAPARAVSAVKNMNISQQLKDIKLP 40
GEIVMGGMVLETNMNEILQRIQEQDKIQKQEAGITAAPARAVSAVKNMNISQQLKDIKLP
Sbjct: 121 GEIVMGGMVLETNMNEILQRIQEQDKIQKQEAGITAAPARAVSAVKNMNISQQLKDIKLP 180
Query: 39 DLPSLSNLKNAF 4
DLPSLSNLKNAF
Sbjct: 181 DLPSLSNLKNAF 192