Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y53C12B_2
         (873 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17535261|ref|NP_496098.1| male ABnormal MAB-3, DM DNA-binding...   440   e-122
gi|39589249|emb|CAE57982.1| Hypothetical protein CBG01045 [Caeno...   295   1e-78
gi|39589248|emb|CAE57981.1| Hypothetical protein CBG01044 [Caeno...   211   2e-53
gi|32563794|ref|NP_871909.1| male ABnormal MAB-3, putative prote...   132   8e-30
gi|17565692|ref|NP_507810.1| transcription factor (5U124) [Caeno...    69   1e-10
gi|27532961|ref|NP_082008.1| doublesex and mab-3 related transcr...    69   2e-10
gi|32490574|ref|NP_870987.1| doublesex and mab-3 related transcr...    68   2e-10
gi|20809693|gb|AAH29202.1| DMRTC2 protein [Homo sapiens]               68   2e-10
gi|24659689|gb|AAH39266.1| DMRTC2 protein [Homo sapiens]               68   2e-10
gi|5729806|ref|NP_006548.1| doublesex and mab-3 related transcri...    68   2e-10
gi|48143850|ref|XP_397480.1| similar to DM-related transcription...    68   2e-10
gi|14329696|emb|CAC40652.1| Doublesex-mab-3 (DM) domain [Homo sa...    68   3e-10
gi|8809752|gb|AAF79931.1| sex-determining protein DMT [Oreochrom...    68   3e-10
gi|34855342|ref|XP_218456.2| ribosomal protein S19 [Rattus norve...    68   3e-10
gi|39596960|emb|CAE59187.1| Hypothetical protein CBG02496 [Caeno...    68   3e-10
gi|25149528|ref|NP_495138.2| transcription factor (30.8 kD) (2G6...    67   4e-10
gi|32364760|gb|AAP80399.1| doublesex and mab-3 related transcrip...    67   4e-10
gi|7498797|pir||T16020 hypothetical protein F10C1.5 - Caenorhabd...    67   4e-10
gi|39585418|emb|CAE61740.1| Hypothetical protein CBG05691 [Caeno...    67   4e-10
gi|39593176|emb|CAE64645.1| Hypothetical protein CBG09411 [Caeno...    67   4e-10
gi|17558404|ref|NP_506289.1| transcription factor family member ...    67   4e-10
gi|32364762|gb|AAP80400.1| doublesex and mab-3 related transcrip...    67   4e-10
gi|32364758|gb|AAP80398.1| doublesex and mab-3 related transcrip...    67   4e-10
gi|32364764|gb|AAP80401.1| doublesex and mab-3 related transcrip...    67   4e-10
gi|47211841|emb|CAF90474.1| unnamed protein product [Tetraodon n...    66   9e-10
gi|42655790|ref|XP_027162.3| DMRT-like family A2 [Homo sapiens]        66   1e-09
gi|38141731|dbj|BAD00703.1| doublesex and mab-3 related transcri...    66   1e-09
gi|22653327|gb|AAN04011.1| DM domain protein [Acropora millepora]      66   1e-09
gi|10443639|gb|AAG17544.1| DMRT1 protein [Oncorhynchus mykiss]         65   1e-09
gi|17986183|ref|NP_524428.1| CG5737-PA [Drosophila melanogaster]...    65   1e-09
gi|24308342|ref|NP_149041.1| DMRT-like family C2 [Homo sapiens] ...    65   1e-09
gi|26986623|ref|NP_758500.1| doublesex and mab-3 related transcr...    65   1e-09
gi|34870318|ref|XP_233363.2| similar to doublesex- and mab-3-rel...    65   1e-09
gi|37359221|gb|AAN78445.1| DM-related transcriptional factor Dmr...    65   1e-09
gi|13940223|emb|CAC37946.1| doublesex-mab-3 (DM) domain [Homo sa...    65   1e-09
gi|32483421|gb|AAP84972.1| DMRT 1 [Acanthopagrus schlegelii]           65   1e-09
gi|19070559|gb|AAL83919.1| DM-domain containing transcription fa...    65   2e-09
gi|17986191|ref|NP_524549.1| CG15504-PA [Drosophila melanogaster...    65   2e-09
gi|47123011|gb|AAH70678.1| MGC83057 protein [Xenopus laevis]           65   2e-09
gi|28316744|ref|NP_783578.1| doublesex and mab-3 related transcr...    65   3e-09
gi|46195737|ref|NP_071443.1| DMRT-like family A1 [Homo sapiens] ...    65   3e-09
gi|48135209|ref|XP_396746.1| similar to CG15504-PA [Apis mellifera]    65   3e-09
gi|34869600|ref|XP_233182.2| similar to doublesex and mab-3 rela...    65   3e-09
gi|27728754|gb|AAO18650.1| doublesex and mab-3 related transcrip...    65   3e-09
gi|14571695|emb|CAC42778.1| DM domain-containing transcription f...    65   3e-09
gi|37727289|gb|AAO41737.1| doublesex and mab-3 related transcrip...    65   3e-09
gi|15592929|gb|AAL02163.1| DMRT2 [Oryzias latipes]                     64   3e-09
gi|29789377|ref|NP_665830.1| terra; terra homolog (Zebrafish) [M...    64   3e-09
gi|15216289|dbj|BAB63259.1| OlaDMRT4 [Oryzias latipes]                 64   3e-09
gi|34862134|ref|XP_219926.2| similar to doublesex and mab-3 rela...    64   3e-09
gi|33989348|gb|AAH52041.2| Doublesex and mab-3 related transcrip...    64   3e-09
gi|28893523|ref|NP_796334.1| doublesex and mab-3 related transcr...    64   3e-09
gi|37781783|gb|AAO74158.1| DM-related transcriptional factor Dmr...    64   3e-09
gi|37727287|gb|AAO41736.1| doublesex and mab-3 related transcrip...    64   3e-09
gi|39983009|gb|AAR34460.1| sex-determining protein DMO [Oreochro...    64   3e-09
gi|11056048|ref|NP_067063.1| doublesex and mab-3 related transcr...    64   3e-09
gi|9743439|gb|AAF79932.2| sex-determining protein DMO [Oreochrom...    64   3e-09
gi|31203439|ref|XP_310668.1| ENSANGP00000020063 [Anopheles gambi...    64   3e-09
gi|40254566|ref|NP_056641.2| doublesex and mab-3 related transcr...    64   3e-09
gi|12643840|sp|Q9QZ59|DMT1_MOUSE Doublesex- and mab-3-related tr...    64   3e-09
gi|16758526|ref|NP_446158.1| doublesex and mab-3 related transcr...    64   3e-09
gi|6522829|emb|CAB62040.1| similar to (M25292) doublesex protein...    64   3e-09
gi|37727281|gb|AAO41733.1| doublesex and mab-3 related transcrip...    64   3e-09
gi|33315845|gb|AAQ04554.1| DMRT1 [Clarias gariepinus]                  64   3e-09
gi|40748271|gb|AAR89619.1| doublesex and mab-3 related transcrip...    64   4e-09
gi|23428505|gb|AAL18253.1| DMRT1 form ST2 [Acipenser transmontanus]    64   4e-09
gi|39585417|emb|CAE61739.1| Hypothetical protein CBG05690 [Caeno...    64   4e-09
gi|7328177|emb|CAB82427.1| human DMRT1 protein related to Drosop...    64   4e-09
gi|47523030|ref|NP_999276.1| doublesex and mab-3 related transcr...    64   4e-09
gi|11386173|ref|NP_068770.1| doublesex and mab-3 related transcr...    64   4e-09
gi|23428500|gb|AAL18252.1| DMRT1 form ST1 [Acipenser transmontanus]    64   4e-09
gi|6601570|gb|AAF19034.1| doublesex and mab-3 related transcript...    64   4e-09
gi|29027651|dbj|BAC65996.1| DMRT1 protein [Oryzias curvinotus]         64   6e-09
gi|24943244|gb|AAN65377.1| DMRT1 transcription factor [Xiphophor...    64   6e-09
gi|37359219|gb|AAN78446.1| DM-related transcriptional factor Dmr...    64   6e-09
gi|14571697|emb|CAC42780.1| DM domain-containing transcription f...    64   6e-09
gi|50790276|ref|XP_427822.1| PREDICTED: similar to Doublesex and...    64   6e-09
gi|19070561|gb|AAL83920.1| DM-domain containing transcription fa...    64   6e-09
gi|18859475|ref|NP_571027.1| terra [Danio rerio] >gnl|BL_ORD_ID|...    64   6e-09
gi|30088779|gb|AAO63771.1| putative zinc finger transcription fa...    64   6e-09
gi|37724020|gb|AAO23675.1| putative zinc finger transcription fa...    64   6e-09
gi|37724059|gb|AAN61065.1| doublesex- and mab-3-related transcri...    63   7e-09
gi|37724053|gb|AAN61062.1| doublesex- and mab-3-related transcri...    63   7e-09
gi|28950672|gb|AAO23674.1| putative zinc finger transcription fa...    63   7e-09
gi|14571696|emb|CAC42779.1| DM domain-containing transcription f...    63   7e-09
gi|47221532|emb|CAG08194.1| unnamed protein product [Tetraodon n...    63   7e-09
gi|8347086|emb|CAB93971.1| hypothetical protein [Tetraodon nigro...    63   7e-09
gi|47225637|emb|CAG07980.1| unnamed protein product [Tetraodon n...    63   7e-09
gi|8745329|gb|AAF78891.1| putative DM domain protein [Homo sapiens]    63   7e-09
gi|8249918|emb|CAB93343.1| hypothetical protein [Mus musculus]         63   7e-09
gi|33315848|gb|AAQ04555.1| Dmrt1 [Danio rerio]                         63   7e-09
gi|37724049|gb|AAN61060.1| doublesex- and mab-3-related transcri...    63   7e-09
gi|40716452|gb|AAR88764.1| DMRT1 isoform b [Oryzias latipes]           63   7e-09
gi|37724057|gb|AAN61064.1| doublesex- and mab-3-related transcri...    63   7e-09
gi|37724061|gb|AAN61066.1| doublesex- and mab-3-related transcri...    63   7e-09
gi|15592932|gb|AAL02164.1| DMRT3 [Oryzias latipes]                     63   7e-09
gi|15592926|gb|AAL02162.1| DMRT1 [Oryzias latipes]                     63   7e-09
gi|37724055|gb|AAN61063.1| doublesex- and mab-3-related transcri...    63   7e-09
gi|20522006|dbj|BAB92012.1| DMY protein [Oryzias latipes] >gnl|B...    63   1e-08
gi|34862136|ref|XP_219927.2| similar to doublesex and mab-3 rela...    63   1e-08
gi|29027649|dbj|BAC65995.1| DMY protein [Oryzias curvinotus]           62   1e-08
gi|12643832|sp|Q9PTQ7|DMT1_CHICK Doublesex- and mab-3-related tr...    62   1e-08
gi|25396157|pir||E88925 protein T22H9.4 [imported] - Caenorhabdi...    62   2e-08
gi|32566053|ref|NP_503176.2| DM DNA-binding containing protein f...    62   2e-08
gi|31242635|ref|XP_321748.1| ENSANGP00000016774 [Anopheles gambi...    62   2e-08
gi|24641758|ref|NP_511146.2| CG15749-PA [Drosophila melanogaster...    62   2e-08
gi|39588751|emb|CAE58275.1| Hypothetical protein CBG01382 [Caeno...    62   2e-08
gi|25989745|gb|AAN74844.1| sex-specific transcription factor DMR...    61   4e-08
gi|23345007|gb|AAN17676.1| sex-specific transcription factor DMR...    61   4e-08
gi|48104711|ref|XP_392966.1| similar to ENSANGP00000016774 [Apis...    61   4e-08
gi|47221531|emb|CAG08193.1| unnamed protein product [Tetraodon n...    61   4e-08
gi|40748275|gb|AAR89621.1| doublesex and mab-3 related transcrip...    60   5e-08
gi|15592935|gb|AAL02165.1| DMRT1 [Oryzias latipes]                     60   5e-08
gi|39596621|emb|CAE63240.1| Hypothetical protein CBG07603 [Caeno...    60   5e-08
gi|17550670|ref|NP_510466.1| transcription factor (XP476) [Caeno...    60   5e-08
gi|32482451|gb|AAP84606.1| DMRT1 transcription factor [Odontesth...    60   8e-08
gi|39593177|emb|CAE64646.1| Hypothetical protein CBG09413 [Caeno...    60   8e-08
gi|22795029|gb|AAN05398.1| male sex-determining protein [Oryzias...    59   1e-07
gi|38564769|gb|AAR23812.1| DSXF [Musca domestica]                      59   1e-07
gi|38564771|gb|AAR23813.1| DSXM [Musca domestica]                      59   1e-07
gi|31201307|ref|XP_309601.1| ENSANGP00000004060 [Anopheles gambi...    58   2e-07
gi|13774296|gb|AAK38832.1| male-specific doublesex protein [Mega...    57   4e-07
gi|24644936|ref|NP_731198.1| CG11094-PB [Drosophila melanogaster...    57   4e-07
gi|2827985|gb|AAB99948.1| doublesex [Bactrocera tryoni]                57   4e-07
gi|475973|gb|AAA17840.1| doublesex                                     57   4e-07
gi|11230443|emb|CAC16590.1| putative DMO orthologue [Homo sapiens]     57   4e-07
gi|24637186|gb|AAN63598.1| double-sex [Ceratitis capitata]             57   4e-07
gi|46019689|emb|CAD67987.1| male-specific doublesex protein [Bac...    57   4e-07
gi|13774294|gb|AAK38831.1| female-specific doublesex protein [Me...    57   4e-07
gi|46019687|emb|CAD67986.1| female-specific doublesex protein [B...    57   4e-07
gi|24644934|ref|NP_731197.1| CG11094-PA [Drosophila melanogaster...    57   4e-07
gi|2827983|gb|AAB99947.1| doublesex [Bactrocera tryoni]                57   4e-07
gi|24637184|gb|AAN63597.1| double-sex [Ceratitis capitata]             57   4e-07
gi|16648062|gb|AAL25296.1| GH08308p [Drosophila melanogaster]          57   5e-07
gi|38085756|ref|XP_357085.1| similar to doublesex and mab-3 rela...    57   5e-07
gi|10443643|gb|AAG17546.1| DMRT4 protein [Oncorhynchus mykiss]         56   9e-07
gi|40748273|gb|AAR89620.1| doublesex and mab-3 related transcrip...    56   9e-07
gi|22531371|emb|CAD44608.1| doublesex-related protein [Gadus mor...    56   9e-07
gi|34870302|ref|XP_233356.2| similar to doublesex and mab-3 rela...    56   9e-07
gi|47221533|emb|CAG08195.1| unnamed protein product [Tetraodon n...    55   2e-06
gi|40716454|gb|AAR88765.1| DMRT1 isoform d [Oryzias latipes]           55   2e-06
gi|22531369|emb|CAD44607.1| doublesex-related protein [Hippoglos...    55   2e-06
gi|48728376|gb|AAT46354.1| DM domain protein [Artemia sinica]          54   3e-06
gi|24308352|ref|NP_149056.1| DMRT-like family B with proline-ric...    54   3e-06
gi|37624806|gb|AAQ96172.1| DMRT1 [Alligator sinensis]                  54   4e-06
gi|48715084|emb|CAG30925.1| doublesex and mab-3 related transcri...    54   4e-06
gi|25155106|ref|NP_741624.1| male ABnormal MAB-23, putative tran...    54   4e-06
gi|10443641|gb|AAG17545.1| DMRT2 protein [Oncorhynchus mykiss]         53   1e-05
gi|10119786|dbj|BAB13471.1| BmDSX-F [Bombyx mori]                      53   1e-05
gi|11967930|dbj|BAB19780.1| female-specific splicing product [Bo...    53   1e-05
gi|10119788|dbj|BAB13472.1| BmDSX-M [Bombyx mori]                      53   1e-05
gi|11967931|dbj|BAB19781.1| male-specific splicing product [Bomb...    53   1e-05
gi|50751838|ref|XP_426663.1| PREDICTED: similar to DMRT-like fam...    52   1e-05
gi|14571795|emb|CAC42783.1| DM domain-containing transcription f...    52   1e-05
gi|38078632|ref|XP_205469.2| DMRT-like family B with proline-ric...    52   2e-05
gi|25992727|gb|AAN77235.1| doublesex and mab-3 related transcrip...    52   2e-05
gi|39593391|emb|CAE64861.1| Hypothetical protein CBG09659 [Caeno...    52   2e-05
gi|14329700|emb|CAC40654.1| doublesex-mab-3 (DM) domain [Homo sa...    51   3e-05
gi|24158883|pdb|1LPV|A Chain A, Drosophila Melanogaster Doublese...    50   5e-05
gi|48100520|ref|XP_392621.1| similar to doublesex [Apis mellifera]     49   1e-04
gi|39583475|emb|CAE73933.1| Hypothetical protein CBG21552 [Caeno...    46   0.001
gi|17539826|ref|NP_502770.1| DM DNA-binding containing protein (...    46   0.001
gi|17539828|ref|NP_502771.1| DM DNA-binding containing protein (...    46   0.001
gi|31376302|dbj|BAC77242.1| DMY protein [Oryzias latipes]              43   0.008
gi|12229800|sp|P57690|DMT1_TRASC Doublesex- and mab-3-related tr...    43   0.010
gi|27462982|gb|AAO15678.1| DMRT1-like protein [Calotes versicolor]     43   0.010
gi|27734126|ref|NP_775605.1| hypothetical protein C130032F08 [Mu...    41   0.039
gi|27710298|ref|XP_231724.1| similar to hypothetical protein C13...    41   0.039
gi|7505494|pir||T25807 hypothetical protein K08B12.2 - Caenorhab...    40   0.051
gi|25149479|ref|NP_741551.1| DM DNA-binding containing protein f...    40   0.051
gi|17543946|ref|NP_500305.1| DMY protein like family member (4E1...    40   0.067
gi|17558402|ref|NP_506288.1| transcription factor (5N704) [Caeno...    40   0.088
gi|39594273|emb|CAE71851.1| Hypothetical protein CBG18895 [Caeno...    39   0.20
gi|40716456|gb|AAR88766.1| DMRT1 isoform b [Gallus gallus]             38   0.26
gi|40716458|gb|AAR88767.1| DMRT1 isoform c [Gallus gallus]             38   0.26
gi|40716462|gb|AAR88769.1| DMRT1 isoform e [Gallus gallus]             38   0.26
gi|40716464|gb|AAR88770.1| DMRT1 isoform f [Gallus gallus]             38   0.26
gi|40716466|gb|AAR88771.1| DMRT1 isoform g [Gallus gallus]             38   0.26
gi|41054179|ref|NP_956115.1| Tnf receptor-associated factor 6; w...    38   0.33
gi|47716905|gb|AAT37634.1| TNF-receptor associated factor 6 [Dan...    38   0.33
gi|26324804|dbj|BAC26156.1| unnamed protein product [Mus musculu...    37   0.44
gi|39585695|emb|CAE59897.1| Hypothetical protein CBG03381 [Caeno...    37   0.44
gi|13940225|emb|CAC37947.1| doublesex-mab-3 (DM) domain [Homo sa...    37   0.44
gi|34785654|gb|AAH57094.1| Unknown (protein for MGC:73514) [Mus ...    37   0.44
gi|40716460|gb|AAR88768.1| DMRT1 isoform d [Gallus gallus]             37   0.57
gi|50757735|ref|XP_415625.1| PREDICTED: hypothetical protein XP_...    35   2.2
gi|32493227|gb|AAP85628.1| mab-3 related transcription factor 6 ...    34   3.7
gi|31196519|ref|XP_307207.1| ENSANGP00000014556 [Anopheles gambi...    34   3.7
gi|10442780|gb|AAG15564.1| doublesex-related protein Dmrt15 [Cot...    34   4.8
gi|10567718|gb|AAG18555.1| doublesex-like protein Dmrt5 [Mastace...    34   4.8
gi|10442778|gb|AAG15563.1| doublesex-related protein Dmrt6 [Cotu...    34   4.8
gi|28828363|gb|AAM09332.2| similar to Homo sapiens (Human). Dent...    34   4.8
gi|15223171|ref|NP_174512.1| zinc finger (C3HC4-type RING finger...    34   4.8
gi|32493229|gb|AAP85629.1| mab-3 related transcription factor 7 ...    33   6.3
gi|38073484|gb|AAR10851.1| ariadne-like ubiquitin ligase RbrA [D...    33   6.3
gi|46228923|gb|EAK89772.1| protein with 2 pleckstrin homology (P...    33   6.3
gi|32398671|emb|CAD98631.1| 41 Kd oocyst wall protein [Cryptospo...    33   6.3
gi|50257983|gb|EAL20677.1| hypothetical protein CNBE0430 [Crypto...    33   8.2
gi|32493223|gb|AAP85626.1| mab-3 related transcription factor 1 ...    33   8.2
gi|50257984|gb|EAL20678.1| hypothetical protein CNBE0430 [Crypto...    33   8.2


>gi|17535261|ref|NP_496098.1| male ABnormal MAB-3, DM DNA-binding
           containing protein family member (mab-3) [Caenorhabditis
           elegans]
 gi|12229851|sp|O18214|MAB3_CAEEL Male abnormal-3 protein
 gi|7510162|pir||T27132 transcription factor MAB-3 homolog -
           Caenorhabditis elegans
 gi|2906000|gb|AAC38956.1| putative transcription factor MAB-3
           [Caenorhabditis elegans]
 gi|3881132|emb|CAB16489.1| C. elegans MAB-3 protein (corresponding
           sequence Y53C12B.5a) [Caenorhabditis elegans]
          Length = 290

 Score =  440 bits (1131), Expect = e-122
 Identities = 221/290 (76%), Positives = 221/290 (76%)
 Frame = +1

Query: 1   MLTEDPVSEICEAKAVDELAEQEKNYYCQRCLNHGELKPRKGHKPDCRYLKCPCRECTMV 180
           MLTEDPVSEICEAKAVDELAEQEKNYYCQRCLNHGELKPRKGHKPDCRYLKCPCRECTMV
Sbjct: 1   MLTEDPVSEICEAKAVDELAEQEKNYYCQRCLNHGELKPRKGHKPDCRYLKCPCRECTMV 60

Query: 181 EQRRQLNNLLSKKKIHCTPATQTRDGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCE 360
           EQRRQLNNLLSKKKIHCTPATQTRDGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCE
Sbjct: 61  EQRRQLNNLLSKKKIHCTPATQTRDGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCE 120

Query: 361 CTLCTLVEHRRNLMAAQIKLRRSQQKSRDGKEPKRNSRRKSKDMDMEMMVVTATDGQKII 540
           CTLCTLVEHRRNLMAAQIKLRRSQQKSRDGKEPKRNSRRKSKDMDMEMMVVTATDGQKII
Sbjct: 121 CTLCTLVEHRRNLMAAQIKLRRSQQKSRDGKEPKRNSRRKSKDMDMEMMVVTATDGQKII 180

Query: 541 GXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLAQYTLTLAAXXXXXXXXXXXXXXXXXXXX 720
           G                            LLAQYTLTLAA
Sbjct: 181 GTSASPSPSSTTDTMSPSLSMSPPCSPSPLLAQYTLTLAAPIPIYPPIPMNQQLISLQQQ 240

Query: 721 XXXXXXXXXMAPSIGQQAPLLPXXXXXXXXXXXXLNEFWSMYLKNYGLQA 870
                    MAPSIGQQAPLLP            LNEFWSMYLKNYGLQA
Sbjct: 241 QFLMSIIQNMAPSIGQQAPLLPGISAGSVSSAAILNEFWSMYLKNYGLQA 290




[DB home][top]