Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y51A2D_11
         (1161 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17565984|ref|NP_507627.1| cysteine proteinase family member (...   810   0.0
gi|39595933|emb|CAE67436.1| Hypothetical protein CBG12926 [Caeno...   541   e-152
gi|17558790|ref|NP_505458.1| cysteine protease family member (5K...   340   4e-92
gi|17565974|ref|NP_507622.1| cysteine proteinase family member (...   331   2e-89
gi|39595929|emb|CAE67432.1| Hypothetical protein CBG12922 [Caeno...   328   1e-88
gi|39594612|emb|CAE72190.1| Hypothetical protein CBG19298 [Caeno...   311   2e-83
gi|17566486|ref|NP_507904.1| cathepsin H family member (5U698) [...   258   2e-67
gi|39595915|emb|CAE67418.1| Hypothetical protein CBG12906 [Caeno...   213   7e-54
gi|5231178|gb|AAD41105.1| cysteine proteinase [Hypera postica]        160   4e-38
gi|1594287|gb|AAC48340.1| cathepsin L-like cysteine proteinase [...   155   2e-36
gi|18401420|ref|NP_565649.1| cysteine proteinase, putative [Arab...   152   1e-35
gi|21483188|gb|AAK77918.1| cathepsin L 1 [Dictyocaulus viviparus]     151   3e-35
gi|21483190|gb|AAL14223.1| cathepsin L [Dictyocaulus viviparus]       151   3e-35
gi|118155|sp|P22497|CYSP_THEPA Cysteine proteinase precursor >gn...   146   1e-33
gi|45822209|emb|CAE47501.1| cathepsin L-like proteinase [Diabrot...   144   5e-33
gi|7489850|pir||T10516 fruit bromelain (EC 3.4.22.33) FB22 precu...   143   7e-33
gi|21483184|gb|AAF86584.1| cathepsin L cysteine protease [Haemon...   143   9e-33
gi|4210800|emb|CAA76927.1| thiol protease [Phaedon cochleariae]       143   9e-33
gi|33112583|gb|AAP94047.1| cathepsin-L-like cysteine peptidase 0...   143   9e-33
gi|7435827|pir||T10501 fruit bromelain (EC 3.4.22.33) FB13 precu...   142   1e-32
gi|7435828|pir||T10503 fruit bromelain (EC 3.4.22.33) FB18 precu...   142   1e-32
gi|30023547|gb|AAO48766.2| cathepsin L-like cysteine proteinase ...   142   1e-32
gi|7489849|pir||T10518 fruit bromelain (EC 3.4.22.33) FB1035 pre...   142   2e-32
gi|34905996|ref|NP_914345.1| putative cysteine proteinase [Oryza...   142   2e-32
gi|21483192|gb|AAL14224.1| cathepsin L [Haemonchus contortus] >g...   141   3e-32
gi|33112581|gb|AAP94046.1| cathepsin-L-like cysteine peptidase 0...   141   3e-32
gi|47086663|ref|NP_997853.1| Unknown (protein for MGC:85774); wu...   140   7e-32
gi|33945878|emb|CAE45589.1| papain-like cysteine proteinase-like...   139   1e-31
gi|41152717|dbj|BAD08222.1| cysteine protease 2 [Theileria orien...   139   1e-31
gi|47224192|emb|CAG13112.1| unnamed protein product [Tetraodon n...   139   2e-31
gi|18408828|ref|NP_566920.1| cysteine proteinase, putative [Arab...   138   3e-31
gi|100069|pir||S24602 cysteine proteinase tpp (EC 3.4.22.-) - ga...   138   3e-31
gi|17563798|ref|NP_507199.1| CathePsin L (38.1 kD) (cpl-1) [Caen...   138   3e-31
gi|2507252|sp|P14080|PAP2_CARPA Chymopapain precursor (Papaya pr...   137   4e-31
gi|18418684|ref|NP_567983.1| cysteine endopeptidase, papain-type...   137   4e-31
gi|37780047|gb|AAP32196.1| cysteine protease 8 [Trifolium repens]     137   4e-31
gi|6851030|emb|CAB71032.1| cysteine protease [Lolium multiflorum]     137   4e-31
gi|37732137|gb|AAR02406.1| cysteine proteinase [Anthonomus grandis]   137   5e-31
gi|25956267|dbj|BAC41322.1| unnamed protein product [Lotus corni...   137   5e-31
gi|461905|sp|Q05094|CYS2_LEIPI Cysteine proteinase 2 precursor (...   137   5e-31
gi|45822207|emb|CAE47500.1| cathepsin L-like proteinase [Diabrot...   137   6e-31
gi|18407961|ref|NP_566880.1| cysteine proteinase, putative [Arab...   137   6e-31
gi|14348750|emb|CAC41275.1| CPB2 protein [Leishmania mexicana]        137   6e-31
gi|630816|pir||S47433 cathepsin L (EC 3.4.22.15) - Norway lobste...   136   8e-31
gi|42564163|gb|AAS20593.1| digestive cysteine proteinase intesta...   136   8e-31
gi|7435824|pir||T07851 ananain (EC 3.4.22.31) precursor AN11 - p...   136   1e-30
gi|4469153|emb|CAB38314.1| chymopapain isoform II [Carica papaya]     135   1e-30
gi|5915887|sp|O17473|CATL_BRUPA Cathepsin L-like precursor >gnl|...   135   1e-30
gi|11265612|pir||T47471 cysteine proteinase (EC 3.4.22.-) F18N11...   135   1e-30
gi|39582386|emb|CAE74770.1| Hypothetical protein CBG22599 [Caeno...   135   1e-30
gi|17062058|gb|AAL34984.1| cathepsine L-like cysteine protease [...   135   2e-30
gi|39585483|emb|CAE70566.1| Hypothetical protein CBG17217 [Caeno...   135   2e-30
gi|14719319|gb|AAK73137.1| putative cysteine proteinase [Oryza s...   135   2e-30
gi|14349351|gb|AAC38832.2| cysteine protease [Leishmania donovan...   135   2e-30
gi|1730100|sp|P36400|LCPB_LEIME Cysteine proteinase B precursor ...   135   2e-30
gi|10336513|dbj|BAB13759.1| cysteine proteinase [Astragalus sini...   135   2e-30
gi|118117|sp|P04988|CYS1_DICDI Cysteine proteinase 1 precursor >...   135   2e-30
gi|37780051|gb|AAP32198.1| cysteine protease 12 [Trifolium repens]    135   2e-30
gi|7435801|pir||T06416 cysteine proteinase (EC 3.4.22.-) precurs...   135   2e-30
gi|15824691|gb|AAL09443.1| cysteine protease [Leishmania donovani]    134   3e-30
gi|478768|pir||S29245 cysteine proteinase (EC 3.4.22.-) precurso...   134   3e-30
gi|37780045|gb|AAP32195.1| cysteine protease 5 [Trifolium repens]     134   3e-30
gi|27728675|gb|AAO18731.1| cysteine protease [Gossypium hirsutum]     134   3e-30
gi|7435775|pir||JC5443 cathepsin L-like cysteine proteinase (EC ...   134   3e-30
gi|33333694|gb|AAQ11965.1| putative gut cathepsin L-like cystein...   134   4e-30
gi|2144501|pir||TAGB actinidain (EC 3.4.22.14) precursor - kiwi ...   134   4e-30
gi|46948154|gb|AAT07059.1| cathepsin F-like cysteine proteinase ...   134   4e-30
gi|13432122|sp|P80884|ANAN_ANACO Ananain precursor >gnl|BL_ORD_I...   134   4e-30
gi|46948150|gb|AAT07057.1| cathepsin L-like cysteine proteinase ...   134   4e-30
gi|113603|sp|P05167|ALEU_HORVU Thiol protease aleurain precursor...   134   5e-30
gi|535600|gb|AAA29137.1| cathepsin [Fasciola hepatica]                134   5e-30
gi|18420375|ref|NP_568052.1| cysteine proteinase RD19a (RD19A) /...   134   5e-30
gi|629792|pir||S47434 cysteine proteinase (EC 3.4.22.-) - rice >...   134   5e-30
gi|730035|sp|P16311|MMAL_DERFA Major mite fecal allergen Der f 1...   134   5e-30
gi|46401612|dbj|BAD16614.1| cysteine proteinase [Dianthus caryop...   134   5e-30
gi|10798511|emb|CAC12806.1| cathepsin L1 [Fasciola hepatica]          134   5e-30
gi|33333698|gb|AAQ11967.1| putative gut cathepsin L-like cystein...   133   7e-30
gi|22096273|gb|AAC17994.2| cysteine protease [Babesia equi]           133   7e-30
gi|46309423|ref|YP_006313.1| cathepsin [Agrotis segetum granulov...   133   7e-30
gi|23397070|gb|AAN31820.1| putative cysteine proteinase AALP [Ar...   133   7e-30
gi|18424347|ref|NP_568921.1| cysteine proteinase, putative / AAL...   133   7e-30
gi|2351107|dbj|BAA21929.1| bromelain [Ananas comosus]                 133   7e-30
gi|17569349|ref|NP_509408.1| cysteine proteinase AALP (43.7 kD) ...   133   7e-30
gi|1491774|emb|CAA68192.1| cysteine protease [Zea mays]               133   9e-30
gi|1706261|sp|Q10717|CYS2_MAIZE Cysteine proteinase 2 precursor ...   133   9e-30
gi|33333708|gb|AAQ11972.1| putative gut cathepsin L-like cystein...   133   9e-30
gi|33333696|gb|AAQ11966.1| putative gut cathepsin L-like cystein...   133   9e-30
gi|33242884|gb|AAQ01146.1| cathepsin [Petromyzon marinus]             133   9e-30
gi|34329348|gb|AAQ63885.1| putative cysteine proteinase [Medicag...   133   9e-30
gi|18423124|ref|NP_568722.1| cysteine proteinase, putative [Arab...   133   9e-30
gi|14422331|emb|CAC41636.1| early leaf senescence abundant cyste...   133   9e-30
gi|945081|gb|AAC49361.1| P21                                          132   1e-29
gi|39588844|emb|CAE69474.1| Hypothetical protein CBG15672 [Caeno...   132   2e-29
gi|7435791|pir||T12041 cysteine proteinase (EC 3.4.22.-) 3 precu...   132   2e-29
gi|33333702|gb|AAQ11969.1| putative gut cathepsin L-like cystein...   132   2e-29
gi|2780176|emb|CAA71085.1| cystein proteinase [Leishmania mexicana]   132   2e-29
gi|18141287|gb|AAL60581.1| senescence-associated cysteine protea...   132   2e-29
gi|12744965|gb|AAK06862.1| actinidin protease [Actinidia chinensis]   132   2e-29
gi|113285|sp|P00785|ACTN_ACTCH Actinidain precursor (Actinidin) ...   132   2e-29
gi|31322338|gb|AAP20039.1| vivapain 2 [Plasmodium vivax]              132   2e-29
gi|30141019|dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus]   132   2e-29
gi|1361974|pir||S57776 cysteine proteinase (EC 3.4.22.-) - clove...   132   2e-29
gi|4469155|emb|CAB38315.1| chymopapain isoform III [Carica papaya]    132   2e-29
gi|7435779|pir||S71923 cysteine proteinase (EC 3.4.22.-) - garde...   132   2e-29
gi|33945877|emb|CAE45588.1| papain-like cysteine proteinase-like...   132   2e-29
gi|47606538|gb|AAT36253.1| vivapain-2 [Plasmodium vivax] >gnl|BL...   132   2e-29
gi|47606558|gb|AAT36263.1| vivapain-2 [Plasmodium vivax]              132   2e-29
gi|47606560|gb|AAT36264.1| vivapain-2 [Plasmodium vivax]              132   2e-29
gi|47606518|gb|AAT36243.1| vivapain-2 [Plasmodium vivax] >gnl|BL...   132   2e-29
gi|33333704|gb|AAQ11970.1| putative gut cathepsin L-like cystein...   132   2e-29
gi|21593213|gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsi...   132   2e-29
gi|47524507|gb|AAT34987.1| putative cysteine protease [Gossypium...   132   2e-29
gi|535454|gb|AAA50755.1| cysteine proteinase                          132   2e-29
gi|67656|pir||KHBH aleurain (EC 3.4.22.-) precursor - barley          132   2e-29
gi|1749812|emb|CAA90237.1| cysteine proteinase LmCPB1 [Leishmani...   132   2e-29
gi|129233|sp|P25778|ORYC_ORYSA Oryzain gamma chain precursor >gn...   131   3e-29
gi|30141025|dbj|BAC75926.1| cysteine protease-4 [Helianthus annuus]   131   3e-29
gi|33333712|gb|AAQ11974.1| putative gut cathepsin L-like cystein...   131   3e-29
gi|33333706|gb|AAQ11971.1| putative gut cathepsin L-like cystein...   131   3e-29
gi|28971811|dbj|BAC65417.1| crustapain [Pandalus borealis]            131   3e-29
gi|2499879|sp|Q40143|CYS3_LYCES Cysteine proteinase 3 precursor ...   131   3e-29
gi|27530349|dbj|BAC53948.1| Der f 1 allergen preproenzyme [Derma...   131   3e-29
gi|1173630|gb|AAB37233.1| cysteine proteinase                         131   3e-29
gi|50355623|dbj|BAD29960.1| cysteine protease [Daucus carota]         131   3e-29
gi|17569299|ref|NP_509736.1| cathepsin L-like cysteine proteinas...   131   3e-29
gi|8347420|dbj|BAA96501.1| cysteine protease [Nicotiana tabacum]      131   3e-29
gi|45822201|emb|CAE47497.1| cathepsin L-like proteinase [Diabrot...   131   3e-29
gi|18141289|gb|AAL60582.1| senescence-associated cysteine protea...   131   3e-29
gi|50657027|emb|CAH04631.1| cathepsin H [Suberites domuncula]         131   3e-29
gi|7435773|pir||S71773 cysteine proteinase (EC 3.4.22.-) precurs...   130   4e-29
gi|8547325|gb|AAF76330.1| cathepsin L [Fasciola hepatica]             130   4e-29
gi|31240547|ref|XP_320687.1| ENSANGP00000020002 [Anopheles gambi...   130   4e-29
gi|18403438|ref|NP_565780.1| cysteine proteinase, putative [Arab...   130   4e-29
gi|20136379|gb|AAM11647.1| cathepsin L [Fasciola hepatica]            130   4e-29
gi|22759715|dbj|BAC10906.1| cysteine proteinase [Zinnia elegans]      130   6e-29
gi|13491750|gb|AAK27968.1| cysteine protease [Ipomoea batatas]        130   6e-29
gi|7271891|gb|AAF44676.1| cathepsin L [Fasciola gigantica]            130   6e-29
gi|12597541|ref|NP_075125.1| cathepsin [Heliocoverpa armigera nu...   130   6e-29
gi|7435798|pir||T06206 probable cysteine proteinase (EC 3.4.22.-...   130   6e-29
gi|129231|sp|P25776|ORYA_ORYSA Oryzain alpha chain precursor >gn...   130   6e-29
gi|228245|prf||1801240C Cys protease 3                                130   6e-29
gi|37963625|gb|AAP94048.2| cathepsin-L-like midgut cysteine prot...   130   6e-29
gi|38346007|emb|CAD40110.2| OSJNBa0035O13.9 [Oryza sativa (japon...   130   6e-29
gi|18141281|gb|AAL60578.1| senescence-associated cysteine protea...   130   8e-29
gi|15824693|gb|AAL09444.1| cysteine protease [Leishmania donovani]    130   8e-29
gi|41152538|gb|AAR99518.1| cathepsin L protein [Fasciola hepatica]    130   8e-29
gi|5853329|gb|AAD54424.1| thiol protease [Matricaria chamomilla]      130   8e-29
gi|44844204|emb|CAF32698.1| cysteine proteinase [Leishmania infa...   130   8e-29
gi|10441624|gb|AAG17127.1| cathepsin L-like cysteine proteinase ...   130   8e-29
gi|5081735|gb|AAD39513.1| cathepsin L-like protease precursor [A...   130   8e-29
gi|18399697|ref|NP_565512.1| cysteine proteinase A494, putative ...   130   8e-29
gi|21070926|gb|AAM34401.1| putative cysteine proteinase [Oryza s...   130   8e-29
gi|33348834|gb|AAQ16117.1| cathepsin L-like cysteine proteinase ...   129   1e-28
gi|30690594|ref|NP_564321.2| peptidase C1A papain family protein...   129   1e-28
gi|27681979|ref|XP_225125.1| similar to cathepsin 1 precursor [R...   129   1e-28
gi|7435820|pir||T10514 probable stem bromelain (EC 3.4.22.32) pr...   129   1e-28
gi|39583812|emb|CAE74885.1| Hypothetical protein CBG22748 [Caeno...   129   1e-28
gi|600111|emb|CAA84378.1| cysteine proteinase [Vicia sativa]          129   1e-28
gi|321019|pir||S19651 cysteine proteinase (EC 3.4.22.-) precurso...   129   1e-28
gi|25289991|pir||D86413 cysteine proteinase (EC 3.4.22.-) [simil...   129   1e-28
gi|542004|pir||S42882 cysteine proteinase (EC 3.4.22.-) precurso...   129   1e-28
gi|40806498|gb|AAR92154.1| putative cysteine protease 1 [Iris ho...   129   1e-28
gi|39581574|emb|CAE58359.1| Hypothetical protein CBG01480 [Caeno...   129   1e-28
gi|33242880|gb|AAQ01144.1| cathepsin [Branchiostoma lanceolatum]      129   2e-28
gi|33242872|gb|AAQ01140.1| cathepsin [Branchiostoma lanceolatum]      129   2e-28
gi|630489|pir||S43991 cathepsin L-like proteinases (EC 3.4.22.-)...   129   2e-28
gi|45738078|gb|AAS75836.1| fastuosain precursor [Bromelia fastuosa]   129   2e-28
gi|17224950|gb|AAL37181.1| cathepsin L-like protease [Ancylostom...   129   2e-28
gi|18396939|ref|NP_564320.1| peptidase C1A papain family protein...   129   2e-28
gi|6649575|gb|AAF21461.1| cysteine proteinase PWCP1 [Paragonimus...   129   2e-28
gi|13774082|gb|AAK38169.1| cathepsin L-like [Fasciola hepatica]       129   2e-28
gi|627141|pir||A61500 allergen Der f I precursor - house-dust mi...   128   2e-28
gi|18138384|ref|NP_542680.1| cathepsin [Helicoverpa zea single n...   128   2e-28
gi|28192371|gb|AAK07729.1| NTCP23-like cysteine proteinase [Nico...   128   2e-28
gi|4574304|gb|AAD23996.1| cathepsin [Fasciola gigantica]              128   2e-28
gi|27413319|gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]   128   2e-28
gi|1401242|gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]    128   2e-28
gi|6682829|dbj|BAA88898.1| cysteine protease component of protea...   128   2e-28
gi|11055|emb|CAA45129.1| cysteine proteinase preproenzyme [Homar...   128   2e-28
gi|10241433|emb|CAC09354.1| putative oryzain alpha precursor [Or...   128   2e-28
gi|118125|sp|P25784|CYS3_HOMAM Digestive cysteine proteinase 3 p...   128   2e-28
gi|7211745|gb|AAF40416.1| papain-like cysteine proteinase isofor...   128   2e-28
gi|516865|emb|CAA52403.1| putative thiol protease [Arabidopsis t...   128   3e-28
gi|17978641|gb|AAL48319.1| vinckepain-2 [Plasmodium vinckei]          128   3e-28
gi|1809286|gb|AAB41670.1| secreted cathepsin L 1 [Fasciola hepat...   128   3e-28
gi|33333700|gb|AAQ11968.1| putative gut cathepsin L-like cystein...   128   3e-28
gi|7271889|gb|AAF44675.1| cathepsin L [Fasciola gigantica]            128   3e-28
gi|7271893|gb|AAF44677.1| cathepsin L [Fasciola gigantica]            128   3e-28
gi|1169186|sp|P43156|CYSP_HEMSP Thiol protease SEN102 precursor ...   128   3e-28
gi|21263041|gb|AAM44832.1| cathepsin L2 [Fasciola gigantica]          128   3e-28
gi|7435822|pir||T07840 ananain (EC 3.4.22.31) AN8 precursor - pi...   128   3e-28
gi|6978721|ref|NP_037071.1| cathepsin H [Rattus norvegicus] >gnl...   128   3e-28
gi|7106279|ref|NP_031827.1| cathepsin H; Cat H [Mus musculus] >g...   128   3e-28
gi|28932706|gb|AAO60047.1| midgut cysteine proteinase 4 [Rhipice...   128   3e-28
gi|12024965|gb|AAG45727.1| cathepsin L-like cysteine protease [L...   128   3e-28
gi|34899394|ref|NP_911043.1| putative cysteine proteinase [Oryza...   127   4e-28
gi|33242874|gb|AAQ01141.1| cathepsin [Branchiostoma lanceolatum]      127   4e-28
gi|50355611|dbj|BAD29954.1| cysteine protease [Daucus carota]         127   4e-28
gi|47522632|ref|NP_999094.1| cathepsin H [Sus scrofa] >gnl|BL_OR...   127   4e-28
gi|7435806|pir||T01207 cysteine proteinase mir3 (EC 3.4.22.-) - ...   127   5e-28
gi|50355613|dbj|BAD29955.1| cysteine protease [Daucus carota]         127   5e-28
gi|18141283|gb|AAL60579.1| senescence-associated cysteine protea...   127   6e-28
gi|30141021|dbj|BAC75924.1| cysteine protease-2 [Helianthus annuus]   127   6e-28
gi|34559455|gb|AAQ75437.1| cathepsin L-like protease [Helicoverp...   127   6e-28
gi|18422289|ref|NP_568620.1| cysteine proteinase, putative / thi...   127   6e-28
gi|33333710|gb|AAQ11973.1| putative gut cathepsin L-like cystein...   127   6e-28
gi|38045864|gb|AAR08900.1| cathepsin L [Fasciola gigantica]           127   6e-28
gi|7381219|gb|AAF61440.1| papain-like cysteine proteinase isofor...   127   6e-28
gi|7211741|gb|AAF40414.1| papain-like cysteine proteinase isofor...   127   6e-28
gi|18141285|gb|AAL60580.1| senescence-associated cysteine protea...   127   6e-28
gi|7435797|pir||T06208 cysteine proteinase (EC 3.4.22.-) - barle...   127   6e-28
gi|4100157|gb|AAD10337.1| cysteine proteinase precursor [Hordeum...   127   6e-28
gi|129614|sp|P00784|PAPA_CARPA Papain precursor (Papaya proteina...   127   6e-28
gi|20334377|gb|AAM19209.1| cysteine protease [Lycopersicon escul...   127   6e-28
gi|4731374|gb|AAD28477.1| papain-like cysteine protease [Sanders...   127   6e-28
gi|50313163|gb|AAT74529.1| toxopain-2 [Toxoplasma gondii]             127   6e-28
gi|6650705|gb|AAF21977.1| thiolproteinase SmTP1 [Sarcocystis muris]   126   8e-28
gi|3688528|emb|CAA06243.1| pre-pro-TPE4A protein [Pisum sativum]      126   8e-28
gi|37788267|gb|AAO64473.1| cathepsin H precursor [Fundulus heter...   126   8e-28
gi|118120|sp|P25249|CYS1_HORVU Cysteine proteinase EP-B 1 precur...   126   8e-28
gi|20334375|gb|AAM19208.1| cysteine protease [Lycopersicon penne...   126   8e-28
gi|24285904|gb|AAL14199.1| cysteine proteinase precursor [Ipomoe...   126   1e-27
gi|33242878|gb|AAQ01143.1| cathepsin [Branchiostoma lanceolatum]      126   1e-27
gi|31558997|gb|AAP49831.1| cathepsin L [Fasciola hepatica]            126   1e-27
gi|2239107|emb|CAA70693.1| cathepsin L-like cysteine proteinase ...   126   1e-27
gi|7211743|gb|AAF40415.1| papain-like cysteine proteinase isofor...   126   1e-27
gi|5823020|gb|AAD53012.1| senescence-specific cysteine protease ...   125   1e-27
gi|7381221|gb|AAF61441.1| papain-like cysteine proteinase isofor...   125   1e-27
gi|38344381|emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa (japon...   125   1e-27
gi|40556818|gb|AAR87763.1| fibroinase precursor [Bombyx mori]         125   2e-27
gi|21953244|emb|CAD42716.1| putative cathepsin L [Myzus persicae]     125   2e-27
gi|33242876|gb|AAQ01142.1| cathepsin [Branchiostoma lanceolatum]      125   2e-27
gi|118150|sp|P25804|CYSP_PEA Cysteine proteinase 15A precursor (...   125   2e-27
gi|24654434|ref|NP_725686.1| CG4847-PD [Drosophila melanogaster]...   125   2e-27
gi|34146988|gb|AAB65956.2| Hypothetical protein F41E6.6 [Caenorh...   125   2e-27
gi|19922450|ref|NP_611221.1| CG4847-PA [Drosophila melanogaster]...   125   2e-27
gi|7435793|pir||T09528 probable cysteine proteinase (EC 3.4.22.-...   125   2e-27
gi|118124|sp|P25250|CYS2_HORVU Cysteine proteinase EP-B 2 precur...   125   2e-27
gi|33333714|gb|AAQ11975.1| putative gut cathepsin L-like cystein...   125   2e-27
gi|18394919|ref|NP_564126.1| cysteine endopeptidase, papain-type...   125   2e-27
gi|44844206|emb|CAF32699.1| cathepsin L-like cysteine proteinase...   125   2e-27
gi|33242870|gb|AAQ01139.1| cathepsin [Branchiostoma lanceolatum]      124   3e-27
gi|203341|gb|AAA63484.1| cathepsin H                                  124   3e-27
gi|31096290|gb|AAP43630.1| chabaupain-2 [Plasmodium chabaudi cha...   124   3e-27
gi|28974202|gb|AAO61485.1| cathepsin H [Sterkiella histriomuscorum]   124   3e-27
gi|40806500|gb|AAR92155.1| putative cysteine protease 2 [Iris ho...   124   3e-27
gi|33242882|gb|AAQ01145.1| cathepsin [Branchiostoma lanceolatum]      124   4e-27
gi|1483570|emb|CAA68066.1| cathepsin l [Litopenaeus vannamei]         124   4e-27
gi|20334373|gb|AAM19207.1| cysteine protease [Lycopersicon pimpi...   124   4e-27
gi|28971813|dbj|BAC65418.1| cathepsin L [Pandalus borealis]           124   4e-27
gi|21264388|sp|P09668|CATH_HUMAN Cathepsin H precursor >gnl|BL_O...   124   4e-27
gi|38345008|emb|CAD40026.2| OSJNBa0052O21.11 [Oryza sativa (japo...   124   5e-27
gi|46251290|gb|AAS84611.1| cathepsin L-like cysteine proteinase ...   124   5e-27
gi|24644153|ref|NP_649521.1| CG12163-PB [Drosophila melanogaster...   124   5e-27
gi|67653|pir||KHHUH cathepsin H (EC 3.4.22.16) precursor [valida...   124   5e-27
gi|24644155|ref|NP_730901.1| CG12163-PA [Drosophila melanogaster...   124   5e-27
gi|39588173|emb|CAE68098.1| Hypothetical protein CBG13738 [Caeno...   123   7e-27
gi|7435790|pir||T12382 cysteine proteinase (EC 3.4.22.-) - commo...   123   7e-27
gi|37780041|gb|AAP32193.1| cysteine protease 14 [Trifolium repens]    123   7e-27
gi|13905172|gb|AAH06878.1| Cathepsin H [Mus musculus]                 123   7e-27
gi|45822205|emb|CAE47499.1| cathepsin L-like proteinase [Diabrot...   123   7e-27
gi|47076309|emb|CAD89795.1| putative cathepsin L protease [Meloi...   123   7e-27
gi|46395620|sp|O65039|CYSP_RICCO Vignain precursor (Cysteine end...   123   9e-27
gi|1353726|gb|AAB01769.1| cysteine proteinase homolog                 123   9e-27
gi|19909509|dbj|BAB86959.1| cathepsin L [Fasciola gigantica]          123   9e-27
gi|3941390|gb|AAC82352.1| group 1 allergen Eur m 1 0102 [Eurogly...   123   9e-27
gi|37780039|gb|AAP32192.1| cysteine protease 14 [Trifolium repens]    123   9e-27
gi|4503155|ref|NP_001903.1| cathepsin L preproprotein; major exc...   123   9e-27
gi|15214962|gb|AAH12612.1| Cathepsin L, preproprotein [Homo sapi...   123   9e-27
gi|1709574|sp|P10056|PAP3_CARPA Caricain precursor (Papaya prote...   123   9e-27
gi|14517542|gb|AAK62661.1| F2G19.31/F2G19.31 [Arabidopsis thalia...   123   9e-27
gi|18401614|ref|NP_564497.1| cysteine proteinase (RD21A) / thiol...   123   9e-27
gi|228244|prf||1801240B Cys protease 2                                122   1e-26
gi|26245875|gb|AAN77413.1| digestive cysteine protease intestain...   122   1e-26
gi|50355615|dbj|BAD29956.1| cysteine protease [Daucus carota]         122   1e-26
gi|50762389|ref|XP_425038.1| PREDICTED: similar to cathepsin L p...   122   1e-26
gi|38345906|emb|CAE04498.2| OSJNBb0059K02.8 [Oryza sativa (japon...   122   1e-26
gi|13928758|ref|NP_113748.1| cathepsin K [Rattus norvegicus] >gn...   122   1e-26
gi|50355619|dbj|BAD29958.1| cysteine protease [Daucus carota]         122   1e-26
gi|50355621|dbj|BAD29959.1| cysteine protease [Daucus carota]         122   1e-26
gi|630486|pir||S44151 cathepsin L (EC 3.4.22.15) - fluke (Schist...   122   1e-26
gi|48145879|emb|CAG33162.1| CTSH [Homo sapiens]                       122   1e-26
gi|23110955|ref|NP_004381.2| cathepsin H isoform a preproprotein...   122   1e-26
gi|1223922|gb|AAA92063.1| cysteinyl endopeptidase [Vigna radiata]     122   2e-26
gi|445927|prf||1910332A Cys endopeptidase                             122   2e-26
gi|1809288|gb|AAC47721.1| secreted cathepsin L 2 [Fasciola hepat...   122   2e-26
gi|23110957|ref|NP_683880.1| cathepsin H isoform b precursor; al...   122   2e-26
gi|30387350|ref|NP_848429.1| cathepsin [Choristoneura fumiferana...   122   2e-26
gi|1185459|gb|AAA87849.1| preprocathepsin cathepsin L                 122   2e-26
gi|11493685|gb|AAG35605.1| cysteine protease [Cercopithecus aeth...   122   2e-26
gi|16506813|gb|AAL23961.1| cathepsin H [Homo sapiens]                 122   2e-26
gi|19909511|dbj|BAB86960.1| cathepsin L [Fasciola gigantica]          122   2e-26
gi|118123|sp|P25782|CYS2_HOMAM Digestive cysteine proteinase 2 p...   122   2e-26
gi|4757570|gb|AAD29084.1| cysteine proteinase precursor [Solanum...   122   2e-26
gi|5051468|emb|CAB44983.1| putative preprocysteine proteinase [N...   122   2e-26
gi|16506815|gb|AAL23962.1| truncated cathepsin H [Homo sapiens]       122   2e-26
gi|42407296|dbj|BAD10859.1| cysteine protease [Aster tripolium]       122   2e-26
gi|23344734|gb|AAN28680.1| cathepsin L [Theromyzon tessulatum]        122   2e-26
gi|32394728|gb|AAM96000.1| cathepsin L precursor [Metapenaeus en...   122   2e-26
gi|7242888|dbj|BAA92495.1| cysteine protease [Vigna mungo]            122   2e-26
gi|32394730|gb|AAM96001.1| cathepsin L precursor [Metapenaeus en...   122   2e-26
gi|42407937|dbj|BAD09076.1| putative cysteine proteinase [Oryza ...   122   2e-26
gi|21425246|emb|CAD33266.1| cathepsin L [Aphis gossypii]              121   3e-26
gi|24653516|ref|NP_725347.1| CG6692-PA [Drosophila melanogaster]...   121   3e-26
gi|23110960|ref|NP_001324.2| cathepsin L2 preproprotein; catheps...   121   3e-26
gi|3087790|emb|CAA75029.1| cathepsin L2 [Homo sapiens]                121   3e-26
gi|1848231|gb|AAB48120.1| cathepsin L-like protease [Leishmania ...   121   3e-26
gi|28192375|gb|AAK07731.1| CPR2-like cysteine proteinase [Nicoti...   121   3e-26
gi|18408616|ref|NP_566901.1| cysteine proteinase, putative [Arab...   121   3e-26
gi|25289998|pir||JC7787 carrot seed cysteine proteinase (EC 3.4....   121   3e-26
gi|50761194|ref|XP_418273.1| PREDICTED: similar to Cathepsin L, ...   121   3e-26
gi|50355617|dbj|BAD29957.1| cysteine protease [Daucus carota]         121   3e-26
gi|24653514|ref|NP_523735.2| CG6692-PC [Drosophila melanogaster]...   121   3e-26
gi|118158|sp|P12412|CYSP_VIGMU Vignain precursor (Bean endopepti...   121   4e-26
gi|7435809|pir||T06529 cysteine proteinase (EC 3.4.22.-) - garde...   121   4e-26
gi|7435794|pir||T12039 cysteine proteinase (EC 3.4.22.-) 1 precu...   121   4e-26
gi|8917581|gb|AAF81277.1| EPCS68 [Mus musculus] >gnl|BL_ORD_ID|4...   121   4e-26
gi|46358368|ref|NP_062414.2| cathepsin 8; ectoplacental cone, in...   121   4e-26
gi|14424447|sp|P25780|EUM1_EURMA Mite group 1 allergen Eur m 1 p...   121   4e-26
gi|1085124|pir||JX0366 cysteine endopeptidase (EC 3.4.22.-) prec...   121   4e-26
gi|100203|pir||S24988 cysteine proteinase (EC 3.4.22.-) precurso...   121   4e-26
gi|5777889|emb|CAB53515.1| cysteine protease [Solanum tuberosum]      121   4e-26
gi|1706260|sp|Q10716|CYS1_MAIZE Cysteine proteinase 1 precursor ...   121   4e-26
gi|7435795|pir||T12040 cysteine proteinase (EC 3.4.22.-) 2 precu...   120   5e-26
gi|21666724|gb|AAM73806.1| cysteine proteinase [Brassica napus] ...   120   5e-26
gi|11265608|pir||T46630 cysteine proteinase (EC 3.4.22.-) 1 prec...   120   5e-26
gi|18422605|ref|NP_568651.1| senescence-specific SAG12 protein (...   120   5e-26
gi|30141023|dbj|BAC75925.1| cysteine protease-3 [Helianthus annuus]   120   5e-26
gi|5761329|dbj|BAA83473.1| cysteine endopeptidase [Oryza sativa]...   120   5e-26
gi|9634237|ref|NP_037776.1| ORF16 cathepsin [Spodoptera exigua n...   120   5e-26
gi|37651368|ref|NP_932731.1| cathepsin [Choristoneura fumiferana...   120   6e-26
gi|23110964|ref|NP_001326.2| cathepsin W preproprotein; lymphopa...   120   6e-26
gi|23956098|ref|NP_062412.1| cathepsin 7; ectoplacental cone, in...   120   6e-26
gi|129232|sp|P25777|ORYB_ORYSA Oryzain beta chain precursor >gnl...   120   6e-26
gi|13491752|gb|AAK27969.1| cysteine protease [Ipomoea batatas]        120   6e-26
gi|8917575|gb|AAF81274.1| EPCS24 [Mus musculus]                       120   6e-26
gi|7381610|gb|AAF61565.1| cathepsin L-like proteinase precursor ...   120   8e-26
gi|7435780|pir||T09259 cathepsin L-like proteinase (EC 3.4.22.-)...   120   8e-26
gi|22653681|sp|Q9TST1|CATW_FELCA Cathepsin W precursor                120   8e-26
gi|29165304|gb|AAO65603.1| cathepsin L precursor [Hydra vulgaris]     120   8e-26
gi|15290508|gb|AAK92229.1| cysteine proteinase [Arabidopsis thal...   120   8e-26
gi|730036|sp|P08176|MMAL_DERPT Major mite fecal allergen Der p 1...   120   8e-26
gi|30141027|dbj|BAC75927.1| cysteine protease-5 [Helianthus annuus]   120   8e-26
gi|31982433|ref|NP_031828.2| cathepsin K; Cat K; minisatellite 1...   120   8e-26
gi|7435774|pir||S22502 cysteine proteinase (EC 3.4.22.-) - kidne...   119   1e-25
gi|15234557|ref|NP_195406.1| cysteine proteinase, putative [Arab...   119   1e-25
gi|33520126|gb|AAQ21040.1| cathepsin L precursor [Branchiostoma ...   119   1e-25
gi|17543258|ref|NP_502836.1| cysteine precursor (4P968) [Caenorh...   119   1e-25
gi|7435777|pir||JC5442 cathepsin L-like cysteine proteinase (EC ...   119   1e-25
gi|5823018|gb|AAD53011.1| senescence-specific cysteine protease ...   119   1e-25
gi|3097321|dbj|BAA25899.1| Bd 30K [Glycine max]                       119   1e-25
gi|7435811|pir||T06708 cysteine proteinase (EC 3.4.22.-) T29H11....   119   1e-25
gi|1345573|emb|CAA40073.1| endopeptidase (EP-C1) [Phaseolus vulg...   119   1e-25
gi|15826035|pdb|1FH0|A Chain A, Crystal Structure Of Human Cathe...   119   1e-25
gi|32488398|emb|CAE02823.1| OSJNBa0043A12.28 [Oryza sativa (japo...   119   1e-25
gi|1709576|sp|P05994|PAP4_CARPA Papaya proteinase IV precursor (...   119   1e-25
gi|544129|sp|P25803|CYSP_PHAVU Vignain precursor (Bean endopepti...   119   1e-25
gi|9635308|ref|NP_059206.1| ORF58 [Xestia c-nigrum granulovirus]...   119   1e-25
gi|46948152|gb|AAT07058.1| cathepsin L-like cysteine proteinase ...   119   1e-25
gi|16304178|gb|AAL16954.1| cathepsin L-like cysteine protease pr...   119   1e-25
gi|23508353|ref|NP_701022.1| falcipain-3 [Plasmodium falciparum ...   119   2e-25
gi|50539796|ref|NP_001002368.1| zgc:92089 [Danio rerio] >gnl|BL_...   119   2e-25
gi|5822035|pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L    119   2e-25
gi|17978639|gb|AAL48318.1| berghepain-2 [Plasmodium berghei]          119   2e-25
gi|2392232|pdb|1CJL|  Crystal Structure Of A Cysteine Protease P...   119   2e-25
gi|49671274|gb|AAH75275.1| Unknown (protein for MGC:88904) [Xeno...   119   2e-25
gi|15617524|ref|NP_258322.1| cathepsin-like cysteine proteinase ...   119   2e-25
gi|47086859|ref|NP_997749.1| cathepsin L, a; ik:tdsubc_2d2; xx:t...   119   2e-25
gi|8050826|gb|AAF71757.1| cysteine protease falcipain-3; PCP2 [P...   119   2e-25
gi|22549430|ref|NP_689203.1| putative cysteine proteinase [Mames...   118   2e-25
gi|9630063|ref|NP_046281.1| cathepsin [Orgyia pseudotsugata mult...   118   2e-25
gi|2829471|sp|P56202|CATW_HUMAN Cathepsin W precursor (Lymphopai...   118   2e-25
gi|50418223|gb|AAH77285.1| Unknown (protein for MGC:80097) [Xeno...   118   2e-25
gi|419782|pir||S30150 cysteine proteinase (EC 3.4.22.-) precurso...   118   2e-25
gi|7435776|pir||JC5441 cathepsin L-like cysteine proteinase (EC ...   118   2e-25
gi|13242029|gb|AAK16515.1| cathepsin L-like cysteine proteinase ...   118   2e-25
gi|31206163|ref|XP_312033.1| ENSANGP00000022503 [Anopheles gambi...   118   2e-25
gi|7435778|pir||S74227 cathepsin K (EC 3.4.22.-) precursor - mou...   118   2e-25
gi|31206165|ref|XP_312034.1| ENSANGP00000018713 [Anopheles gambi...   118   2e-25
gi|20069912|ref|NP_613116.1| cathepsin [Mamestra configurata nuc...   118   2e-25
gi|161879|gb|AAA98600.1| cathepsin L-like cysteine protease           118   3e-25
gi|38346003|emb|CAD40112.2| OSJNBa0035O13.5 [Oryza sativa (japon...   118   3e-25
gi|17560860|ref|NP_505215.1| cysteine proteinase PWCP1 precursor...   118   3e-25
gi|9631045|ref|NP_047715.1| cathepsin-like proteinase [Lymantria...   118   3e-25
gi|2245510|gb|AAB62536.1| cysteine protease [Dirofilaria immitis]     118   3e-25
gi|41688064|dbj|BAD08618.1| cathepsin L preproprotein [Cyprinus ...   118   3e-25
gi|1085687|pir||S53027 cathepsin L (EC 3.4.22.15) precursor - pe...   117   4e-25
gi|38345300|emb|CAE02828.2| OSJNBa0043A12.33 [Oryza sativa (japo...   117   4e-25
gi|419781|pir||S30149 cysteine proteinase (EC 3.4.22.-) precurso...   117   4e-25
gi|2351557|gb|AAB68595.1| cathepsin [Choristoneura fumiferana MNPV]   117   4e-25
gi|37077647|sp|Q91CL9|CATV_NPVAP Viral cathepsin (V-cath) (Cyste...   117   4e-25
gi|7435799|pir||T06207 cysteine proteinase (EC 3.4.22.-) - barle...   117   4e-25
gi|33242865|gb|AAQ01137.1| cathepsin [Branchiostoma lanceolatum]      117   4e-25
gi|545734|gb|AAB30089.1| cysteine protease [Fasciola sp.] >gnl|B...   117   4e-25
gi|34761156|gb|AAQ81938.1| cysteine proteinase precursor [Ipomoe...   117   4e-25
gi|13897890|gb|AAK48495.1| putative cysteine protease [Ipomoea b...   117   4e-25
gi|41055305|ref|NP_956686.1| hypothetical protein MGC64209 [Dani...   117   5e-25
gi|15705865|gb|AAL05851.1| cysteine proteinase precursor [Sander...   117   5e-25
gi|23485822|gb|EAA20588.1| cysteine proteinase precursor [Plasmo...   117   5e-25
gi|4426617|gb|AAD20453.1| cysteine endopeptidase precursor [Oryz...   117   7e-25
gi|30017423|ref|NP_835199.1| testin [Mus musculus] >gnl|BL_ORD_I...   117   7e-25
gi|1834307|dbj|BAA09820.1| cysteine proteinase [Spirometra erina...   117   7e-25
gi|47523662|ref|NP_999467.1| cathepsin K precursor [Sus scrofa] ...   117   7e-25
gi|537437|gb|AAC35211.1| cysteine proteinase [Hemerocallis hybri...   117   7e-25
gi|28194643|gb|AAO33583.1| cathepsin P [Meriones unguiculatus]        116   9e-25
gi|47497527|dbj|BAD19579.1| putative cysteine proteinase 1 precu...   116   9e-25
gi|7435804|pir||T03694 cysteine proteinase (EC 3.4.22.-) - rice ...   116   9e-25
gi|7770062|ref|NP_036137.1| cathepsin J; rat gene/Cathepsin L-re...   116   9e-25
gi|2677828|gb|AAB97142.1| cysteine protease [Prunus armeniaca]        116   9e-25
gi|15128493|dbj|BAB62718.1| plerocercoid growth factor/cysteine ...   116   9e-25
gi|1168794|sp|P43236|CATK_RABIT Cathepsin K precursor (OC-2 prot...   116   9e-25
gi|33348836|gb|AAQ16118.1| cathepsin L-like cysteine proteinase ...   116   9e-25
gi|29840885|gb|AAP05886.1| similar to GenBank Accession Number A...   116   1e-24
gi|18913076|gb|AAL79510.1| granule-biosynthesis induced protease...   116   1e-24
gi|22653679|sp|Q26636|CATL_SARPE Cathepsin L precursor >gnl|BL_O...   115   1e-24
gi|18402225|ref|NP_566633.1| cysteine proteinase, putative / thi...   115   1e-24
gi|4581057|gb|AAD24589.1| cysteine protease [Trypanosoma congole...   115   1e-24
gi|7271897|gb|AAF44679.1| cathepsin L [Fasciola gigantica]            115   1e-24
gi|27681673|ref|XP_225126.1| similar to cathepsin 1 precursor [R...   115   1e-24
gi|2829472|sp|P56203|CATW_MOUSE Cathepsin W precursor (Lymphopai...   115   1e-24
gi|31981819|ref|NP_034115.2| cathepsin W preproprotein [Mus musc...   115   1e-24
gi|31559530|dbj|BAC77523.1| cysteine proteinase [Glycine max] >g...   115   2e-24
gi|950240|gb|AAC47033.1| cysteine proteinase                          115   2e-24
gi|2118132|pir||JC4848 cysteine proteinase (EC 3.4.22.-) - Dougl...   115   2e-24
gi|13124026|sp|Q9WGE0|CATV_NPVHC Viral cathepsin (V-cath) (Cyste...   115   2e-24
gi|27497538|gb|AAO13009.1| cathepsin S preproprotein [Canis fami...   115   2e-24
gi|24583376|ref|NP_609387.1| CG5367-PA [Drosophila melanogaster]...   115   2e-24
gi|7239343|gb|AAF43193.1| cathepsin L [Stylonychia lemnae]            115   2e-24
gi|34861419|ref|XP_341988.1| similar to cathepsin F [Rattus norv...   115   2e-24
gi|39930363|ref|NP_058817.1| cathepsin J; cathepsin P [Rattus no...   115   3e-24
gi|34912626|ref|NP_917660.1| putative cysteine proteinase [Oryza...   115   3e-24
gi|7435805|pir||T01206 cysteine proteinase mir2 (EC 3.4.22.-) - ...   115   3e-24
gi|1199563|gb|AAB09252.1| 34 kDa maturing seed vacuolar thiol pr...   115   3e-24
gi|18391078|ref|NP_563855.1| cysteine protease, papain-like (XBC...   115   3e-24
gi|14600257|gb|AAK71314.1| papain-like cysteine peptidase XBCP3 ...   115   3e-24
gi|49522051|gb|AAH74718.1| Unknown (protein for MGC:69486) [Xeno...   115   3e-24
gi|9845246|ref|NP_063914.1| cathepsin F; cathepsin F precursor [...   115   3e-24
gi|11066228|gb|AAG28508.1| cathepsin F [Mus musculus]                 115   3e-24
gi|4826565|emb|CAB42884.1| cathepsin F [Mus musculus]                 115   3e-24
gi|13242025|gb|AAK16513.1| cathepsin L-like cysteine proteinase ...   114   3e-24
gi|6630972|gb|AAF19630.1| cysteine proteinase precursor [Myxine ...   114   3e-24
gi|30575716|gb|AAP33050.1| cysteine proteinase 3 [Clonorchis sin...   114   3e-24
gi|129353|sp|P22895|P34_SOYBN P34 probable thiol protease precur...   114   3e-24
gi|2765358|emb|CAA74241.1| cathepsin L [Litopenaeus vannamei]         114   3e-24
gi|81542|pir||S02728 actinidain (EC 3.4.22.14) precursor (clone ...   114   3e-24
gi|42794048|dbj|BAD11762.1| cahepsin L-like cysteine protease [B...   114   3e-24
gi|31559526|dbj|BAC77521.1| cysteine proteinase [Glycine max] >g...   114   4e-24
gi|49522293|gb|AAH75261.1| Unknown (protein for MGC:88875) [Xeno...   114   4e-24
gi|34861821|ref|XP_215183.2| similar to Cathepsin W precursor (L...   114   4e-24
gi|37780043|gb|AAP32194.1| cysteine protease 1 [Trifolium repens]     114   4e-24
gi|41152540|gb|AAR99519.1| cathepsin L protein [Fasciola hepatica]    114   4e-24
gi|2239109|emb|CAA70694.1| cathepsin S-like cysteine proteinase ...   114   4e-24
gi|27806673|ref|NP_776457.1| cathepsin L [Bos taurus] >gnl|BL_OR...   114   6e-24
gi|3916212|gb|AAC78838.1| cathepsin F [Homo sapiens]                  114   6e-24
gi|6042196|ref|NP_003784.2| cathepsin F [Homo sapiens] >gnl|BL_O...   114   6e-24
gi|29567137|ref|NP_818699.1| cathepsin [Adoxophyes honmai nucleo...   114   6e-24
gi|18414611|ref|NP_567489.1| cysteine proteinase, putative [Arab...   113   7e-24
gi|6630974|gb|AAF19631.1| cysteine proteinase precursor [Myxine ...   113   7e-24
gi|118145|sp|P20721|CYSL_LYCES Low-temperature-induced cysteine ...   113   7e-24
gi|230417|pdb|2ACT|  Actinidin (Sulfhydryl Proteinase) (E.C. Num...   113   7e-24
gi|442619|pdb|1AEC|  Actinidin (E.C.3.4.22.14) Complex With The ...   113   7e-24
gi|32396020|gb|AAP41847.1| senescence-associated cysteine protea...   113   1e-23
gi|7435800|pir||T03941 cysteine proteinase (EC 3.4.22.-) precurs...   113   1e-23
gi|46948144|gb|AAT07054.1| cathepsin L-like cysteine proteinase ...   113   1e-23
gi|23508356|ref|NP_701025.1| falcipain 2 precursor [Plasmodium f...   113   1e-23
gi|37994576|gb|AAH60335.1| Unknown (protein for MGC:68554) [Xeno...   113   1e-23
gi|37724090|gb|AAO23671.1| silicatein [Petrosia ficiformis]           112   1e-23
gi|6753558|ref|NP_034114.1| cathepsin L preproprotein; furless; ...   112   1e-23
gi|200501|gb|AAA39984.1| preprocathepsin L precursor >gnl|BL_ORD...   112   1e-23
gi|18407678|ref|NP_566867.1| cysteine proteinase, putative [Arab...   112   1e-23
gi|21593501|gb|AAM65468.1| cysteine proteinase [Arabidopsis thal...   112   1e-23
gi|50251130|dbj|BAD27582.1| cathepsin S [Oryzias latipes]             112   1e-23
gi|23482498|gb|EAA18465.1| berghepain-2 [Plasmodium yoelii yoelii]    112   1e-23
gi|9719454|gb|AAF97809.1| falcipain 2 [Plasmodium falciparum] >g...   112   1e-23
gi|9719452|gb|AAF97808.1| falcipain 2 [Plasmodium falciparum]         112   1e-23
gi|7542559|gb|AAF63497.1| falcipain 2 [Plasmodium falciparum] >g...   112   1e-23
gi|7638427|gb|AAF65468.1| cysteine protease falcipain-2 [Plasmod...   112   1e-23
gi|2144502|pir||KHCHL cathepsin L (EC 3.4.22.15) - chicken            112   1e-23
gi|1272388|gb|AAB17051.1| cysteine protease                           112   1e-23
gi|37905511|gb|AAO64477.1| cathepsin S precursor [Fundulus heter...   112   1e-23
gi|47213723|emb|CAF95154.1| unnamed protein product [Tetraodon n...   112   2e-23
gi|12847813|dbj|BAB27719.1| unnamed protein product [Mus musculus]    112   2e-23
gi|27960480|gb|AAO27844.1| cathepsin Q2 [Rattus norvegicus]           112   2e-23
gi|31077116|ref|NP_852043.1| cathepsin M [Rattus norvegicus] >gn...   112   2e-23
gi|4139678|pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cath...   112   2e-23
gi|27465595|ref|NP_775155.1| testin [Rattus norvegicus] >gnl|BL_...   112   2e-23
gi|6467382|gb|AAF13146.1| cathepsin F precursor [Homo sapiens]        112   2e-23
gi|47169030|pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of T...   112   2e-23
gi|13278510|gb|AAH04054.1| Ctsf protein [Mus musculus]                112   2e-23
gi|7271895|gb|AAF44678.1| cathepsin L [Fasciola gigantica]            112   2e-23
gi|37780049|gb|AAP32197.1| cysteine protease 10 [Trifolium repens]    112   2e-23
gi|23110962|ref|NP_004070.3| cathepsin S preproprotein [Homo sap...   112   2e-23
gi|49456321|emb|CAG46481.1| CTSF [Homo sapiens]                       112   2e-23
gi|47213724|emb|CAF95155.1| unnamed protein product [Tetraodon n...   112   2e-23
gi|25289988|pir||G86232 cysteine proteinase (EC 3.4.22.-) [simil...   111   3e-23
gi|33242886|gb|AAQ01147.1| cathepsin [Paralabidochromis chilotes]     111   3e-23
gi|46948156|gb|AAT07060.1| cathepsin L-like cysteine proteinase ...   111   3e-23
gi|12803615|gb|AAH02642.1| Cathepsin S, preproprotein [Homo sapi...   111   3e-23
gi|50251128|dbj|BAD27581.1| cathepsin L [Oryzias latipes]             111   3e-23
gi|1169187|sp|P42666|CYSP_PLAVS Cysteine proteinase precursor >g...   111   3e-23


>gi|17565984|ref|NP_507627.1| cysteine proteinase family member (5T30)
            [Caenorhabditis elegans]
 gi|7510114|pir||T27079 hypothetical protein Y51A2D.8 - Caenorhabditis
            elegans
 gi|3881044|emb|CAA16407.1| Hypothetical protein Y51A2D.8
            [Caenorhabditis elegans]
          Length = 386

 Score =  810 bits (2093), Expect = 0.0
 Identities = 386/386 (100%), Positives = 386/386 (100%)
 Frame = -1

Query: 1161 MQVFVIFLVVLPISGVVSINITEPEFFEINIDRDHPEKLYKAFEDFKKKYNRKYKDESEN 982
            MQVFVIFLVVLPISGVVSINITEPEFFEINIDRDHPEKLYKAFEDFKKKYNRKYKDESEN
Sbjct: 1    MQVFVIFLVVLPISGVVSINITEPEFFEINIDRDHPEKLYKAFEDFKKKYNRKYKDESEN 60

Query: 981  QQRFNNFVKSYNNVDKLNAKSKAAGYDTQFGINKFSDLSTAEFHGRLSNVVPSNNTGLPM 802
            QQRFNNFVKSYNNVDKLNAKSKAAGYDTQFGINKFSDLSTAEFHGRLSNVVPSNNTGLPM
Sbjct: 61   QQRFNNFVKSYNNVDKLNAKSKAAGYDTQFGINKFSDLSTAEFHGRLSNVVPSNNTGLPM 120

Query: 801  LNFDKKKPDFRAADMNKTRHKRRSTRYPDYFDLRNEKINGRYIVGPIKDQGQCACCWGFA 622
            LNFDKKKPDFRAADMNKTRHKRRSTRYPDYFDLRNEKINGRYIVGPIKDQGQCACCWGFA
Sbjct: 121  LNFDKKKPDFRAADMNKTRHKRRSTRYPDYFDLRNEKINGRYIVGPIKDQGQCACCWGFA 180

Query: 621  VTALVETVYAAHSGKFKSLSDQEVCDCGTEGTPGCKGGSLTLGVQYVKKYGLSGDEDYPY 442
            VTALVETVYAAHSGKFKSLSDQEVCDCGTEGTPGCKGGSLTLGVQYVKKYGLSGDEDYPY
Sbjct: 181  VTALVETVYAAHSGKFKSLSDQEVCDCGTEGTPGCKGGSLTLGVQYVKKYGLSGDEDYPY 240

Query: 441  DQNRANQGRRCRLRETDRIVPARAFNFAVINPRRAEEQIIQVLTEWKVPVAVYFKVGDQF 262
            DQNRANQGRRCRLRETDRIVPARAFNFAVINPRRAEEQIIQVLTEWKVPVAVYFKVGDQF
Sbjct: 241  DQNRANQGRRCRLRETDRIVPARAFNFAVINPRRAEEQIIQVLTEWKVPVAVYFKVGDQF 300

Query: 261  KEYKEGVIIEDDCRRATQWHAGAIVGYDTVEDSRGRSHDYWIIKNSWGGDWAESGYVRVV 82
            KEYKEGVIIEDDCRRATQWHAGAIVGYDTVEDSRGRSHDYWIIKNSWGGDWAESGYVRVV
Sbjct: 301  KEYKEGVIIEDDCRRATQWHAGAIVGYDTVEDSRGRSHDYWIIKNSWGGDWAESGYVRVV 360

Query: 81   RGRDWCSIEDQPMTGDIKDHKDNYYY 4
            RGRDWCSIEDQPMTGDIKDHKDNYYY
Sbjct: 361  RGRDWCSIEDQPMTGDIKDHKDNYYY 386




[DB home][top]