Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y51A2D_11
(1161 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17565984|ref|NP_507627.1| cysteine proteinase family member (... 810 0.0
gi|39595933|emb|CAE67436.1| Hypothetical protein CBG12926 [Caeno... 541 e-152
gi|17558790|ref|NP_505458.1| cysteine protease family member (5K... 340 4e-92
gi|17565974|ref|NP_507622.1| cysteine proteinase family member (... 331 2e-89
gi|39595929|emb|CAE67432.1| Hypothetical protein CBG12922 [Caeno... 328 1e-88
gi|39594612|emb|CAE72190.1| Hypothetical protein CBG19298 [Caeno... 311 2e-83
gi|17566486|ref|NP_507904.1| cathepsin H family member (5U698) [... 258 2e-67
gi|39595915|emb|CAE67418.1| Hypothetical protein CBG12906 [Caeno... 213 7e-54
gi|5231178|gb|AAD41105.1| cysteine proteinase [Hypera postica] 160 4e-38
gi|1594287|gb|AAC48340.1| cathepsin L-like cysteine proteinase [... 155 2e-36
gi|18401420|ref|NP_565649.1| cysteine proteinase, putative [Arab... 152 1e-35
gi|21483188|gb|AAK77918.1| cathepsin L 1 [Dictyocaulus viviparus] 151 3e-35
gi|21483190|gb|AAL14223.1| cathepsin L [Dictyocaulus viviparus] 151 3e-35
gi|118155|sp|P22497|CYSP_THEPA Cysteine proteinase precursor >gn... 146 1e-33
gi|45822209|emb|CAE47501.1| cathepsin L-like proteinase [Diabrot... 144 5e-33
gi|7489850|pir||T10516 fruit bromelain (EC 3.4.22.33) FB22 precu... 143 7e-33
gi|21483184|gb|AAF86584.1| cathepsin L cysteine protease [Haemon... 143 9e-33
gi|4210800|emb|CAA76927.1| thiol protease [Phaedon cochleariae] 143 9e-33
gi|33112583|gb|AAP94047.1| cathepsin-L-like cysteine peptidase 0... 143 9e-33
gi|7435827|pir||T10501 fruit bromelain (EC 3.4.22.33) FB13 precu... 142 1e-32
gi|7435828|pir||T10503 fruit bromelain (EC 3.4.22.33) FB18 precu... 142 1e-32
gi|30023547|gb|AAO48766.2| cathepsin L-like cysteine proteinase ... 142 1e-32
gi|7489849|pir||T10518 fruit bromelain (EC 3.4.22.33) FB1035 pre... 142 2e-32
gi|34905996|ref|NP_914345.1| putative cysteine proteinase [Oryza... 142 2e-32
gi|21483192|gb|AAL14224.1| cathepsin L [Haemonchus contortus] >g... 141 3e-32
gi|33112581|gb|AAP94046.1| cathepsin-L-like cysteine peptidase 0... 141 3e-32
gi|47086663|ref|NP_997853.1| Unknown (protein for MGC:85774); wu... 140 7e-32
gi|33945878|emb|CAE45589.1| papain-like cysteine proteinase-like... 139 1e-31
gi|41152717|dbj|BAD08222.1| cysteine protease 2 [Theileria orien... 139 1e-31
gi|47224192|emb|CAG13112.1| unnamed protein product [Tetraodon n... 139 2e-31
gi|18408828|ref|NP_566920.1| cysteine proteinase, putative [Arab... 138 3e-31
gi|100069|pir||S24602 cysteine proteinase tpp (EC 3.4.22.-) - ga... 138 3e-31
gi|17563798|ref|NP_507199.1| CathePsin L (38.1 kD) (cpl-1) [Caen... 138 3e-31
gi|2507252|sp|P14080|PAP2_CARPA Chymopapain precursor (Papaya pr... 137 4e-31
gi|18418684|ref|NP_567983.1| cysteine endopeptidase, papain-type... 137 4e-31
gi|37780047|gb|AAP32196.1| cysteine protease 8 [Trifolium repens] 137 4e-31
gi|6851030|emb|CAB71032.1| cysteine protease [Lolium multiflorum] 137 4e-31
gi|37732137|gb|AAR02406.1| cysteine proteinase [Anthonomus grandis] 137 5e-31
gi|25956267|dbj|BAC41322.1| unnamed protein product [Lotus corni... 137 5e-31
gi|461905|sp|Q05094|CYS2_LEIPI Cysteine proteinase 2 precursor (... 137 5e-31
gi|45822207|emb|CAE47500.1| cathepsin L-like proteinase [Diabrot... 137 6e-31
gi|18407961|ref|NP_566880.1| cysteine proteinase, putative [Arab... 137 6e-31
gi|14348750|emb|CAC41275.1| CPB2 protein [Leishmania mexicana] 137 6e-31
gi|630816|pir||S47433 cathepsin L (EC 3.4.22.15) - Norway lobste... 136 8e-31
gi|42564163|gb|AAS20593.1| digestive cysteine proteinase intesta... 136 8e-31
gi|7435824|pir||T07851 ananain (EC 3.4.22.31) precursor AN11 - p... 136 1e-30
gi|4469153|emb|CAB38314.1| chymopapain isoform II [Carica papaya] 135 1e-30
gi|5915887|sp|O17473|CATL_BRUPA Cathepsin L-like precursor >gnl|... 135 1e-30
gi|11265612|pir||T47471 cysteine proteinase (EC 3.4.22.-) F18N11... 135 1e-30
gi|39582386|emb|CAE74770.1| Hypothetical protein CBG22599 [Caeno... 135 1e-30
gi|17062058|gb|AAL34984.1| cathepsine L-like cysteine protease [... 135 2e-30
gi|39585483|emb|CAE70566.1| Hypothetical protein CBG17217 [Caeno... 135 2e-30
gi|14719319|gb|AAK73137.1| putative cysteine proteinase [Oryza s... 135 2e-30
gi|14349351|gb|AAC38832.2| cysteine protease [Leishmania donovan... 135 2e-30
gi|1730100|sp|P36400|LCPB_LEIME Cysteine proteinase B precursor ... 135 2e-30
gi|10336513|dbj|BAB13759.1| cysteine proteinase [Astragalus sini... 135 2e-30
gi|118117|sp|P04988|CYS1_DICDI Cysteine proteinase 1 precursor >... 135 2e-30
gi|37780051|gb|AAP32198.1| cysteine protease 12 [Trifolium repens] 135 2e-30
gi|7435801|pir||T06416 cysteine proteinase (EC 3.4.22.-) precurs... 135 2e-30
gi|15824691|gb|AAL09443.1| cysteine protease [Leishmania donovani] 134 3e-30
gi|478768|pir||S29245 cysteine proteinase (EC 3.4.22.-) precurso... 134 3e-30
gi|37780045|gb|AAP32195.1| cysteine protease 5 [Trifolium repens] 134 3e-30
gi|27728675|gb|AAO18731.1| cysteine protease [Gossypium hirsutum] 134 3e-30
gi|7435775|pir||JC5443 cathepsin L-like cysteine proteinase (EC ... 134 3e-30
gi|33333694|gb|AAQ11965.1| putative gut cathepsin L-like cystein... 134 4e-30
gi|2144501|pir||TAGB actinidain (EC 3.4.22.14) precursor - kiwi ... 134 4e-30
gi|46948154|gb|AAT07059.1| cathepsin F-like cysteine proteinase ... 134 4e-30
gi|13432122|sp|P80884|ANAN_ANACO Ananain precursor >gnl|BL_ORD_I... 134 4e-30
gi|46948150|gb|AAT07057.1| cathepsin L-like cysteine proteinase ... 134 4e-30
gi|113603|sp|P05167|ALEU_HORVU Thiol protease aleurain precursor... 134 5e-30
gi|535600|gb|AAA29137.1| cathepsin [Fasciola hepatica] 134 5e-30
gi|18420375|ref|NP_568052.1| cysteine proteinase RD19a (RD19A) /... 134 5e-30
gi|629792|pir||S47434 cysteine proteinase (EC 3.4.22.-) - rice >... 134 5e-30
gi|730035|sp|P16311|MMAL_DERFA Major mite fecal allergen Der f 1... 134 5e-30
gi|46401612|dbj|BAD16614.1| cysteine proteinase [Dianthus caryop... 134 5e-30
gi|10798511|emb|CAC12806.1| cathepsin L1 [Fasciola hepatica] 134 5e-30
gi|33333698|gb|AAQ11967.1| putative gut cathepsin L-like cystein... 133 7e-30
gi|22096273|gb|AAC17994.2| cysteine protease [Babesia equi] 133 7e-30
gi|46309423|ref|YP_006313.1| cathepsin [Agrotis segetum granulov... 133 7e-30
gi|23397070|gb|AAN31820.1| putative cysteine proteinase AALP [Ar... 133 7e-30
gi|18424347|ref|NP_568921.1| cysteine proteinase, putative / AAL... 133 7e-30
gi|2351107|dbj|BAA21929.1| bromelain [Ananas comosus] 133 7e-30
gi|17569349|ref|NP_509408.1| cysteine proteinase AALP (43.7 kD) ... 133 7e-30
gi|1491774|emb|CAA68192.1| cysteine protease [Zea mays] 133 9e-30
gi|1706261|sp|Q10717|CYS2_MAIZE Cysteine proteinase 2 precursor ... 133 9e-30
gi|33333708|gb|AAQ11972.1| putative gut cathepsin L-like cystein... 133 9e-30
gi|33333696|gb|AAQ11966.1| putative gut cathepsin L-like cystein... 133 9e-30
gi|33242884|gb|AAQ01146.1| cathepsin [Petromyzon marinus] 133 9e-30
gi|34329348|gb|AAQ63885.1| putative cysteine proteinase [Medicag... 133 9e-30
gi|18423124|ref|NP_568722.1| cysteine proteinase, putative [Arab... 133 9e-30
gi|14422331|emb|CAC41636.1| early leaf senescence abundant cyste... 133 9e-30
gi|945081|gb|AAC49361.1| P21 132 1e-29
gi|39588844|emb|CAE69474.1| Hypothetical protein CBG15672 [Caeno... 132 2e-29
gi|7435791|pir||T12041 cysteine proteinase (EC 3.4.22.-) 3 precu... 132 2e-29
gi|33333702|gb|AAQ11969.1| putative gut cathepsin L-like cystein... 132 2e-29
gi|2780176|emb|CAA71085.1| cystein proteinase [Leishmania mexicana] 132 2e-29
gi|18141287|gb|AAL60581.1| senescence-associated cysteine protea... 132 2e-29
gi|12744965|gb|AAK06862.1| actinidin protease [Actinidia chinensis] 132 2e-29
gi|113285|sp|P00785|ACTN_ACTCH Actinidain precursor (Actinidin) ... 132 2e-29
gi|31322338|gb|AAP20039.1| vivapain 2 [Plasmodium vivax] 132 2e-29
gi|30141019|dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus] 132 2e-29
gi|1361974|pir||S57776 cysteine proteinase (EC 3.4.22.-) - clove... 132 2e-29
gi|4469155|emb|CAB38315.1| chymopapain isoform III [Carica papaya] 132 2e-29
gi|7435779|pir||S71923 cysteine proteinase (EC 3.4.22.-) - garde... 132 2e-29
gi|33945877|emb|CAE45588.1| papain-like cysteine proteinase-like... 132 2e-29
gi|47606538|gb|AAT36253.1| vivapain-2 [Plasmodium vivax] >gnl|BL... 132 2e-29
gi|47606558|gb|AAT36263.1| vivapain-2 [Plasmodium vivax] 132 2e-29
gi|47606560|gb|AAT36264.1| vivapain-2 [Plasmodium vivax] 132 2e-29
gi|47606518|gb|AAT36243.1| vivapain-2 [Plasmodium vivax] >gnl|BL... 132 2e-29
gi|33333704|gb|AAQ11970.1| putative gut cathepsin L-like cystein... 132 2e-29
gi|21593213|gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsi... 132 2e-29
gi|47524507|gb|AAT34987.1| putative cysteine protease [Gossypium... 132 2e-29
gi|535454|gb|AAA50755.1| cysteine proteinase 132 2e-29
gi|67656|pir||KHBH aleurain (EC 3.4.22.-) precursor - barley 132 2e-29
gi|1749812|emb|CAA90237.1| cysteine proteinase LmCPB1 [Leishmani... 132 2e-29
gi|129233|sp|P25778|ORYC_ORYSA Oryzain gamma chain precursor >gn... 131 3e-29
gi|30141025|dbj|BAC75926.1| cysteine protease-4 [Helianthus annuus] 131 3e-29
gi|33333712|gb|AAQ11974.1| putative gut cathepsin L-like cystein... 131 3e-29
gi|33333706|gb|AAQ11971.1| putative gut cathepsin L-like cystein... 131 3e-29
gi|28971811|dbj|BAC65417.1| crustapain [Pandalus borealis] 131 3e-29
gi|2499879|sp|Q40143|CYS3_LYCES Cysteine proteinase 3 precursor ... 131 3e-29
gi|27530349|dbj|BAC53948.1| Der f 1 allergen preproenzyme [Derma... 131 3e-29
gi|1173630|gb|AAB37233.1| cysteine proteinase 131 3e-29
gi|50355623|dbj|BAD29960.1| cysteine protease [Daucus carota] 131 3e-29
gi|17569299|ref|NP_509736.1| cathepsin L-like cysteine proteinas... 131 3e-29
gi|8347420|dbj|BAA96501.1| cysteine protease [Nicotiana tabacum] 131 3e-29
gi|45822201|emb|CAE47497.1| cathepsin L-like proteinase [Diabrot... 131 3e-29
gi|18141289|gb|AAL60582.1| senescence-associated cysteine protea... 131 3e-29
gi|50657027|emb|CAH04631.1| cathepsin H [Suberites domuncula] 131 3e-29
gi|7435773|pir||S71773 cysteine proteinase (EC 3.4.22.-) precurs... 130 4e-29
gi|8547325|gb|AAF76330.1| cathepsin L [Fasciola hepatica] 130 4e-29
gi|31240547|ref|XP_320687.1| ENSANGP00000020002 [Anopheles gambi... 130 4e-29
gi|18403438|ref|NP_565780.1| cysteine proteinase, putative [Arab... 130 4e-29
gi|20136379|gb|AAM11647.1| cathepsin L [Fasciola hepatica] 130 4e-29
gi|22759715|dbj|BAC10906.1| cysteine proteinase [Zinnia elegans] 130 6e-29
gi|13491750|gb|AAK27968.1| cysteine protease [Ipomoea batatas] 130 6e-29
gi|7271891|gb|AAF44676.1| cathepsin L [Fasciola gigantica] 130 6e-29
gi|12597541|ref|NP_075125.1| cathepsin [Heliocoverpa armigera nu... 130 6e-29
gi|7435798|pir||T06206 probable cysteine proteinase (EC 3.4.22.-... 130 6e-29
gi|129231|sp|P25776|ORYA_ORYSA Oryzain alpha chain precursor >gn... 130 6e-29
gi|228245|prf||1801240C Cys protease 3 130 6e-29
gi|37963625|gb|AAP94048.2| cathepsin-L-like midgut cysteine prot... 130 6e-29
gi|38346007|emb|CAD40110.2| OSJNBa0035O13.9 [Oryza sativa (japon... 130 6e-29
gi|18141281|gb|AAL60578.1| senescence-associated cysteine protea... 130 8e-29
gi|15824693|gb|AAL09444.1| cysteine protease [Leishmania donovani] 130 8e-29
gi|41152538|gb|AAR99518.1| cathepsin L protein [Fasciola hepatica] 130 8e-29
gi|5853329|gb|AAD54424.1| thiol protease [Matricaria chamomilla] 130 8e-29
gi|44844204|emb|CAF32698.1| cysteine proteinase [Leishmania infa... 130 8e-29
gi|10441624|gb|AAG17127.1| cathepsin L-like cysteine proteinase ... 130 8e-29
gi|5081735|gb|AAD39513.1| cathepsin L-like protease precursor [A... 130 8e-29
gi|18399697|ref|NP_565512.1| cysteine proteinase A494, putative ... 130 8e-29
gi|21070926|gb|AAM34401.1| putative cysteine proteinase [Oryza s... 130 8e-29
gi|33348834|gb|AAQ16117.1| cathepsin L-like cysteine proteinase ... 129 1e-28
gi|30690594|ref|NP_564321.2| peptidase C1A papain family protein... 129 1e-28
gi|27681979|ref|XP_225125.1| similar to cathepsin 1 precursor [R... 129 1e-28
gi|7435820|pir||T10514 probable stem bromelain (EC 3.4.22.32) pr... 129 1e-28
gi|39583812|emb|CAE74885.1| Hypothetical protein CBG22748 [Caeno... 129 1e-28
gi|600111|emb|CAA84378.1| cysteine proteinase [Vicia sativa] 129 1e-28
gi|321019|pir||S19651 cysteine proteinase (EC 3.4.22.-) precurso... 129 1e-28
gi|25289991|pir||D86413 cysteine proteinase (EC 3.4.22.-) [simil... 129 1e-28
gi|542004|pir||S42882 cysteine proteinase (EC 3.4.22.-) precurso... 129 1e-28
gi|40806498|gb|AAR92154.1| putative cysteine protease 1 [Iris ho... 129 1e-28
gi|39581574|emb|CAE58359.1| Hypothetical protein CBG01480 [Caeno... 129 1e-28
gi|33242880|gb|AAQ01144.1| cathepsin [Branchiostoma lanceolatum] 129 2e-28
gi|33242872|gb|AAQ01140.1| cathepsin [Branchiostoma lanceolatum] 129 2e-28
gi|630489|pir||S43991 cathepsin L-like proteinases (EC 3.4.22.-)... 129 2e-28
gi|45738078|gb|AAS75836.1| fastuosain precursor [Bromelia fastuosa] 129 2e-28
gi|17224950|gb|AAL37181.1| cathepsin L-like protease [Ancylostom... 129 2e-28
gi|18396939|ref|NP_564320.1| peptidase C1A papain family protein... 129 2e-28
gi|6649575|gb|AAF21461.1| cysteine proteinase PWCP1 [Paragonimus... 129 2e-28
gi|13774082|gb|AAK38169.1| cathepsin L-like [Fasciola hepatica] 129 2e-28
gi|627141|pir||A61500 allergen Der f I precursor - house-dust mi... 128 2e-28
gi|18138384|ref|NP_542680.1| cathepsin [Helicoverpa zea single n... 128 2e-28
gi|28192371|gb|AAK07729.1| NTCP23-like cysteine proteinase [Nico... 128 2e-28
gi|4574304|gb|AAD23996.1| cathepsin [Fasciola gigantica] 128 2e-28
gi|27413319|gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba] 128 2e-28
gi|1401242|gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba] 128 2e-28
gi|6682829|dbj|BAA88898.1| cysteine protease component of protea... 128 2e-28
gi|11055|emb|CAA45129.1| cysteine proteinase preproenzyme [Homar... 128 2e-28
gi|10241433|emb|CAC09354.1| putative oryzain alpha precursor [Or... 128 2e-28
gi|118125|sp|P25784|CYS3_HOMAM Digestive cysteine proteinase 3 p... 128 2e-28
gi|7211745|gb|AAF40416.1| papain-like cysteine proteinase isofor... 128 2e-28
gi|516865|emb|CAA52403.1| putative thiol protease [Arabidopsis t... 128 3e-28
gi|17978641|gb|AAL48319.1| vinckepain-2 [Plasmodium vinckei] 128 3e-28
gi|1809286|gb|AAB41670.1| secreted cathepsin L 1 [Fasciola hepat... 128 3e-28
gi|33333700|gb|AAQ11968.1| putative gut cathepsin L-like cystein... 128 3e-28
gi|7271889|gb|AAF44675.1| cathepsin L [Fasciola gigantica] 128 3e-28
gi|7271893|gb|AAF44677.1| cathepsin L [Fasciola gigantica] 128 3e-28
gi|1169186|sp|P43156|CYSP_HEMSP Thiol protease SEN102 precursor ... 128 3e-28
gi|21263041|gb|AAM44832.1| cathepsin L2 [Fasciola gigantica] 128 3e-28
gi|7435822|pir||T07840 ananain (EC 3.4.22.31) AN8 precursor - pi... 128 3e-28
gi|6978721|ref|NP_037071.1| cathepsin H [Rattus norvegicus] >gnl... 128 3e-28
gi|7106279|ref|NP_031827.1| cathepsin H; Cat H [Mus musculus] >g... 128 3e-28
gi|28932706|gb|AAO60047.1| midgut cysteine proteinase 4 [Rhipice... 128 3e-28
gi|12024965|gb|AAG45727.1| cathepsin L-like cysteine protease [L... 128 3e-28
gi|34899394|ref|NP_911043.1| putative cysteine proteinase [Oryza... 127 4e-28
gi|33242874|gb|AAQ01141.1| cathepsin [Branchiostoma lanceolatum] 127 4e-28
gi|50355611|dbj|BAD29954.1| cysteine protease [Daucus carota] 127 4e-28
gi|47522632|ref|NP_999094.1| cathepsin H [Sus scrofa] >gnl|BL_OR... 127 4e-28
gi|7435806|pir||T01207 cysteine proteinase mir3 (EC 3.4.22.-) - ... 127 5e-28
gi|50355613|dbj|BAD29955.1| cysteine protease [Daucus carota] 127 5e-28
gi|18141283|gb|AAL60579.1| senescence-associated cysteine protea... 127 6e-28
gi|30141021|dbj|BAC75924.1| cysteine protease-2 [Helianthus annuus] 127 6e-28
gi|34559455|gb|AAQ75437.1| cathepsin L-like protease [Helicoverp... 127 6e-28
gi|18422289|ref|NP_568620.1| cysteine proteinase, putative / thi... 127 6e-28
gi|33333710|gb|AAQ11973.1| putative gut cathepsin L-like cystein... 127 6e-28
gi|38045864|gb|AAR08900.1| cathepsin L [Fasciola gigantica] 127 6e-28
gi|7381219|gb|AAF61440.1| papain-like cysteine proteinase isofor... 127 6e-28
gi|7211741|gb|AAF40414.1| papain-like cysteine proteinase isofor... 127 6e-28
gi|18141285|gb|AAL60580.1| senescence-associated cysteine protea... 127 6e-28
gi|7435797|pir||T06208 cysteine proteinase (EC 3.4.22.-) - barle... 127 6e-28
gi|4100157|gb|AAD10337.1| cysteine proteinase precursor [Hordeum... 127 6e-28
gi|129614|sp|P00784|PAPA_CARPA Papain precursor (Papaya proteina... 127 6e-28
gi|20334377|gb|AAM19209.1| cysteine protease [Lycopersicon escul... 127 6e-28
gi|4731374|gb|AAD28477.1| papain-like cysteine protease [Sanders... 127 6e-28
gi|50313163|gb|AAT74529.1| toxopain-2 [Toxoplasma gondii] 127 6e-28
gi|6650705|gb|AAF21977.1| thiolproteinase SmTP1 [Sarcocystis muris] 126 8e-28
gi|3688528|emb|CAA06243.1| pre-pro-TPE4A protein [Pisum sativum] 126 8e-28
gi|37788267|gb|AAO64473.1| cathepsin H precursor [Fundulus heter... 126 8e-28
gi|118120|sp|P25249|CYS1_HORVU Cysteine proteinase EP-B 1 precur... 126 8e-28
gi|20334375|gb|AAM19208.1| cysteine protease [Lycopersicon penne... 126 8e-28
gi|24285904|gb|AAL14199.1| cysteine proteinase precursor [Ipomoe... 126 1e-27
gi|33242878|gb|AAQ01143.1| cathepsin [Branchiostoma lanceolatum] 126 1e-27
gi|31558997|gb|AAP49831.1| cathepsin L [Fasciola hepatica] 126 1e-27
gi|2239107|emb|CAA70693.1| cathepsin L-like cysteine proteinase ... 126 1e-27
gi|7211743|gb|AAF40415.1| papain-like cysteine proteinase isofor... 126 1e-27
gi|5823020|gb|AAD53012.1| senescence-specific cysteine protease ... 125 1e-27
gi|7381221|gb|AAF61441.1| papain-like cysteine proteinase isofor... 125 1e-27
gi|38344381|emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa (japon... 125 1e-27
gi|40556818|gb|AAR87763.1| fibroinase precursor [Bombyx mori] 125 2e-27
gi|21953244|emb|CAD42716.1| putative cathepsin L [Myzus persicae] 125 2e-27
gi|33242876|gb|AAQ01142.1| cathepsin [Branchiostoma lanceolatum] 125 2e-27
gi|118150|sp|P25804|CYSP_PEA Cysteine proteinase 15A precursor (... 125 2e-27
gi|24654434|ref|NP_725686.1| CG4847-PD [Drosophila melanogaster]... 125 2e-27
gi|34146988|gb|AAB65956.2| Hypothetical protein F41E6.6 [Caenorh... 125 2e-27
gi|19922450|ref|NP_611221.1| CG4847-PA [Drosophila melanogaster]... 125 2e-27
gi|7435793|pir||T09528 probable cysteine proteinase (EC 3.4.22.-... 125 2e-27
gi|118124|sp|P25250|CYS2_HORVU Cysteine proteinase EP-B 2 precur... 125 2e-27
gi|33333714|gb|AAQ11975.1| putative gut cathepsin L-like cystein... 125 2e-27
gi|18394919|ref|NP_564126.1| cysteine endopeptidase, papain-type... 125 2e-27
gi|44844206|emb|CAF32699.1| cathepsin L-like cysteine proteinase... 125 2e-27
gi|33242870|gb|AAQ01139.1| cathepsin [Branchiostoma lanceolatum] 124 3e-27
gi|203341|gb|AAA63484.1| cathepsin H 124 3e-27
gi|31096290|gb|AAP43630.1| chabaupain-2 [Plasmodium chabaudi cha... 124 3e-27
gi|28974202|gb|AAO61485.1| cathepsin H [Sterkiella histriomuscorum] 124 3e-27
gi|40806500|gb|AAR92155.1| putative cysteine protease 2 [Iris ho... 124 3e-27
gi|33242882|gb|AAQ01145.1| cathepsin [Branchiostoma lanceolatum] 124 4e-27
gi|1483570|emb|CAA68066.1| cathepsin l [Litopenaeus vannamei] 124 4e-27
gi|20334373|gb|AAM19207.1| cysteine protease [Lycopersicon pimpi... 124 4e-27
gi|28971813|dbj|BAC65418.1| cathepsin L [Pandalus borealis] 124 4e-27
gi|21264388|sp|P09668|CATH_HUMAN Cathepsin H precursor >gnl|BL_O... 124 4e-27
gi|38345008|emb|CAD40026.2| OSJNBa0052O21.11 [Oryza sativa (japo... 124 5e-27
gi|46251290|gb|AAS84611.1| cathepsin L-like cysteine proteinase ... 124 5e-27
gi|24644153|ref|NP_649521.1| CG12163-PB [Drosophila melanogaster... 124 5e-27
gi|67653|pir||KHHUH cathepsin H (EC 3.4.22.16) precursor [valida... 124 5e-27
gi|24644155|ref|NP_730901.1| CG12163-PA [Drosophila melanogaster... 124 5e-27
gi|39588173|emb|CAE68098.1| Hypothetical protein CBG13738 [Caeno... 123 7e-27
gi|7435790|pir||T12382 cysteine proteinase (EC 3.4.22.-) - commo... 123 7e-27
gi|37780041|gb|AAP32193.1| cysteine protease 14 [Trifolium repens] 123 7e-27
gi|13905172|gb|AAH06878.1| Cathepsin H [Mus musculus] 123 7e-27
gi|45822205|emb|CAE47499.1| cathepsin L-like proteinase [Diabrot... 123 7e-27
gi|47076309|emb|CAD89795.1| putative cathepsin L protease [Meloi... 123 7e-27
gi|46395620|sp|O65039|CYSP_RICCO Vignain precursor (Cysteine end... 123 9e-27
gi|1353726|gb|AAB01769.1| cysteine proteinase homolog 123 9e-27
gi|19909509|dbj|BAB86959.1| cathepsin L [Fasciola gigantica] 123 9e-27
gi|3941390|gb|AAC82352.1| group 1 allergen Eur m 1 0102 [Eurogly... 123 9e-27
gi|37780039|gb|AAP32192.1| cysteine protease 14 [Trifolium repens] 123 9e-27
gi|4503155|ref|NP_001903.1| cathepsin L preproprotein; major exc... 123 9e-27
gi|15214962|gb|AAH12612.1| Cathepsin L, preproprotein [Homo sapi... 123 9e-27
gi|1709574|sp|P10056|PAP3_CARPA Caricain precursor (Papaya prote... 123 9e-27
gi|14517542|gb|AAK62661.1| F2G19.31/F2G19.31 [Arabidopsis thalia... 123 9e-27
gi|18401614|ref|NP_564497.1| cysteine proteinase (RD21A) / thiol... 123 9e-27
gi|228244|prf||1801240B Cys protease 2 122 1e-26
gi|26245875|gb|AAN77413.1| digestive cysteine protease intestain... 122 1e-26
gi|50355615|dbj|BAD29956.1| cysteine protease [Daucus carota] 122 1e-26
gi|50762389|ref|XP_425038.1| PREDICTED: similar to cathepsin L p... 122 1e-26
gi|38345906|emb|CAE04498.2| OSJNBb0059K02.8 [Oryza sativa (japon... 122 1e-26
gi|13928758|ref|NP_113748.1| cathepsin K [Rattus norvegicus] >gn... 122 1e-26
gi|50355619|dbj|BAD29958.1| cysteine protease [Daucus carota] 122 1e-26
gi|50355621|dbj|BAD29959.1| cysteine protease [Daucus carota] 122 1e-26
gi|630486|pir||S44151 cathepsin L (EC 3.4.22.15) - fluke (Schist... 122 1e-26
gi|48145879|emb|CAG33162.1| CTSH [Homo sapiens] 122 1e-26
gi|23110955|ref|NP_004381.2| cathepsin H isoform a preproprotein... 122 1e-26
gi|1223922|gb|AAA92063.1| cysteinyl endopeptidase [Vigna radiata] 122 2e-26
gi|445927|prf||1910332A Cys endopeptidase 122 2e-26
gi|1809288|gb|AAC47721.1| secreted cathepsin L 2 [Fasciola hepat... 122 2e-26
gi|23110957|ref|NP_683880.1| cathepsin H isoform b precursor; al... 122 2e-26
gi|30387350|ref|NP_848429.1| cathepsin [Choristoneura fumiferana... 122 2e-26
gi|1185459|gb|AAA87849.1| preprocathepsin cathepsin L 122 2e-26
gi|11493685|gb|AAG35605.1| cysteine protease [Cercopithecus aeth... 122 2e-26
gi|16506813|gb|AAL23961.1| cathepsin H [Homo sapiens] 122 2e-26
gi|19909511|dbj|BAB86960.1| cathepsin L [Fasciola gigantica] 122 2e-26
gi|118123|sp|P25782|CYS2_HOMAM Digestive cysteine proteinase 2 p... 122 2e-26
gi|4757570|gb|AAD29084.1| cysteine proteinase precursor [Solanum... 122 2e-26
gi|5051468|emb|CAB44983.1| putative preprocysteine proteinase [N... 122 2e-26
gi|16506815|gb|AAL23962.1| truncated cathepsin H [Homo sapiens] 122 2e-26
gi|42407296|dbj|BAD10859.1| cysteine protease [Aster tripolium] 122 2e-26
gi|23344734|gb|AAN28680.1| cathepsin L [Theromyzon tessulatum] 122 2e-26
gi|32394728|gb|AAM96000.1| cathepsin L precursor [Metapenaeus en... 122 2e-26
gi|7242888|dbj|BAA92495.1| cysteine protease [Vigna mungo] 122 2e-26
gi|32394730|gb|AAM96001.1| cathepsin L precursor [Metapenaeus en... 122 2e-26
gi|42407937|dbj|BAD09076.1| putative cysteine proteinase [Oryza ... 122 2e-26
gi|21425246|emb|CAD33266.1| cathepsin L [Aphis gossypii] 121 3e-26
gi|24653516|ref|NP_725347.1| CG6692-PA [Drosophila melanogaster]... 121 3e-26
gi|23110960|ref|NP_001324.2| cathepsin L2 preproprotein; catheps... 121 3e-26
gi|3087790|emb|CAA75029.1| cathepsin L2 [Homo sapiens] 121 3e-26
gi|1848231|gb|AAB48120.1| cathepsin L-like protease [Leishmania ... 121 3e-26
gi|28192375|gb|AAK07731.1| CPR2-like cysteine proteinase [Nicoti... 121 3e-26
gi|18408616|ref|NP_566901.1| cysteine proteinase, putative [Arab... 121 3e-26
gi|25289998|pir||JC7787 carrot seed cysteine proteinase (EC 3.4.... 121 3e-26
gi|50761194|ref|XP_418273.1| PREDICTED: similar to Cathepsin L, ... 121 3e-26
gi|50355617|dbj|BAD29957.1| cysteine protease [Daucus carota] 121 3e-26
gi|24653514|ref|NP_523735.2| CG6692-PC [Drosophila melanogaster]... 121 3e-26
gi|118158|sp|P12412|CYSP_VIGMU Vignain precursor (Bean endopepti... 121 4e-26
gi|7435809|pir||T06529 cysteine proteinase (EC 3.4.22.-) - garde... 121 4e-26
gi|7435794|pir||T12039 cysteine proteinase (EC 3.4.22.-) 1 precu... 121 4e-26
gi|8917581|gb|AAF81277.1| EPCS68 [Mus musculus] >gnl|BL_ORD_ID|4... 121 4e-26
gi|46358368|ref|NP_062414.2| cathepsin 8; ectoplacental cone, in... 121 4e-26
gi|14424447|sp|P25780|EUM1_EURMA Mite group 1 allergen Eur m 1 p... 121 4e-26
gi|1085124|pir||JX0366 cysteine endopeptidase (EC 3.4.22.-) prec... 121 4e-26
gi|100203|pir||S24988 cysteine proteinase (EC 3.4.22.-) precurso... 121 4e-26
gi|5777889|emb|CAB53515.1| cysteine protease [Solanum tuberosum] 121 4e-26
gi|1706260|sp|Q10716|CYS1_MAIZE Cysteine proteinase 1 precursor ... 121 4e-26
gi|7435795|pir||T12040 cysteine proteinase (EC 3.4.22.-) 2 precu... 120 5e-26
gi|21666724|gb|AAM73806.1| cysteine proteinase [Brassica napus] ... 120 5e-26
gi|11265608|pir||T46630 cysteine proteinase (EC 3.4.22.-) 1 prec... 120 5e-26
gi|18422605|ref|NP_568651.1| senescence-specific SAG12 protein (... 120 5e-26
gi|30141023|dbj|BAC75925.1| cysteine protease-3 [Helianthus annuus] 120 5e-26
gi|5761329|dbj|BAA83473.1| cysteine endopeptidase [Oryza sativa]... 120 5e-26
gi|9634237|ref|NP_037776.1| ORF16 cathepsin [Spodoptera exigua n... 120 5e-26
gi|37651368|ref|NP_932731.1| cathepsin [Choristoneura fumiferana... 120 6e-26
gi|23110964|ref|NP_001326.2| cathepsin W preproprotein; lymphopa... 120 6e-26
gi|23956098|ref|NP_062412.1| cathepsin 7; ectoplacental cone, in... 120 6e-26
gi|129232|sp|P25777|ORYB_ORYSA Oryzain beta chain precursor >gnl... 120 6e-26
gi|13491752|gb|AAK27969.1| cysteine protease [Ipomoea batatas] 120 6e-26
gi|8917575|gb|AAF81274.1| EPCS24 [Mus musculus] 120 6e-26
gi|7381610|gb|AAF61565.1| cathepsin L-like proteinase precursor ... 120 8e-26
gi|7435780|pir||T09259 cathepsin L-like proteinase (EC 3.4.22.-)... 120 8e-26
gi|22653681|sp|Q9TST1|CATW_FELCA Cathepsin W precursor 120 8e-26
gi|29165304|gb|AAO65603.1| cathepsin L precursor [Hydra vulgaris] 120 8e-26
gi|15290508|gb|AAK92229.1| cysteine proteinase [Arabidopsis thal... 120 8e-26
gi|730036|sp|P08176|MMAL_DERPT Major mite fecal allergen Der p 1... 120 8e-26
gi|30141027|dbj|BAC75927.1| cysteine protease-5 [Helianthus annuus] 120 8e-26
gi|31982433|ref|NP_031828.2| cathepsin K; Cat K; minisatellite 1... 120 8e-26
gi|7435774|pir||S22502 cysteine proteinase (EC 3.4.22.-) - kidne... 119 1e-25
gi|15234557|ref|NP_195406.1| cysteine proteinase, putative [Arab... 119 1e-25
gi|33520126|gb|AAQ21040.1| cathepsin L precursor [Branchiostoma ... 119 1e-25
gi|17543258|ref|NP_502836.1| cysteine precursor (4P968) [Caenorh... 119 1e-25
gi|7435777|pir||JC5442 cathepsin L-like cysteine proteinase (EC ... 119 1e-25
gi|5823018|gb|AAD53011.1| senescence-specific cysteine protease ... 119 1e-25
gi|3097321|dbj|BAA25899.1| Bd 30K [Glycine max] 119 1e-25
gi|7435811|pir||T06708 cysteine proteinase (EC 3.4.22.-) T29H11.... 119 1e-25
gi|1345573|emb|CAA40073.1| endopeptidase (EP-C1) [Phaseolus vulg... 119 1e-25
gi|15826035|pdb|1FH0|A Chain A, Crystal Structure Of Human Cathe... 119 1e-25
gi|32488398|emb|CAE02823.1| OSJNBa0043A12.28 [Oryza sativa (japo... 119 1e-25
gi|1709576|sp|P05994|PAP4_CARPA Papaya proteinase IV precursor (... 119 1e-25
gi|544129|sp|P25803|CYSP_PHAVU Vignain precursor (Bean endopepti... 119 1e-25
gi|9635308|ref|NP_059206.1| ORF58 [Xestia c-nigrum granulovirus]... 119 1e-25
gi|46948152|gb|AAT07058.1| cathepsin L-like cysteine proteinase ... 119 1e-25
gi|16304178|gb|AAL16954.1| cathepsin L-like cysteine protease pr... 119 1e-25
gi|23508353|ref|NP_701022.1| falcipain-3 [Plasmodium falciparum ... 119 2e-25
gi|50539796|ref|NP_001002368.1| zgc:92089 [Danio rerio] >gnl|BL_... 119 2e-25
gi|5822035|pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L 119 2e-25
gi|17978639|gb|AAL48318.1| berghepain-2 [Plasmodium berghei] 119 2e-25
gi|2392232|pdb|1CJL| Crystal Structure Of A Cysteine Protease P... 119 2e-25
gi|49671274|gb|AAH75275.1| Unknown (protein for MGC:88904) [Xeno... 119 2e-25
gi|15617524|ref|NP_258322.1| cathepsin-like cysteine proteinase ... 119 2e-25
gi|47086859|ref|NP_997749.1| cathepsin L, a; ik:tdsubc_2d2; xx:t... 119 2e-25
gi|8050826|gb|AAF71757.1| cysteine protease falcipain-3; PCP2 [P... 119 2e-25
gi|22549430|ref|NP_689203.1| putative cysteine proteinase [Mames... 118 2e-25
gi|9630063|ref|NP_046281.1| cathepsin [Orgyia pseudotsugata mult... 118 2e-25
gi|2829471|sp|P56202|CATW_HUMAN Cathepsin W precursor (Lymphopai... 118 2e-25
gi|50418223|gb|AAH77285.1| Unknown (protein for MGC:80097) [Xeno... 118 2e-25
gi|419782|pir||S30150 cysteine proteinase (EC 3.4.22.-) precurso... 118 2e-25
gi|7435776|pir||JC5441 cathepsin L-like cysteine proteinase (EC ... 118 2e-25
gi|13242029|gb|AAK16515.1| cathepsin L-like cysteine proteinase ... 118 2e-25
gi|31206163|ref|XP_312033.1| ENSANGP00000022503 [Anopheles gambi... 118 2e-25
gi|7435778|pir||S74227 cathepsin K (EC 3.4.22.-) precursor - mou... 118 2e-25
gi|31206165|ref|XP_312034.1| ENSANGP00000018713 [Anopheles gambi... 118 2e-25
gi|20069912|ref|NP_613116.1| cathepsin [Mamestra configurata nuc... 118 2e-25
gi|161879|gb|AAA98600.1| cathepsin L-like cysteine protease 118 3e-25
gi|38346003|emb|CAD40112.2| OSJNBa0035O13.5 [Oryza sativa (japon... 118 3e-25
gi|17560860|ref|NP_505215.1| cysteine proteinase PWCP1 precursor... 118 3e-25
gi|9631045|ref|NP_047715.1| cathepsin-like proteinase [Lymantria... 118 3e-25
gi|2245510|gb|AAB62536.1| cysteine protease [Dirofilaria immitis] 118 3e-25
gi|41688064|dbj|BAD08618.1| cathepsin L preproprotein [Cyprinus ... 118 3e-25
gi|1085687|pir||S53027 cathepsin L (EC 3.4.22.15) precursor - pe... 117 4e-25
gi|38345300|emb|CAE02828.2| OSJNBa0043A12.33 [Oryza sativa (japo... 117 4e-25
gi|419781|pir||S30149 cysteine proteinase (EC 3.4.22.-) precurso... 117 4e-25
gi|2351557|gb|AAB68595.1| cathepsin [Choristoneura fumiferana MNPV] 117 4e-25
gi|37077647|sp|Q91CL9|CATV_NPVAP Viral cathepsin (V-cath) (Cyste... 117 4e-25
gi|7435799|pir||T06207 cysteine proteinase (EC 3.4.22.-) - barle... 117 4e-25
gi|33242865|gb|AAQ01137.1| cathepsin [Branchiostoma lanceolatum] 117 4e-25
gi|545734|gb|AAB30089.1| cysteine protease [Fasciola sp.] >gnl|B... 117 4e-25
gi|34761156|gb|AAQ81938.1| cysteine proteinase precursor [Ipomoe... 117 4e-25
gi|13897890|gb|AAK48495.1| putative cysteine protease [Ipomoea b... 117 4e-25
gi|41055305|ref|NP_956686.1| hypothetical protein MGC64209 [Dani... 117 5e-25
gi|15705865|gb|AAL05851.1| cysteine proteinase precursor [Sander... 117 5e-25
gi|23485822|gb|EAA20588.1| cysteine proteinase precursor [Plasmo... 117 5e-25
gi|4426617|gb|AAD20453.1| cysteine endopeptidase precursor [Oryz... 117 7e-25
gi|30017423|ref|NP_835199.1| testin [Mus musculus] >gnl|BL_ORD_I... 117 7e-25
gi|1834307|dbj|BAA09820.1| cysteine proteinase [Spirometra erina... 117 7e-25
gi|47523662|ref|NP_999467.1| cathepsin K precursor [Sus scrofa] ... 117 7e-25
gi|537437|gb|AAC35211.1| cysteine proteinase [Hemerocallis hybri... 117 7e-25
gi|28194643|gb|AAO33583.1| cathepsin P [Meriones unguiculatus] 116 9e-25
gi|47497527|dbj|BAD19579.1| putative cysteine proteinase 1 precu... 116 9e-25
gi|7435804|pir||T03694 cysteine proteinase (EC 3.4.22.-) - rice ... 116 9e-25
gi|7770062|ref|NP_036137.1| cathepsin J; rat gene/Cathepsin L-re... 116 9e-25
gi|2677828|gb|AAB97142.1| cysteine protease [Prunus armeniaca] 116 9e-25
gi|15128493|dbj|BAB62718.1| plerocercoid growth factor/cysteine ... 116 9e-25
gi|1168794|sp|P43236|CATK_RABIT Cathepsin K precursor (OC-2 prot... 116 9e-25
gi|33348836|gb|AAQ16118.1| cathepsin L-like cysteine proteinase ... 116 9e-25
gi|29840885|gb|AAP05886.1| similar to GenBank Accession Number A... 116 1e-24
gi|18913076|gb|AAL79510.1| granule-biosynthesis induced protease... 116 1e-24
gi|22653679|sp|Q26636|CATL_SARPE Cathepsin L precursor >gnl|BL_O... 115 1e-24
gi|18402225|ref|NP_566633.1| cysteine proteinase, putative / thi... 115 1e-24
gi|4581057|gb|AAD24589.1| cysteine protease [Trypanosoma congole... 115 1e-24
gi|7271897|gb|AAF44679.1| cathepsin L [Fasciola gigantica] 115 1e-24
gi|27681673|ref|XP_225126.1| similar to cathepsin 1 precursor [R... 115 1e-24
gi|2829472|sp|P56203|CATW_MOUSE Cathepsin W precursor (Lymphopai... 115 1e-24
gi|31981819|ref|NP_034115.2| cathepsin W preproprotein [Mus musc... 115 1e-24
gi|31559530|dbj|BAC77523.1| cysteine proteinase [Glycine max] >g... 115 2e-24
gi|950240|gb|AAC47033.1| cysteine proteinase 115 2e-24
gi|2118132|pir||JC4848 cysteine proteinase (EC 3.4.22.-) - Dougl... 115 2e-24
gi|13124026|sp|Q9WGE0|CATV_NPVHC Viral cathepsin (V-cath) (Cyste... 115 2e-24
gi|27497538|gb|AAO13009.1| cathepsin S preproprotein [Canis fami... 115 2e-24
gi|24583376|ref|NP_609387.1| CG5367-PA [Drosophila melanogaster]... 115 2e-24
gi|7239343|gb|AAF43193.1| cathepsin L [Stylonychia lemnae] 115 2e-24
gi|34861419|ref|XP_341988.1| similar to cathepsin F [Rattus norv... 115 2e-24
gi|39930363|ref|NP_058817.1| cathepsin J; cathepsin P [Rattus no... 115 3e-24
gi|34912626|ref|NP_917660.1| putative cysteine proteinase [Oryza... 115 3e-24
gi|7435805|pir||T01206 cysteine proteinase mir2 (EC 3.4.22.-) - ... 115 3e-24
gi|1199563|gb|AAB09252.1| 34 kDa maturing seed vacuolar thiol pr... 115 3e-24
gi|18391078|ref|NP_563855.1| cysteine protease, papain-like (XBC... 115 3e-24
gi|14600257|gb|AAK71314.1| papain-like cysteine peptidase XBCP3 ... 115 3e-24
gi|49522051|gb|AAH74718.1| Unknown (protein for MGC:69486) [Xeno... 115 3e-24
gi|9845246|ref|NP_063914.1| cathepsin F; cathepsin F precursor [... 115 3e-24
gi|11066228|gb|AAG28508.1| cathepsin F [Mus musculus] 115 3e-24
gi|4826565|emb|CAB42884.1| cathepsin F [Mus musculus] 115 3e-24
gi|13242025|gb|AAK16513.1| cathepsin L-like cysteine proteinase ... 114 3e-24
gi|6630972|gb|AAF19630.1| cysteine proteinase precursor [Myxine ... 114 3e-24
gi|30575716|gb|AAP33050.1| cysteine proteinase 3 [Clonorchis sin... 114 3e-24
gi|129353|sp|P22895|P34_SOYBN P34 probable thiol protease precur... 114 3e-24
gi|2765358|emb|CAA74241.1| cathepsin L [Litopenaeus vannamei] 114 3e-24
gi|81542|pir||S02728 actinidain (EC 3.4.22.14) precursor (clone ... 114 3e-24
gi|42794048|dbj|BAD11762.1| cahepsin L-like cysteine protease [B... 114 3e-24
gi|31559526|dbj|BAC77521.1| cysteine proteinase [Glycine max] >g... 114 4e-24
gi|49522293|gb|AAH75261.1| Unknown (protein for MGC:88875) [Xeno... 114 4e-24
gi|34861821|ref|XP_215183.2| similar to Cathepsin W precursor (L... 114 4e-24
gi|37780043|gb|AAP32194.1| cysteine protease 1 [Trifolium repens] 114 4e-24
gi|41152540|gb|AAR99519.1| cathepsin L protein [Fasciola hepatica] 114 4e-24
gi|2239109|emb|CAA70694.1| cathepsin S-like cysteine proteinase ... 114 4e-24
gi|27806673|ref|NP_776457.1| cathepsin L [Bos taurus] >gnl|BL_OR... 114 6e-24
gi|3916212|gb|AAC78838.1| cathepsin F [Homo sapiens] 114 6e-24
gi|6042196|ref|NP_003784.2| cathepsin F [Homo sapiens] >gnl|BL_O... 114 6e-24
gi|29567137|ref|NP_818699.1| cathepsin [Adoxophyes honmai nucleo... 114 6e-24
gi|18414611|ref|NP_567489.1| cysteine proteinase, putative [Arab... 113 7e-24
gi|6630974|gb|AAF19631.1| cysteine proteinase precursor [Myxine ... 113 7e-24
gi|118145|sp|P20721|CYSL_LYCES Low-temperature-induced cysteine ... 113 7e-24
gi|230417|pdb|2ACT| Actinidin (Sulfhydryl Proteinase) (E.C. Num... 113 7e-24
gi|442619|pdb|1AEC| Actinidin (E.C.3.4.22.14) Complex With The ... 113 7e-24
gi|32396020|gb|AAP41847.1| senescence-associated cysteine protea... 113 1e-23
gi|7435800|pir||T03941 cysteine proteinase (EC 3.4.22.-) precurs... 113 1e-23
gi|46948144|gb|AAT07054.1| cathepsin L-like cysteine proteinase ... 113 1e-23
gi|23508356|ref|NP_701025.1| falcipain 2 precursor [Plasmodium f... 113 1e-23
gi|37994576|gb|AAH60335.1| Unknown (protein for MGC:68554) [Xeno... 113 1e-23
gi|37724090|gb|AAO23671.1| silicatein [Petrosia ficiformis] 112 1e-23
gi|6753558|ref|NP_034114.1| cathepsin L preproprotein; furless; ... 112 1e-23
gi|200501|gb|AAA39984.1| preprocathepsin L precursor >gnl|BL_ORD... 112 1e-23
gi|18407678|ref|NP_566867.1| cysteine proteinase, putative [Arab... 112 1e-23
gi|21593501|gb|AAM65468.1| cysteine proteinase [Arabidopsis thal... 112 1e-23
gi|50251130|dbj|BAD27582.1| cathepsin S [Oryzias latipes] 112 1e-23
gi|23482498|gb|EAA18465.1| berghepain-2 [Plasmodium yoelii yoelii] 112 1e-23
gi|9719454|gb|AAF97809.1| falcipain 2 [Plasmodium falciparum] >g... 112 1e-23
gi|9719452|gb|AAF97808.1| falcipain 2 [Plasmodium falciparum] 112 1e-23
gi|7542559|gb|AAF63497.1| falcipain 2 [Plasmodium falciparum] >g... 112 1e-23
gi|7638427|gb|AAF65468.1| cysteine protease falcipain-2 [Plasmod... 112 1e-23
gi|2144502|pir||KHCHL cathepsin L (EC 3.4.22.15) - chicken 112 1e-23
gi|1272388|gb|AAB17051.1| cysteine protease 112 1e-23
gi|37905511|gb|AAO64477.1| cathepsin S precursor [Fundulus heter... 112 1e-23
gi|47213723|emb|CAF95154.1| unnamed protein product [Tetraodon n... 112 2e-23
gi|12847813|dbj|BAB27719.1| unnamed protein product [Mus musculus] 112 2e-23
gi|27960480|gb|AAO27844.1| cathepsin Q2 [Rattus norvegicus] 112 2e-23
gi|31077116|ref|NP_852043.1| cathepsin M [Rattus norvegicus] >gn... 112 2e-23
gi|4139678|pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cath... 112 2e-23
gi|27465595|ref|NP_775155.1| testin [Rattus norvegicus] >gnl|BL_... 112 2e-23
gi|6467382|gb|AAF13146.1| cathepsin F precursor [Homo sapiens] 112 2e-23
gi|47169030|pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of T... 112 2e-23
gi|13278510|gb|AAH04054.1| Ctsf protein [Mus musculus] 112 2e-23
gi|7271895|gb|AAF44678.1| cathepsin L [Fasciola gigantica] 112 2e-23
gi|37780049|gb|AAP32197.1| cysteine protease 10 [Trifolium repens] 112 2e-23
gi|23110962|ref|NP_004070.3| cathepsin S preproprotein [Homo sap... 112 2e-23
gi|49456321|emb|CAG46481.1| CTSF [Homo sapiens] 112 2e-23
gi|47213724|emb|CAF95155.1| unnamed protein product [Tetraodon n... 112 2e-23
gi|25289988|pir||G86232 cysteine proteinase (EC 3.4.22.-) [simil... 111 3e-23
gi|33242886|gb|AAQ01147.1| cathepsin [Paralabidochromis chilotes] 111 3e-23
gi|46948156|gb|AAT07060.1| cathepsin L-like cysteine proteinase ... 111 3e-23
gi|12803615|gb|AAH02642.1| Cathepsin S, preproprotein [Homo sapi... 111 3e-23
gi|50251128|dbj|BAD27581.1| cathepsin L [Oryzias latipes] 111 3e-23
gi|1169187|sp|P42666|CYSP_PLAVS Cysteine proteinase precursor >g... 111 3e-23
>gi|17565984|ref|NP_507627.1| cysteine proteinase family member (5T30)
[Caenorhabditis elegans]
gi|7510114|pir||T27079 hypothetical protein Y51A2D.8 - Caenorhabditis
elegans
gi|3881044|emb|CAA16407.1| Hypothetical protein Y51A2D.8
[Caenorhabditis elegans]
Length = 386
Score = 810 bits (2093), Expect = 0.0
Identities = 386/386 (100%), Positives = 386/386 (100%)
Frame = -1
Query: 1161 MQVFVIFLVVLPISGVVSINITEPEFFEINIDRDHPEKLYKAFEDFKKKYNRKYKDESEN 982
MQVFVIFLVVLPISGVVSINITEPEFFEINIDRDHPEKLYKAFEDFKKKYNRKYKDESEN
Sbjct: 1 MQVFVIFLVVLPISGVVSINITEPEFFEINIDRDHPEKLYKAFEDFKKKYNRKYKDESEN 60
Query: 981 QQRFNNFVKSYNNVDKLNAKSKAAGYDTQFGINKFSDLSTAEFHGRLSNVVPSNNTGLPM 802
QQRFNNFVKSYNNVDKLNAKSKAAGYDTQFGINKFSDLSTAEFHGRLSNVVPSNNTGLPM
Sbjct: 61 QQRFNNFVKSYNNVDKLNAKSKAAGYDTQFGINKFSDLSTAEFHGRLSNVVPSNNTGLPM 120
Query: 801 LNFDKKKPDFRAADMNKTRHKRRSTRYPDYFDLRNEKINGRYIVGPIKDQGQCACCWGFA 622
LNFDKKKPDFRAADMNKTRHKRRSTRYPDYFDLRNEKINGRYIVGPIKDQGQCACCWGFA
Sbjct: 121 LNFDKKKPDFRAADMNKTRHKRRSTRYPDYFDLRNEKINGRYIVGPIKDQGQCACCWGFA 180
Query: 621 VTALVETVYAAHSGKFKSLSDQEVCDCGTEGTPGCKGGSLTLGVQYVKKYGLSGDEDYPY 442
VTALVETVYAAHSGKFKSLSDQEVCDCGTEGTPGCKGGSLTLGVQYVKKYGLSGDEDYPY
Sbjct: 181 VTALVETVYAAHSGKFKSLSDQEVCDCGTEGTPGCKGGSLTLGVQYVKKYGLSGDEDYPY 240
Query: 441 DQNRANQGRRCRLRETDRIVPARAFNFAVINPRRAEEQIIQVLTEWKVPVAVYFKVGDQF 262
DQNRANQGRRCRLRETDRIVPARAFNFAVINPRRAEEQIIQVLTEWKVPVAVYFKVGDQF
Sbjct: 241 DQNRANQGRRCRLRETDRIVPARAFNFAVINPRRAEEQIIQVLTEWKVPVAVYFKVGDQF 300
Query: 261 KEYKEGVIIEDDCRRATQWHAGAIVGYDTVEDSRGRSHDYWIIKNSWGGDWAESGYVRVV 82
KEYKEGVIIEDDCRRATQWHAGAIVGYDTVEDSRGRSHDYWIIKNSWGGDWAESGYVRVV
Sbjct: 301 KEYKEGVIIEDDCRRATQWHAGAIVGYDTVEDSRGRSHDYWIIKNSWGGDWAESGYVRVV 360
Query: 81 RGRDWCSIEDQPMTGDIKDHKDNYYY 4
RGRDWCSIEDQPMTGDIKDHKDNYYY
Sbjct: 361 RGRDWCSIEDQPMTGDIKDHKDNYYY 386