Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y53C12A_3
(1476 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17537407|ref|NP_496094.1| glutamate transporter (52.8 kD) (2J... 858 0.0
gi|39589254|emb|CAE57987.1| Hypothetical protein CBG01050 [Caeno... 761 0.0
gi|39597747|emb|CAE68439.1| Hypothetical protein CBG14224 [Caeno... 461 e-128
gi|7495879|pir||T29633 hypothetical protein C12D12.2 - Caenorhab... 460 e-128
gi|17550362|ref|NP_508601.1| GLutamate Transporter, Sodium-depen... 458 e-127
gi|17550360|ref|NP_508600.1| GLutamate Transporter, Sodium-depen... 458 e-127
gi|3023684|sp|Q25605|EAAT_ONCVO Excitatory amino acid transporte... 454 e-126
gi|1045480|gb|AAB41910.1| CeGlt-1 452 e-126
gi|1045479|gb|AAB41909.1| CeGlt-2 452 e-126
gi|4960026|gb|AAD34586.1| glutamate transporter Am-EAAT [Apis me... 423 e-117
gi|2655017|gb|AAB88287.1| glutamate transporter 2A [Ambystoma ti... 422 e-116
gi|1169460|sp|P43006|EAA2_MOUSE Excitatory amino acid transporte... 418 e-115
gi|1363971|pir||JC4262 glutamate transporter 2 - mouse >gnl|BL_O... 418 e-115
gi|2668400|dbj|BAA23771.1| mGLT-1A [Mus musculus] 418 e-115
gi|7106409|ref|NP_035523.1| solute carrier family 1 (glial high ... 418 e-115
gi|15554308|gb|AAK98779.1| glutamate transporter 1 variant [Ratt... 418 e-115
gi|10121878|gb|AAG13411.1| sodium-dependent high affinity glutam... 417 e-115
gi|417074|sp|P31596|EAA2_RAT Excitatory amino acid transporter 2... 417 e-115
gi|705398|gb|AAA93061.1| GluT 417 e-115
gi|20386140|gb|AAM21604.1| glutamate transporter GLT1b [Rattus n... 417 e-115
gi|10432368|emb|CAC10343.1| dJ68D18.1.1 (solute carrier family 1... 417 e-115
gi|40254478|ref|NP_004162.2| solute carrier family 1, member 2; ... 417 e-115
gi|10432367|emb|CAC10342.1| dJ68D18.1.2 (solute carrier family 1... 417 e-115
gi|13569725|gb|AAK31212.1| glutamate transporter GLT1 [Felis catus] 416 e-115
gi|2459554|gb|AAB71737.1| glutamate transporter [Mus musculus] 416 e-115
gi|6978309|gb|AAF14542.2| glutamate transporter [Canis familiaris] 416 e-115
gi|7447027|pir||I38399 glutamate/aspartate transporter II - huma... 415 e-114
gi|2135091|pir||I38432 excitatory amino acid transporter2 - huma... 415 e-114
gi|47217066|emb|CAG02377.1| unnamed protein product [Tetraodon n... 409 e-112
gi|41053909|ref|NP_956273.1| Unknown (protein for MGC:65897); wu... 407 e-112
gi|2655019|gb|AAB88288.1| glutamate transporter 2B [Ambystoma ti... 404 e-111
gi|1169458|sp|P43003|EAA1_HUMAN Excitatory amino acid transporte... 399 e-110
gi|31543628|ref|NP_004163.2| solute carrier family 1 (glial high... 399 e-110
gi|5577964|gb|AAD45401.1| Na+-dependent glutamate transporter; G... 398 e-109
gi|27807085|ref|NP_777025.1| solute carrier family 1 (glial high... 398 e-109
gi|232176|sp|P24942|EAA1_RAT Excitatory amino acid transporter 1... 396 e-109
gi|9507115|ref|NP_062098.1| solute carrier family 1, member 3; g... 395 e-108
gi|542832|pir||S38353 glutamate transporter protein - human 394 e-108
gi|26339750|dbj|BAC33538.1| unnamed protein product [Mus musculus] 394 e-108
gi|24233554|ref|NP_683740.1| solute carrier family 1 (glial high... 394 e-108
gi|37994698|gb|AAH60347.1| MGC68789 protein [Xenopus laevis] 393 e-108
gi|26351375|dbj|BAC39324.1| unnamed protein product [Mus musculus] 391 e-107
gi|6015046|sp|O57321|EAA1_AMBTI Excitatory amino acid transporte... 388 e-106
gi|47086755|ref|NP_997805.1| solute carrier family 1 (glial high... 384 e-105
gi|8394286|ref|NP_058911.1| solute carrier family 1, member 2; g... 382 e-104
gi|17541374|ref|NP_501844.1| glutamate transporter GLT1 (58.5 kD... 381 e-104
gi|29179482|gb|AAH49340.1| Unknown (protein for MGC:56661) [Dani... 381 e-104
gi|7447026|pir||I37426 glutamate transporter - human >gnl|BL_ORD... 380 e-104
gi|4827012|ref|NP_005062.1| solute carrier family 1 (high affini... 379 e-104
gi|6678003|ref|NP_033226.1| solute carrier family 1 (high affini... 378 e-103
gi|30909279|gb|AAP37181.1| solute carrier family 1 member 6 [Rat... 378 e-103
gi|39585726|emb|CAE59928.1| Hypothetical protein CBG03414 [Caeno... 378 e-103
gi|38605065|sp|Q9N1R2|EAA4_CANFA Excitatory amino acid transport... 378 e-103
gi|2135092|pir||I38433 excitatory amino acid transporter3 - huma... 377 e-103
gi|1706561|sp|P51907|EAA3_RAT Excitatory amino acid transporter ... 377 e-103
gi|12857793|dbj|BAB31114.1| unnamed protein product [Mus musculus] 376 e-103
gi|6678001|ref|NP_033225.1| solute carrier family 1 (neuronal/ep... 376 e-103
gi|1706560|sp|P51906|EAA3_MOUSE Excitatory amino acid transporte... 376 e-103
gi|39593609|emb|CAE61901.1| Hypothetical protein CBG05893 [Caeno... 376 e-103
gi|14091748|ref|NP_114454.1| solute carrier family 1 member 6; h... 375 e-102
gi|40352863|gb|AAH64797.1| Solute carrier family 1 (neuronal/epi... 375 e-102
gi|50540400|ref|NP_001002666.1| zgc:91959 [Danio rerio] >gnl|BL_... 375 e-102
gi|6979017|gb|AAF34319.1| neuronal glutamate transporter [Rattus... 375 e-102
gi|31543626|ref|NP_004161.3| solute carrier family 1, member 1; ... 374 e-102
gi|1352332|sp|P43005|EAA3_HUMAN Excitatory amino acid transporte... 374 e-102
gi|31377496|ref|NP_037164.2| solute carrier family 1, member 1; ... 372 e-102
gi|627458|pir||A54856 high affinity glutamate transporter - huma... 372 e-101
gi|5931353|gb|AAC27511.3| neuronal and epithelial glutamate tran... 372 e-101
gi|6978307|gb|AAF14541.2| glutamate transporter [Canis familiaris] 372 e-101
gi|27807083|ref|NP_777024.1| solute carrier family 1, member 1 [... 372 e-101
gi|1072116|gb|AAB09773.1| EAAC1 371 e-101
gi|2135270|pir||I38560 glutamate transporter - human >gnl|BL_ORD... 370 e-101
gi|399760|sp|P31597|EAA3_RABIT Excitatory amino acid transporter... 369 e-101
gi|25145532|ref|NP_501210.2| glutamate transporter family member... 364 3e-99
gi|8118689|gb|AAF73069.1| GLAST-1a [Rattus norvegicus] 356 7e-97
gi|7506319|pir||T29354 hypothetical protein R05G6.6 - Caenorhabd... 355 1e-96
gi|47230754|emb|CAF99947.1| unnamed protein product [Tetraodon n... 353 6e-96
gi|1587133|prf||2206275A neuronal Glu transporter EAAC1 352 1e-95
gi|22122845|ref|NP_666367.1| solute carrier family 1 (glutamate ... 350 4e-95
gi|20070239|ref|NP_006662.2| solute carrier family 1 (glutamate ... 349 8e-95
gi|705397|gb|AAA93062.1| GluT-R glutamate transporter 349 1e-94
gi|47206511|emb|CAF93494.1| unnamed protein product [Tetraodon n... 346 9e-94
gi|3023686|sp|O00341|EAA5_HUMAN Excitatory amino acid transporte... 345 2e-93
gi|32966014|gb|AAP76304.1| excitatory amino acid transporter [Ae... 344 3e-93
gi|2655021|gb|AAB88289.1| glutamate transporter 5A [Ambystoma ti... 344 3e-93
gi|48138517|ref|XP_393410.1| similar to high-affinity Na+-depend... 340 4e-92
gi|17225095|gb|AAL37244.1| excitatory amino acid carrier 1 [Mus ... 340 5e-92
gi|17137666|ref|NP_477427.1| CG3159-PA [Drosophila melanogaster]... 338 3e-91
gi|31197817|ref|XP_307856.1| ENSANGP00000018072 [Anopheles gambi... 337 4e-91
gi|5713156|gb|AAD47830.1| sodium-dependent excitatory amino acid... 336 1e-90
gi|8050559|gb|AAF71701.1| high-affinity Na+-dependent glutamate ... 335 2e-90
gi|47215956|emb|CAF96358.1| unnamed protein product [Tetraodon n... 334 3e-90
gi|10696976|emb|CAC12702.1| bA6J24.1 (solute carrier family 1 (n... 334 4e-90
gi|2352298|gb|AAB84380.1| high-affinity Na+-dependent glutamate ... 333 6e-90
gi|48104742|ref|XP_395840.1| similar to ENSANGP00000018072 [Apis... 331 2e-89
gi|2655023|gb|AAB88290.1| glutamate transporter 5B [Ambystoma ti... 331 3e-89
gi|47210639|emb|CAF91695.1| unnamed protein product [Tetraodon n... 330 5e-89
gi|49658983|emb|CAE01483.1| EAAT1 [Tetraodon nigroviridis] 330 5e-89
gi|31200155|ref|XP_309025.1| ENSANGP00000021612 [Anopheles gambi... 328 3e-88
gi|17137668|ref|NP_477428.1| CG3747-PA [Drosophila melanogaster]... 325 2e-87
gi|21314632|ref|NP_003029.2| solute carrier family 1, member 4; ... 323 8e-87
gi|507137|gb|AAA19438.1| neutral amino acid transporter 322 1e-86
gi|7657953|dbj|BAA94861.1| hASCT1 [Homo sapiens] 322 1e-86
gi|2135822|pir||I55389 neutral amino acid transporter - human >g... 321 3e-86
gi|31225493|ref|XP_317579.1| ENSANGP00000010046 [Anopheles gambi... 320 4e-86
gi|38454264|ref|NP_942058.1| solute carrier family 1 (glutamate/... 319 1e-85
gi|7447031|pir||T16921 hypothetical protein T22E5.2 - Caenorhabd... 319 1e-85
gi|26336334|dbj|BAC31852.1| unnamed protein product [Mus musculus] 318 2e-85
gi|3024586|sp|O35874|SATT_MOUSE Neutral amino acid transporter A... 317 4e-85
gi|31980935|ref|NP_061349.2| solute carrier family 1 (glutamate/... 317 4e-85
gi|25147438|ref|NP_509075.2| solute carrier family 1 member (XH2... 317 5e-85
gi|39585838|emb|CAE61252.1| Hypothetical protein CBG05056 [Caeno... 315 2e-84
gi|39587529|emb|CAE58467.1| Hypothetical protein CBG01607 [Caeno... 311 3e-83
gi|28629219|gb|AAO49506.1| neutral amino acid transporter type 1... 310 4e-83
gi|27817326|emb|CAD61091.1| SI:zC101N13.5 (novel protein similar... 310 7e-83
gi|47224774|emb|CAG00368.1| unnamed protein product [Tetraodon n... 309 1e-82
gi|19338682|gb|AAL86765.1| glutamate transporter GLT1b [Rattus n... 307 5e-82
gi|47225045|emb|CAF97460.1| unnamed protein product [Tetraodon n... 304 4e-81
gi|49256092|gb|AAH74180.1| Unknown (protein for MGC:82017) [Xeno... 301 2e-80
gi|19071568|gb|AAL55405.1| glutamate transporter splice variant ... 297 5e-79
gi|539647|pir||A47131 Na+-dependent neutral amino acid transport... 295 2e-78
gi|27807087|ref|NP_777026.1| solute carrier family 1 (neutral am... 294 3e-78
gi|913796|gb|AAB32664.1| glutamate/aspartate transporter; GLAST ... 293 9e-78
gi|24308472|ref|NP_714945.1| solute carrier family 1, member 7; ... 291 2e-77
gi|3023228|sp|O19105|AAAT_RABIT Neutral amino acid transporter B... 291 4e-77
gi|50762323|ref|XP_425011.1| PREDICTED: similar to Na+-dependent... 289 1e-76
gi|1478281|gb|AAC50629.1| neutral amino acid transporter B 288 2e-76
gi|5032093|ref|NP_005619.1| solute carrier family 1 (neutral ami... 288 3e-76
gi|4191562|gb|AAD09814.1| neutral amino acid transporter [Homo s... 288 3e-76
gi|12652633|gb|AAH00062.1| Solute carrier family 1 (neutral amin... 288 3e-76
gi|15004317|gb|AAK77026.1| sodium-dependent neutral amino acid t... 288 3e-76
gi|2459559|gb|AAB71739.1| mEAAC2 [Mus musculus] >gnl|BL_ORD_ID|7... 287 5e-76
gi|4191556|gb|AAD09812.1| RD114/simian type D retrovirus recepto... 284 4e-75
gi|47225044|emb|CAF97459.1| unnamed protein product [Tetraodon n... 283 7e-75
gi|6678005|ref|NP_033227.1| solute carrier family 1 (neutral ami... 283 1e-74
gi|9931448|gb|AAG02180.1| neutral amino acid transporter ASCT2 [... 282 2e-74
gi|31746557|gb|AAD14749.2| Glutamate transporter family protein ... 279 1e-73
gi|48103915|ref|XP_392906.1| glutamate transporter Am-EAAT [Apis... 274 3e-72
gi|28461151|ref|NP_786934.1| sodium-dependent neutral amino acid... 270 9e-71
gi|48138442|ref|XP_393405.1| similar to CG10011-PA [Apis mellifera] 268 2e-70
gi|17542794|ref|NP_499944.1| sodium:dicarboxylate symporter fami... 268 2e-70
gi|27462707|gb|AAO15552.1| glutamate transporter [Cavia porcellus] 265 2e-69
gi|1363095|pir||JC4149 adipocyte amino acid transporter - mouse ... 264 4e-69
gi|50760960|ref|XP_425882.1| PREDICTED: similar to glutamate tra... 262 1e-68
gi|47207459|emb|CAF90180.1| unnamed protein product [Tetraodon n... 259 9e-68
gi|47211058|emb|CAF95141.1| unnamed protein product [Tetraodon n... 259 2e-67
gi|20842340|ref|XP_143982.1| similar to solute carrier family 1 ... 257 4e-67
gi|32472153|ref|NP_865147.1| excitatory amino acid transporter [... 246 8e-64
gi|34870306|ref|XP_345560.1| similar to RIKEN cDNA A930031E15 [R... 236 8e-61
gi|27462705|gb|AAO15551.1| glutamate transporter [Cavia porcellus] 233 1e-59
gi|27462703|gb|AAO15550.1| glutamate transporter [Cavia porcellus] 229 1e-58
gi|15680126|gb|AAH14403.1| Unknown (protein for IMAGE:3507239) [... 220 6e-56
gi|38112381|gb|AAR11277.1| solute carrier family 1 [Pan troglody... 213 7e-54
gi|8132399|gb|AAF73279.1| Na+-dependent glutamate/aspartate tran... 213 1e-53
gi|15606533|ref|NP_213913.1| proton/sodium-glutamate symport pro... 205 2e-51
gi|48095475|ref|XP_392302.1| similar to CG3159-PA [Apis mellifera] 201 5e-50
gi|48862607|ref|ZP_00316503.1| COG1301: Na+/H+-dicarboxylate sym... 198 3e-49
gi|47223086|emb|CAG07173.1| unnamed protein product [Tetraodon n... 197 5e-49
gi|3282680|gb|AAC25030.1| glutamate transporter [Rattus norvegicus] 196 2e-48
gi|15616382|ref|NP_244687.1| H(+)/sodium-glutamate symporter [Ba... 195 2e-48
gi|26245397|gb|AAN77496.1| excitatory amino acid transporter 1 [... 192 1e-47
gi|24373512|ref|NP_717555.1| sodium:dicarboxylate symporter fami... 191 3e-47
gi|37675880|ref|NP_936276.1| proton/glutamate symporter [Vibrio ... 188 3e-46
gi|3282678|gb|AAC25029.1| glutamate transporter [Homo sapiens] 188 3e-46
gi|48855811|ref|ZP_00309969.1| COG1301: Na+/H+-dicarboxylate sym... 187 7e-46
gi|27367749|ref|NP_763276.1| Na+/H+-dicarboxylate symporter [Vib... 186 1e-45
gi|15600859|ref|NP_232489.1| proton/glutamate symporter [Vibrio ... 184 4e-45
gi|46912788|emb|CAG19578.1| Putative proton/glutamate symporter ... 184 6e-45
gi|28901464|ref|NP_801119.1| proton/glutamate symporter [Vibrio ... 180 9e-44
gi|41690007|ref|ZP_00146539.1| COG1301: Na+/H+-dicarboxylate sym... 179 2e-43
gi|50748038|ref|XP_421082.1| PREDICTED: similar to glutamate tra... 179 2e-43
gi|50086225|ref|YP_047735.1| putative Proton/sodium-glutamate sy... 179 2e-43
gi|24372509|ref|NP_716551.1| proton/glutamate symporter [Shewane... 179 2e-43
gi|23097476|ref|NP_690942.1| H(+):sodium-glutamate symporter [Oc... 175 3e-42
gi|21399347|ref|NP_655332.1| SDF, Sodium:dicarboxylate symporter... 174 6e-42
gi|15605126|ref|NP_219911.1| Glutamate Symport [Chlamydia tracho... 174 6e-42
gi|42780629|ref|NP_977876.1| proton/glutamate symporter family p... 173 1e-41
gi|49481076|ref|YP_035649.1| proton/sodium-glutamate symport pro... 173 1e-41
gi|14602159|ref|NP_148707.1| proton/sodium-glutamate symport pro... 172 2e-41
gi|30019581|ref|NP_831212.1| Proton/sodium-glutamate symport pro... 172 2e-41
gi|29839984|ref|NP_829090.1| sodium:dicarboxylate symporter fami... 171 3e-41
gi|41724208|ref|ZP_00151074.1| COG1301: Na+/H+-dicarboxylate sym... 171 3e-41
gi|42780582|ref|NP_977829.1| proton/glutamate symporter family p... 171 5e-41
gi|41719826|ref|ZP_00148687.1| COG1301: Na+/H+-dicarboxylate sym... 171 5e-41
gi|28210539|ref|NP_781483.1| proton/sodium-glutamate symport pro... 170 9e-41
gi|50748040|ref|XP_421083.1| PREDICTED: similar to Excitatory am... 170 9e-41
gi|47570499|ref|ZP_00241128.1| proton/sodium-glutamate symport p... 169 1e-40
gi|50876395|emb|CAG36235.1| probable H+/Na+-glutamate symporter ... 169 2e-40
gi|14521051|ref|NP_126526.1| amino acid transporter [Pyrococcus ... 169 2e-40
gi|47566278|ref|ZP_00237306.1| sodium:dicarboxylate symporter fa... 169 2e-40
gi|15835296|ref|NP_297055.1| sodium:dicarboxylate symporter fami... 168 3e-40
gi|38107146|gb|EAA53362.1| hypothetical protein MG07639.4 [Magna... 168 3e-40
gi|15618439|ref|NP_224724.1| Glutamate Symport [Chlamydophila pn... 167 5e-40
gi|21399305|ref|NP_655290.1| SDF, Sodium:dicarboxylate symporter... 167 5e-40
gi|30019539|ref|NP_831170.1| Proton/sodium-glutamate symport pro... 166 1e-39
gi|49101029|ref|XP_410919.1| hypothetical protein AN6782.2 [Aspe... 164 4e-39
gi|15641181|ref|NP_230813.1| proton/glutamate symporter [Vibrio ... 164 4e-39
gi|20091779|ref|NP_617854.1| proton/sodium-glutamate symporter [... 164 5e-39
gi|14591106|ref|NP_143181.1| proton glutamate symport protein [P... 164 5e-39
gi|15925374|ref|NP_372908.1| proton/sodium-glutamate symport pro... 164 7e-39
gi|15604051|ref|NP_220566.1| PROTON/SODIUM-GLUTAMATE SYMPORT PRO... 163 9e-39
gi|49484601|ref|YP_041825.1| putative proton/sodium-glutamate sy... 163 1e-38
gi|24212766|ref|NP_710247.1| Proton/sodium-glutamate symport pro... 160 6e-38
gi|45655973|ref|YP_000059.1| proton glutamate symport protein [L... 160 7e-38
gi|50751836|ref|XP_426662.1| PREDICTED: similar to solute carrie... 159 2e-37
gi|121466|sp|P24944|GLTT_BACCA Proton/sodium-glutamate symport p... 159 2e-37
gi|47565529|ref|ZP_00236570.1| proton/sodium-glutamate symport p... 158 3e-37
gi|49481097|ref|YP_035980.1| proton/sodium-glutamate symport pro... 158 4e-37
gi|554479|gb|AAB51161.1| neuronal glutamate/aspartate transport ... 157 5e-37
gi|37679399|ref|NP_934008.1| proton/glutamate symporter [Vibrio ... 157 6e-37
gi|30019883|ref|NP_831514.1| Proton/sodium-glutamate symport pro... 157 8e-37
gi|46914094|emb|CAG20874.1| putative proton/glutamate symporter ... 156 1e-36
gi|21399679|ref|NP_655664.1| SDF, Sodium:dicarboxylate symporter... 156 1e-36
gi|16078086|ref|NP_388903.1| proton/sodium-glutamate symport pro... 156 1e-36
gi|23129573|ref|ZP_00111399.1| COG1301: Na+/H+-dicarboxylate sym... 156 1e-36
gi|27468882|ref|NP_765519.1| proton/sodium-glutamate symport pro... 156 1e-36
gi|15892146|ref|NP_359860.1| proton/sodium-glutamate symport pro... 155 3e-36
gi|15895059|ref|NP_348408.1| Proton/sodium-glutamate symport pro... 154 5e-36
gi|47197716|emb|CAF88961.1| unnamed protein product [Tetraodon n... 154 5e-36
gi|121467|sp|P24943|GLTT_BACST Proton/sodium-glutamate symport p... 154 7e-36
gi|37523293|ref|NP_926670.1| proton/sodium-glutamate symport pro... 153 9e-36
gi|50083723|ref|YP_045233.1| glutamate:aspartate symport protein... 153 1e-35
gi|28898740|ref|NP_798345.1| proton/glutamate symporter [Vibrio ... 152 2e-35
gi|21229427|ref|NP_635349.1| permease, Na+/H+-dicarboxylate symp... 152 2e-35
gi|46447419|ref|YP_008784.1| putative proton/sodium-glutamate sy... 152 3e-35
gi|24115343|ref|NP_709853.1| glutamate-aspartate symport protein... 152 3e-35
gi|16120218|ref|NP_395806.1| proton/sodium-glutamate symport pro... 151 3e-35
gi|18309743|ref|NP_561677.1| proton/sodium- glutamate symport pr... 151 3e-35
gi|28379296|ref|NP_786188.1| proton/sodium-glutamate symport pro... 151 4e-35
gi|15804669|ref|NP_290710.1| glutamate-aspartate symport protein... 151 4e-35
gi|17934714|ref|NP_531504.1| proton/glutamate transport protein ... 150 6e-35
gi|50120455|ref|YP_049622.1| proton glutamate symport protein [E... 150 6e-35
gi|15888149|ref|NP_353830.1| AGR_C_1476p [Agrobacterium tumefaci... 150 6e-35
gi|16131903|ref|NP_418501.1| glutamate-aspartate symport protein... 150 6e-35
gi|20807669|ref|NP_622840.1| Na+/H+-dicarboxylate symporters [Th... 149 2e-34
gi|15805683|ref|NP_294379.1| proton/sodium-glutamate symport pro... 149 2e-34
gi|16767533|ref|NP_463148.1| glutamate/aspartate symport protein... 149 2e-34
gi|18977841|ref|NP_579198.1| glutamate/aspartate transport prote... 148 4e-34
gi|16762965|ref|NP_458582.1| proton glutamate symport protein [S... 147 5e-34
gi|45440262|ref|NP_991801.1| proton glutamate symport protein [Y... 147 6e-34
gi|46135338|ref|ZP_00162734.2| COG1301: Na+/H+-dicarboxylate sym... 147 6e-34
gi|20381109|gb|AAH28721.1| Unknown (protein for MGC:33092) [Homo... 147 6e-34
gi|17227838|ref|NP_484386.1| proton/sodium-glutamate symport pro... 147 6e-34
gi|49478283|ref|YP_037668.1| C4-dicarboxylate transport protein ... 147 6e-34
gi|16120591|ref|NP_403904.1| proton glutamate symport protein [Y... 147 6e-34
gi|28195274|gb|AAO27468.1| sodium-dependent neutral amino acid t... 147 8e-34
gi|49186385|ref|YP_029637.1| sodium:dicarboxylate symporter [Bac... 146 1e-33
gi|42782654|ref|NP_979901.1| C4-dicarboxylate transport protein ... 146 1e-33
gi|50540096|ref|NP_001002513.1| zgc:92817 [Danio rerio] >gnl|BL_... 146 1e-33
gi|45916949|ref|ZP_00196023.2| COG1301: Na+/H+-dicarboxylate sym... 146 1e-33
gi|48733070|ref|ZP_00266813.1| COG1301: Na+/H+-dicarboxylate sym... 145 2e-33
gi|46188597|ref|ZP_00124846.2| COG1301: Na+/H+-dicarboxylate sym... 145 3e-33
gi|26986882|ref|NP_742307.1| proton/sodium-glutamate/aspartate s... 144 4e-33
gi|48870113|ref|ZP_00322842.1| COG1301: Na+/H+-dicarboxylate sym... 144 4e-33
gi|21325323|dbj|BAB99944.1| Na+/H+-dicarboxylate symporters [Cor... 144 4e-33
gi|19553749|ref|NP_601751.1| Na+/H+-dicarboxylate symporter [Cor... 144 4e-33
gi|41326731|emb|CAF21213.1| Na+/H+-dicarboxylate symporter famil... 144 4e-33
gi|21232650|ref|NP_638567.1| proton glutamate symport protein [X... 144 5e-33
gi|21244098|ref|NP_643680.1| proton glutamate symport protein [X... 144 7e-33
gi|28867465|ref|NP_790084.1| proton/glutamate symporter [Pseudom... 144 7e-33
gi|15600672|ref|NP_254166.1| proton-glutamate symporter [Pseudom... 144 7e-33
gi|48772272|ref|ZP_00276614.1| COG1301: Na+/H+-dicarboxylate sym... 143 1e-32
gi|46912199|emb|CAG18994.1| putative Sodium/glutamate symporter ... 143 1e-32
gi|46317583|ref|ZP_00218161.1| COG1301: Na+/H+-dicarboxylate sym... 142 2e-32
gi|47210010|emb|CAF93353.1| unnamed protein product [Tetraodon n... 142 2e-32
gi|48771208|ref|ZP_00275551.1| COG1301: Na+/H+-dicarboxylate sym... 141 3e-32
gi|33519513|ref|NP_878345.1| proton glutamate symport protein [C... 141 3e-32
gi|50120440|ref|YP_049607.1| proton glutamate symport protein [E... 141 3e-32
gi|34557130|ref|NP_906945.1| PROTON/GLUTAMATE SYMPORTER [Wolinel... 141 5e-32
gi|24371757|ref|NP_715799.1| proton/glutamate symporter [Shewane... 141 5e-32
gi|21222883|ref|NP_628662.1| putative proton transport protein [... 140 8e-32
gi|2072369|emb|CAA70413.1| proton /sodium-glutamate symport prot... 140 8e-32
gi|16077514|ref|NP_388328.1| C4-dicarboxylate transport protein ... 140 8e-32
gi|42527837|ref|NP_972935.1| sodium/dicarboxylate symporter fami... 140 1e-31
gi|22994303|ref|ZP_00038812.1| COG1301: Na+/H+-dicarboxylate sym... 139 1e-31
gi|16125356|ref|NP_419920.1| sodium:dicarboxylate symporter fami... 138 3e-31
gi|50123282|ref|YP_052449.1| aerobic C4-dicarboxylate transport ... 138 4e-31
gi|30250075|ref|NP_842145.1| Sodium:dicarboxylate symporter fami... 138 4e-31
gi|24375066|ref|NP_719109.1| proton/glutamate symporter, putativ... 138 4e-31
gi|15838531|ref|NP_299219.1| proton glutamate symport protein [X... 138 4e-31
gi|38234556|ref|NP_940323.1| sodium:dicarboxylate symporter fami... 138 4e-31
gi|45516940|ref|ZP_00168492.1| COG1301: Na+/H+-dicarboxylate sym... 137 5e-31
gi|17546676|ref|NP_520078.1| PUTATIVE GLUTAMATE SYMPORT TRANSMEM... 137 5e-31
gi|24114796|ref|NP_709306.1| uptake of C4-dicarboxylic acids [Sh... 137 5e-31
gi|48850422|ref|ZP_00304664.1| COG1301: Na+/H+-dicarboxylate sym... 137 7e-31
gi|16131400|ref|NP_417985.1| uptake of C4-dicarboxylic acids; ci... 137 7e-31
gi|15804072|ref|NP_290108.1| uptake of C4-dicarboxylic acids [Es... 137 7e-31
gi|28198765|ref|NP_779079.1| proton glutamate symport protein [X... 136 1e-30
gi|50738960|ref|XP_419344.1| PREDICTED: similar to Neutral amino... 136 1e-30
gi|27363833|ref|NP_759361.1| Sodium/glutamate symporter [Vibrio ... 136 1e-30
gi|37679010|ref|NP_933619.1| sodium/glutamate symporter [Vibrio ... 136 1e-30
gi|16077303|ref|NP_388116.1| proton/glutamate symport protein [B... 135 2e-30
gi|22996198|ref|ZP_00040464.1| COG1301: Na+/H+-dicarboxylate sym... 135 2e-30
gi|47192461|emb|CAG14072.1| unnamed protein product [Tetraodon n... 135 2e-30
gi|16766900|ref|NP_462515.1| C4-dicarboxylic acids transport pro... 135 2e-30
gi|38257448|sp|Q848I3|DCTA_PSECL C4-dicarboxylate transport prot... 135 3e-30
gi|34499162|ref|NP_903377.1| C4-dicarboxylic acids transport pro... 135 3e-30
gi|19703939|ref|NP_603501.1| Proton/sodium-aspartate symport pro... 135 3e-30
gi|47933949|gb|AAT39535.1| GltP [Vibrio harveyi] 135 3e-30
gi|21232775|ref|NP_638692.1| C4-dicarboxylate transport protein ... 135 3e-30
gi|231980|sp|Q01857|DCTA_RHILE C4-dicarboxylate transport protei... 134 4e-30
gi|50120869|ref|YP_050036.1| putative glutamate symport protein ... 134 4e-30
gi|37527090|ref|NP_930434.1| C4-dicarboxylate transport protein ... 134 4e-30
gi|28897426|ref|NP_797031.1| GltP [Vibrio parahaemolyticus RIMD ... 134 4e-30
gi|47225625|emb|CAG07968.1| unnamed protein product [Tetraodon n... 134 7e-30
gi|16762688|ref|NP_458305.1| C4-dicarboxylate transport protein ... 134 7e-30
gi|27379409|ref|NP_770938.1| C4-dicarboxylate transport protein ... 134 7e-30
gi|21244196|ref|NP_643778.1| C4-dicarboxylate transport protein ... 133 1e-29
gi|6746607|gb|AAF27647.1| GltP [Vibrio proteolyticus] 133 1e-29
gi|28868888|ref|NP_791507.1| C4-dicarboxylate transport protein ... 133 1e-29
gi|50083590|ref|YP_045100.1| putative proton/sodium-glutamate sy... 133 1e-29
gi|24375491|ref|NP_719534.1| proton/glutamate symporter, putativ... 133 1e-29
gi|1783389|gb|AAB40997.1| EAAT4 Na+-dependent glutamate transpor... 133 1e-29
gi|17549216|ref|NP_522556.1| PROBABLE C4-DICARBOXYLATE TRANSPORT... 133 1e-29
gi|15800438|ref|NP_286450.1| putative symport protein [Escherich... 133 1e-29
gi|15891635|ref|NP_357307.1| AGR_L_3041p [Agrobacterium tumefaci... 132 2e-29
gi|27379128|ref|NP_770657.1| bll4017 [Bradyrhizobium japonicum U... 132 3e-29
gi|47187770|emb|CAG14071.1| unnamed protein product [Tetraodon n... 131 4e-29
gi|48730638|ref|ZP_00264385.1| COG1301: Na+/H+-dicarboxylate sym... 131 4e-29
gi|23471042|ref|ZP_00126373.1| COG1301: Na+/H+-dicarboxylate sym... 131 5e-29
gi|21243485|ref|NP_643067.1| glutamate symport protein [Xanthomo... 130 6e-29
gi|16124119|ref|NP_407432.1| C4-dicarboxylate transport protein ... 130 8e-29
gi|48764761|ref|ZP_00269312.1| COG1301: Na+/H+-dicarboxylate sym... 130 8e-29
gi|48729212|ref|ZP_00262963.1| COG1301: Na+/H+-dicarboxylate sym... 130 1e-28
gi|15596380|ref|NP_249874.1| C4-dicarboxylate transport protein ... 129 2e-28
gi|50085335|ref|YP_046845.1| aerobic C4-dicarboxylate transport ... 129 2e-28
gi|17545049|ref|NP_518451.1| PROBABLE C4-DICARBOXYLATE TRANSPORT... 129 2e-28
gi|48784367|ref|ZP_00280733.1| COG1301: Na+/H+-dicarboxylate sym... 129 2e-28
gi|23103751|ref|ZP_00090227.1| COG1301: Na+/H+-dicarboxylate sym... 129 2e-28
gi|15807509|ref|NP_296245.1| C4-dicarboxylate transport protein ... 128 3e-28
gi|46132783|ref|ZP_00171468.2| COG1301: Na+/H+-dicarboxylate sym... 128 3e-28
gi|20138055|sp|Q9RRG7|DCTA_DEIRA C4-dicarboxylate transport protein 128 3e-28
gi|20141360|sp|P31601|DCTA_RHISN C4-dicarboxylate transport protein 128 4e-28
gi|16519987|ref|NP_444107.1| DctA1 [Rhizobium sp. NGR234] >gnl|B... 128 4e-28
gi|250725|gb|AAB22400.1| NGRDCTA1 [Rhizobium leguminosarum] 127 7e-28
gi|46314045|ref|ZP_00214632.1| COG1301: Na+/H+-dicarboxylate sym... 127 7e-28
gi|250726|gb|AAB22401.1| NGRDCTA2 [Rhizobium leguminosarum] 127 7e-28
gi|21232027|ref|NP_637944.1| glutamate symport protein [Xanthomo... 127 9e-28
gi|17547992|ref|NP_521394.1| PROBABLE C4-DICARBOXYLATE TRANSPORT... 127 9e-28
gi|45552173|ref|NP_995609.1| CG3159-PB [Drosophila melanogaster]... 127 9e-28
gi|48728843|ref|ZP_00262597.1| COG1301: Na+/H+-dicarboxylate sym... 126 1e-27
gi|29375024|ref|NP_814177.1| sodium/dicarboxylate symporter fami... 126 1e-27
gi|48770376|ref|ZP_00274719.1| COG1301: Na+/H+-dicarboxylate sym... 126 1e-27
gi|28871206|ref|NP_793825.1| C4-dicarboxylate transport protein ... 126 2e-27
gi|23105987|ref|ZP_00092441.1| COG1301: Na+/H+-dicarboxylate sym... 125 2e-27
gi|39933629|ref|NP_945905.1| dicarboxylate transport protein [Rh... 125 2e-27
gi|48731377|ref|ZP_00265122.1| COG1301: Na+/H+-dicarboxylate sym... 125 2e-27
gi|2127497|pir||S71005 glutamate transport protein homolog - Sac... 125 3e-27
gi|20137907|sp|Q98AV2|DTA1_RHILO C4-dicarboxylate transport prot... 125 3e-27
gi|13476029|ref|NP_107599.1| C4-dicarboxylate transport protein ... 125 3e-27
gi|13474864|ref|NP_106434.1| C4-dicarboxylate transport protein ... 125 3e-27
gi|50760912|ref|XP_418178.1| PREDICTED: similar to neuronal glut... 124 4e-27
gi|20804188|emb|CAD31391.1| PROBABLE C4-DICARBOXYLATE TRANSPORT ... 124 4e-27
gi|48786426|ref|ZP_00282560.1| COG1301: Na+/H+-dicarboxylate sym... 124 6e-27
gi|23106107|ref|ZP_00092561.1| COG1301: Na+/H+-dicarboxylate sym... 124 8e-27
gi|26987923|ref|NP_743348.1| C4-dicarboxylate transport protein ... 123 1e-26
gi|27376829|ref|NP_768358.1| C4-dicarboxylate transport protein ... 123 1e-26
gi|27378951|ref|NP_770480.1| C4-dicarboxylate transport protein ... 123 1e-26
gi|77979|pir||A33597 C4-dicarboxylate transport protein - Rhizob... 123 1e-26
gi|46315339|ref|ZP_00215922.1| COG1301: Na+/H+-dicarboxylate sym... 123 1e-26
gi|16265271|ref|NP_438063.1| C4-dicarboxylate transport protein ... 123 1e-26
gi|39935514|ref|NP_947790.1| C4-dicarboxylic acid transport prot... 122 2e-26
gi|27378834|ref|NP_770363.1| C4-dicarboxylate transport protein ... 122 2e-26
gi|48772239|ref|ZP_00276581.1| COG1301: Na+/H+-dicarboxylate sym... 122 2e-26
gi|32043272|ref|ZP_00140534.1| COG1301: Na+/H+-dicarboxylate sym... 122 3e-26
gi|23015278|ref|ZP_00055059.1| COG1301: Na+/H+-dicarboxylate sym... 122 3e-26
gi|27375214|ref|NP_766743.1| proton glutamate symport protein [B... 122 3e-26
gi|46320794|ref|ZP_00221178.1| COG1301: Na+/H+-dicarboxylate sym... 122 3e-26
gi|30271870|gb|AAP29969.1| C4-dicarboxylate transport protein [P... 121 4e-26
gi|15837258|ref|NP_297946.1| glutamate symport protein [Xylella ... 121 5e-26
gi|22994920|ref|ZP_00039407.1| COG1301: Na+/H+-dicarboxylate sym... 121 5e-26
gi|28199396|ref|NP_779710.1| glutamate symport protein [Xylella ... 121 5e-26
gi|22997253|ref|ZP_00041487.1| COG1301: Na+/H+-dicarboxylate sym... 121 5e-26
gi|15595317|ref|NP_248809.1| probable dicarboxylate transporter ... 120 8e-26
gi|26988979|ref|NP_744404.1| C4-dicarboxylate transporter [Pseud... 120 8e-26
gi|50084519|ref|YP_046029.1| putative glutamate symport transmem... 120 1e-25
gi|4545128|gb|AAD22406.1| DctA [Pseudomonas putida] 120 1e-25
gi|48785140|ref|ZP_00281445.1| COG1301: Na+/H+-dicarboxylate sym... 120 1e-25
gi|46316040|ref|ZP_00216620.1| COG1301: Na+/H+-dicarboxylate sym... 119 2e-25
gi|15485429|emb|CAC67523.1| putative glutamate/aspartate-proton ... 119 2e-25
gi|26988781|ref|NP_744206.1| C4-dicarboxylate transport protein ... 119 2e-25
gi|46913101|emb|CAG19890.1| hypothetical Na+/H+-dicarboxylate sy... 119 2e-25
gi|45515608|ref|ZP_00167162.1| COG1301: Na+/H+-dicarboxylate sym... 119 2e-25
gi|48771385|ref|ZP_00275727.1| COG1301: Na+/H+-dicarboxylate sym... 118 3e-25
gi|16124518|ref|NP_419082.1| sodium:dicarboxylate symporter fami... 118 4e-25
gi|46321102|ref|ZP_00221482.1| COG1301: Na+/H+-dicarboxylate sym... 118 4e-25
gi|29377482|ref|NP_816636.1| sodium:dicarboxylate symporter fami... 117 5e-25
gi|19553791|ref|NP_601793.1| Na+/H+-dicarboxylate symporter [Cor... 116 1e-24
gi|16124881|ref|NP_419445.1| sodium:dicarboxylate symporter fami... 116 2e-24
gi|20138046|sp|Q9PEQ2|DCTA_XYLFA C4-dicarboxylate transport protein 115 2e-24
gi|15837578|ref|NP_298266.1| C4-dicarboxylate transport protein ... 115 2e-24
gi|22995133|ref|ZP_00039615.1| COG1301: Na+/H+-dicarboxylate sym... 115 3e-24
gi|28198194|ref|NP_778508.1| C4-dicarboxylate transport protein ... 115 4e-24
gi|35187983|gb|AAQ84466.1| neutral amino acid transporter ASCT1 ... 115 4e-24
gi|15792516|ref|NP_282339.1| putative C4-dicarboxylate transport... 114 5e-24
gi|20138080|sp|Q9X7K6|DCTA_RHIGA C4-dicarboxylate transport prot... 114 5e-24
gi|22997681|ref|ZP_00041909.1| COG1301: Na+/H+-dicarboxylate sym... 114 6e-24
gi|27382298|ref|NP_773827.1| C4-dicarboxylate transport protein ... 114 8e-24
gi|50762082|ref|XP_424930.1| PREDICTED: similar to glutamate tra... 114 8e-24
gi|27381256|ref|NP_772785.1| C4-dicarboxylate transport protein ... 114 8e-24
gi|46019853|emb|CAE52376.1| putative glutamate/aspartate-proton ... 114 8e-24
gi|47573411|ref|ZP_00243450.1| COG1301: Na+/H+-dicarboxylate sym... 112 2e-23
gi|2459565|gb|AAB71742.1| glutamate transporter mEAAC1 [Mus musc... 112 3e-23
gi|46364513|ref|ZP_00227120.1| COG1301: Na+/H+-dicarboxylate sym... 111 5e-23
gi|46447368|ref|YP_008733.1| putative neutral amino acid (glutam... 110 9e-23
gi|18309929|ref|NP_561863.1| probable transmembrane symporter [C... 108 4e-22
gi|6174689|dbj|BAA85981.1| unnamed protein product [Shewanella v... 107 1e-21
gi|30023250|ref|NP_834881.1| Proton/sodium-glutamate symport pro... 106 2e-21
gi|50084228|ref|YP_045738.1| aerobic C4-dicarboxylate transport ... 104 5e-21
gi|15641248|ref|NP_230880.1| sodium/dicarboxylate symporter [Vib... 104 6e-21
gi|28898076|ref|NP_797681.1| sodium/dicarboxylate symporter [Vib... 103 1e-20
gi|21397678|ref|NP_653663.1| SDF, Sodium:dicarboxylate symporter... 103 1e-20
gi|49481199|ref|YP_039206.1| proton/sodium-glutamate symport pro... 102 2e-20
gi|27366340|ref|NP_761868.1| Na+/H+-dicarboxylate symporters [Vi... 102 2e-20
gi|34496653|ref|NP_900868.1| probable proton/sodium-glutamate sy... 102 2e-20
gi|50767056|ref|XP_423027.1| PREDICTED: similar to Excitatory am... 102 2e-20
gi|42784372|ref|NP_981619.1| proton/glutamate symporter family p... 102 2e-20
gi|28195284|gb|AAO27471.1| high-affinity glutamate transporter E... 101 4e-20
gi|21223795|ref|NP_629574.1| putative sodium:dicarboxylate sympo... 101 4e-20
gi|23098737|ref|NP_692203.1| H(+):sodium-glutamate symporter [Oc... 101 4e-20
gi|49184358|ref|YP_027610.1| proton/glutamate symporter protein,... 100 2e-19
gi|12653731|gb|AAH00651.1| SLC1A7 protein [Homo sapiens] 100 2e-19
gi|146056|gb|AAA23832.1| glutamate and aspartate carrier (gltP) 99 2e-19
gi|48131248|ref|XP_396679.1| similar to high-affinity glutamate ... 99 2e-19
gi|15609580|ref|NP_216959.1| dctA [Mycobacterium tuberculosis H3... 99 2e-19
gi|46324293|ref|ZP_00224654.1| COG1301: Na+/H+-dicarboxylate sym... 99 2e-19
gi|41719828|ref|ZP_00148689.1| COG1301: Na+/H+-dicarboxylate sym... 99 3e-19
gi|48730978|ref|ZP_00264724.1| COG1823: Predicted Na+/dicarboxyl... 98 6e-19
gi|45521461|ref|ZP_00172980.1| COG1301: Na+/H+-dicarboxylate sym... 98 6e-19
gi|46360353|gb|AAS89003.1| retina glutamate transporter GLT1c [R... 98 6e-19
gi|42519692|ref|NP_965622.1| hypothetical protein LJ0633 [Lactob... 98 6e-19
gi|42520124|ref|NP_966039.1| sodium/glutamate symporter family p... 96 2e-18
gi|15602200|ref|NP_245272.1| unknown [Pasteurella multocida Pm70... 96 2e-18
gi|34556831|ref|NP_906646.1| PUTATIVE C4-DICARBOXYLATE TRANSPORT... 96 3e-18
gi|23002638|ref|ZP_00046312.1| COG1823: Predicted Na+/dicarboxyl... 95 4e-18
gi|26991807|ref|NP_747232.1| sodium:dicarboxylate symporter fami... 94 6e-18
gi|50119600|ref|YP_048767.1| probable transporter [Erwinia carot... 94 8e-18
gi|30022325|ref|NP_833956.1| Proton/sodium-glutamate symport pro... 94 8e-18
gi|46913984|emb|CAG20766.1| putative sodium/dicarboxylate sympor... 94 1e-17
gi|49478591|ref|YP_038307.1| sodium:dicarboxylate symporter fami... 94 1e-17
gi|42783370|ref|NP_980617.1| sodium:dicarboxylate symporter fami... 94 1e-17
gi|30264318|ref|NP_846695.1| sodium:dicarboxylate symporter fami... 94 1e-17
gi|21401509|ref|NP_657494.1| SDF, Sodium:dicarboxylate symporter... 93 1e-17
gi|543221|pir||B49501 glutamate/aspartate transporter, GLU-T - m... 92 2e-17
gi|23100169|ref|NP_693636.1| sodium:glutamate symporter [Oceanob... 92 3e-17
gi|46308578|ref|ZP_00210770.1| COG1301: Na+/H+-dicarboxylate sym... 92 3e-17
gi|29375338|ref|NP_814492.1| sodium/dicarboxylate symporter fami... 92 3e-17
gi|42631456|ref|ZP_00156994.1| COG1823: Predicted Na+/dicarboxyl... 92 4e-17
gi|46143424|ref|ZP_00135273.2| COG1823: Predicted Na+/dicarboxyl... 91 5e-17
gi|48868020|ref|ZP_00321417.1| COG1823: Predicted Na+/dicarboxyl... 91 5e-17
gi|50121338|ref|YP_050505.1| putative sodium:dicarboxylate sympo... 91 5e-17
gi|29829357|ref|NP_823991.1| putative sodium:dicarboxylate sympo... 91 7e-17
gi|16121976|ref|NP_405289.1| putative transport protein [Yersini... 91 7e-17
gi|45441553|ref|NP_993092.1| putative transport protein [Yersini... 91 7e-17
gi|46128994|ref|ZP_00155584.2| COG1823: Predicted Na+/dicarboxyl... 91 7e-17
gi|15595074|ref|NP_212863.1| glutamate transporter (gltP) [Borre... 91 9e-17
gi|46916935|emb|CAG23698.1| putative sodium/dicarboxylate sympor... 90 1e-16
gi|46113369|ref|ZP_00200771.1| COG1301: Na+/H+-dicarboxylate sym... 90 1e-16
gi|16273079|ref|NP_439312.1| proton glutamate symport protein [H... 90 2e-16
gi|16764671|ref|NP_460286.1| kinase/transporter-like protein [Sa... 89 4e-16
gi|33241632|ref|NP_876573.1| amino acid (glutamate) transporter ... 89 4e-16
gi|27469272|ref|NP_765909.1| proton/sodium-glutamate symport pro... 89 4e-16
gi|50084380|ref|YP_045890.1| putative transport protein [Acineto... 88 5e-16
gi|16760574|ref|NP_456191.1| putative sodium:dicarboxylate sympo... 88 5e-16
gi|37526571|ref|NP_929915.1| hypothetical protein [Photorhabdus ... 88 5e-16
gi|15618209|ref|NP_224494.1| Neutral Amino Acid (Glutamate) Tran... 88 6e-16
gi|15835824|ref|NP_300348.1| neutral amino acid (glutamate) tran... 88 6e-16
gi|15923373|ref|NP_370907.1| hypothetical protein SAV0383 [Staph... 87 8e-16
gi|49482633|ref|YP_039857.1| putative sodium:dicarboxylate sympo... 87 1e-15
gi|42453375|ref|ZP_00153282.1| hypothetical protein Rick021601 [... 87 1e-15
gi|21282088|ref|NP_645176.1| ORFID:MW0359~hypothetical protein, ... 86 2e-15
gi|15802140|ref|NP_288162.1| part of a kinase [Escherichia coli ... 86 2e-15
gi|26247982|ref|NP_754022.1| Hypothetical symporter ydjN [Escher... 86 2e-15
gi|16129683|ref|NP_416243.1| hypothetical symporter; bifunctiona... 86 2e-15
gi|16764718|ref|NP_460333.1| putative Na+-dicarboxylate symporte... 84 7e-15
gi|46114202|ref|ZP_00184464.2| COG3633: Na+/serine symporter [Ex... 84 7e-15
gi|16120913|ref|NP_404226.1| putative symporter protein [Yersini... 84 7e-15
gi|48862227|ref|ZP_00316124.1| COG1301: Na+/H+-dicarboxylate sym... 84 7e-15
gi|22127469|ref|NP_670892.1| Na/dicarboxylate symporter [Yersini... 84 7e-15
gi|15792422|ref|NP_282245.1| putative transmembrane transport pr... 84 9e-15
gi|16761997|ref|NP_457614.1| probable membrane transport protein... 83 1e-14
gi|29143484|ref|NP_806826.1| probable membrane transport protein... 83 1e-14
gi|24374640|ref|NP_718683.1| sodium/dicarboxylate symporter [She... 83 2e-14
gi|16766524|ref|NP_462139.1| putative dicarboxylate permease [Sa... 82 3e-14
gi|19704483|ref|NP_604045.1| Serine/threonine sodium symporter [... 82 3e-14
gi|28901485|ref|NP_801140.1| sodium/dicarboxylate symporter [Vib... 82 3e-14
gi|16760539|ref|NP_456156.1| putative transporter [Salmonella en... 82 4e-14
gi|24112997|ref|NP_707507.1| putative transporter [Shigella flex... 82 4e-14
gi|46141592|ref|ZP_00146897.2| COG3633: Na+/serine symporter [Ps... 82 4e-14
gi|32450425|gb|AAH54455.1| Unknown (protein for MGC:62819) [Mus ... 81 6e-14
gi|15597238|ref|NP_250732.1| probable transporter (membrane subu... 81 6e-14
gi|15803630|ref|NP_289663.1| putative transport protein [Escheri... 81 7e-14
gi|25011722|ref|NP_736117.1| Unknown [Streptococcus agalactiae N... 81 7e-14
gi|49184357|ref|YP_027609.1| proton/glutamate symporter protein,... 81 7e-14
gi|27382206|ref|NP_773735.1| C4-dicarboxylate transport protein ... 80 1e-13
gi|22537775|ref|NP_688626.1| sodium:dicarboxylate symporter fami... 80 1e-13
gi|46314474|ref|ZP_00215060.1| COG1301: Na+/H+-dicarboxylate sym... 80 2e-13
gi|32042138|ref|ZP_00139721.1| COG3633: Na+/serine symporter [Ps... 80 2e-13
gi|18310149|ref|NP_562083.1| probable glutamate/ aspartate trans... 80 2e-13
gi|27367618|ref|NP_763145.1| Na+/serine symporter [Vibrio vulnif... 80 2e-13
>gi|17537407|ref|NP_496094.1| glutamate transporter (52.8 kD) (2J998)
[Caenorhabditis elegans]
gi|7510154|pir||T27128 hypothetical protein Y53C12A.2 -
Caenorhabditis elegans
gi|3881128|emb|CAB16485.1| Hypothetical protein Y53C12A.2
[Caenorhabditis elegans]
Length = 491
Score = 858 bits (2217), Expect = 0.0
Identities = 446/472 (94%), Positives = 446/472 (94%)
Frame = -1
Query: 1476 MGIASKKSVSRWTSWLTKNMLLLMTMAXXXXXXXXXXVLRTADPSPDVIRYVGFPGELFM 1297
MGIASKKSVSRWTSWLTKNMLLLMTMA VLRTADPSPDVIRYVGFPGELFM
Sbjct: 1 MGIASKKSVSRWTSWLTKNMLLLMTMAGIVMGVIIGGVLRTADPSPDVIRYVGFPGELFM 60
Query: 1296 NMLKAMVLPLIAASIVSGLSQLDGKTSGRLGSRAVMYYAITTTHAVILGIIVVSIIQPGD 1117
NMLKAMVLPLIAASIVSGLSQLDGKTSGRLGSRAVMYYAITTTHAVILGIIVVSIIQPGD
Sbjct: 61 NMLKAMVLPLIAASIVSGLSQLDGKTSGRLGSRAVMYYAITTTHAVILGIIVVSIIQPGD 120
Query: 1116 PTIKQKMGYDKEGEAANVSAAQKFLDLFRNAFPENIMRATFSQVQTNYINQTHSNGATHE 937
PTIKQKMGYDKEGEAANVSAAQKFLDLFRNAFPENIMRATFSQVQTNYINQTHSNGATHE
Sbjct: 121 PTIKQKMGYDKEGEAANVSAAQKFLDLFRNAFPENIMRATFSQVQTNYINQTHSNGATHE 180
Query: 936 VLHTGYVDGMNVLGIIVFCIVMGLVVSRIGEEAKALANLFHALDVVITRMVMLIMWLGPI 757
VLHTGYVDGMNVLGIIVFCIVMGLVVSRIGEEAKALANLFHALDVVITRMVMLIMWLGPI
Sbjct: 181 VLHTGYVDGMNVLGIIVFCIVMGLVVSRIGEEAKALANLFHALDVVITRMVMLIMWLGPI 240
Query: 756 GIPSLIAQKMLEVSDLWLTARMLGLFVFTVILGLAIQAFITLPLIYFIGTRHNPYTFLKG 577
GIPSLIAQKMLEVSDLWLTARMLGLFVFTVILGLAIQAFITLPLIYFIGTRHNPYTFLKG
Sbjct: 241 GIPSLIAQKMLEVSDLWLTARMLGLFVFTVILGLAIQAFITLPLIYFIGTRHNPYTFLKG 300
Query: 576 LGQAIMTALGTXXXXXSLPVTFRCLNKLGIDPRVTKFVLPVGAMVNMDGTALYEATASIF 397
LGQAIMTALGT SLPVTFRCLNKLGIDPRVTKFVLPVGAMVNMDGTALYEATASIF
Sbjct: 301 LGQAIMTALGTSSSAASLPVTFRCLNKLGIDPRVTKFVLPVGAMVNMDGTALYEATASIF 360
Query: 396 IAQMNGLELSIGQIVTVSITATLXXXXXXXXXXXGLVTMLIVLTALGLPANDISLILAVD 217
IAQMNGLELSIGQIVTVSITATL GLVTMLIVLTALGLPANDISLILAVD
Sbjct: 361 IAQMNGLELSIGQIVTVSITATLASIGAASIPSAGLVTMLIVLTALGLPANDISLILAVD 420
Query: 216 WFLDRLRTSVNVIGDALGCGFVHHICADHLNADVAEAEKNHAVVEAHGVNFD 61
WFLDRLRTSVNVIGDALGCGFVHHICADHLNADVAEAEKNHAVVEAHGVNFD
Sbjct: 421 WFLDRLRTSVNVIGDALGCGFVHHICADHLNADVAEAEKNHAVVEAHGVNFD 472
>gi|39589254|emb|CAE57987.1| Hypothetical protein CBG01050
[Caenorhabditis briggsae]
Length = 490
Score = 761 bits (1965), Expect = 0.0
Identities = 396/472 (83%), Positives = 415/472 (87%)
Frame = -1
Query: 1476 MGIASKKSVSRWTSWLTKNMLLLMTMAXXXXXXXXXXVLRTADPSPDVIRYVGFPGELFM 1297
MG+++ K +RWTSWLTKNMLLLMTMA VLR +PS ++++YVGFPGELFM
Sbjct: 1 MGMSTNKCGARWTSWLTKNMLLLMTMAGIVMGVIIGGVLRNLEPSQEIVKYVGFPGELFM 60
Query: 1296 NMLKAMVLPLIAASIVSGLSQLDGKTSGRLGSRAVMYYAITTTHAVILGIIVVSIIQPGD 1117
NMLKAMVLPLIAASIVSGLSQLDGKTSGRLGSRAVMYY ITTTHAVILGIIVVSII PGD
Sbjct: 61 NMLKAMVLPLIAASIVSGLSQLDGKTSGRLGSRAVMYYVITTTHAVILGIIVVSIIHPGD 120
Query: 1116 PTIKQKMGYDKEGEAANVSAAQKFLDLFRNAFPENIMRATFSQVQTNYINQTHSNGATHE 937
PTIKQKMG + EG AN SAAQKFLDLFRNAFPENIMRATFSQ QT+Y+N T+SNG
Sbjct: 121 PTIKQKMGIE-EGATANESAAQKFLDLFRNAFPENIMRATFSQYQTHYVNVTNSNGIQKT 179
Query: 936 VLHTGYVDGMNVLGIIVFCIVMGLVVSRIGEEAKALANLFHALDVVITRMVMLIMWLGPI 757
L TGYVDGMNVLGIIVFCIVMGLV+S+IGEEAK LANLFHALDVVITRMVM+IMWLGPI
Sbjct: 180 ELKTGYVDGMNVLGIIVFCIVMGLVISKIGEEAKPLANLFHALDVVITRMVMIIMWLGPI 239
Query: 756 GIPSLIAQKMLEVSDLWLTARMLGLFVFTVILGLAIQAFITLPLIYFIGTRHNPYTFLKG 577
GIPSLIAQKMLEVSDLW TAR+LGLFVFTVILGL IQAFITLPLIY IGTRHNPY FL G
Sbjct: 240 GIPSLIAQKMLEVSDLWQTARVLGLFVFTVILGLGIQAFITLPLIYVIGTRHNPYKFLSG 299
Query: 576 LGQAIMTALGTXXXXXSLPVTFRCLNKLGIDPRVTKFVLPVGAMVNMDGTALYEATASIF 397
LGQAIMTALGT SLPVTFRCLNKLGIDPRVTKFVLPVGAMVNMDGTALYEATASIF
Sbjct: 300 LGQAIMTALGTSSSAASLPVTFRCLNKLGIDPRVTKFVLPVGAMVNMDGTALYEATASIF 359
Query: 396 IAQMNGLELSIGQIVTVSITATLXXXXXXXXXXXGLVTMLIVLTALGLPANDISLILAVD 217
IAQMNGL+LS GQI+TVSITATL GLVTMLIVLTALGLPANDISLILAVD
Sbjct: 360 IAQMNGLDLSAGQIITVSITATLASIGAASIPSAGLVTMLIVLTALGLPANDISLILAVD 419
Query: 216 WFLDRLRTSVNVIGDALGCGFVHHICADHLNADVAEAEKNHAVVEAHGVNFD 61
W LDRLRTSVNVIGDALGCGFVHHICADHLNADVAEAEK HA VEAHGVNFD
Sbjct: 420 WVLDRLRTSVNVIGDALGCGFVHHICADHLNADVAEAEKAHAFVEAHGVNFD 471