Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y53H1A_1
(1215 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17509625|ref|NP_492877.1| hypermethylated in cancer 2 like (5... 655 0.0
gi|39592412|emb|CAE63489.1| Hypothetical protein CBG07957 [Caeno... 345 9e-94
gi|31240667|ref|XP_320747.1| ENSANGP00000020217 [Anopheles gambi... 70 1e-10
gi|31200075|ref|XP_308985.1| ENSANGP00000020210 [Anopheles gambi... 68 4e-10
gi|19115021|ref|NP_594109.1| hypothetical zinc-finger protein; p... 67 1e-09
gi|37540450|ref|XP_098940.2| similar to zinc finger protein 11b ... 67 1e-09
gi|50803164|ref|XP_428657.1| PREDICTED: similar to zinc finger p... 66 1e-09
gi|37574094|ref|NP_932120.1| RIKEN cDNA 1300003B13 [Mus musculus... 65 4e-09
gi|34785968|gb|AAH58040.1| ZNF557 protein [Homo sapiens] 64 5e-09
gi|7656697|gb|AAF66074.1| Zinc finger protein 230 [amino acids 7... 64 5e-09
gi|13236593|ref|NP_077317.1| zinc finger protein 557 [Homo sapie... 64 5e-09
gi|40807459|ref|NP_955473.1| zinc finger protein 334 isoform b [... 64 5e-09
gi|21754798|dbj|BAC04567.1| unnamed protein product [Homo sapiens] 64 5e-09
gi|6598826|gb|AAF18685.1| ZNF230-like [Homo sapiens] 64 5e-09
gi|7022523|dbj|BAA91630.1| unnamed protein product [Homo sapiens] 64 5e-09
gi|40807457|ref|NP_060572.3| zinc finger protein 334 isoform a [... 64 5e-09
gi|9800824|emb|CAC03544.1| bA179N14.1 (novel zinc finger protein... 64 5e-09
gi|21739500|emb|CAD38791.1| hypothetical protein [Homo sapiens] 64 5e-09
gi|6840857|gb|AAF28801.1| hypermethylated in cancer 2 protein; H... 64 7e-09
gi|34869945|ref|XP_221303.2| similar to Hypermethylated in cance... 64 7e-09
gi|31657121|ref|NP_055909.1| hypermethylated in cancer 2; HIC1-r... 64 7e-09
gi|20454983|sp|Q96JB3|HIC2_HUMAN Hypermethylated in cancer 2 pro... 64 7e-09
gi|48429263|sp|Q9JLZ6|HIC2_MOUSE Hypermethylated in cancer 2 pro... 64 7e-09
gi|37360196|dbj|BAC98076.1| mKIAA1020 protein [Mus musculus] 64 7e-09
gi|2116688|dbj|BAA11178.1| deltaEF1 [Gallus gallus] 64 7e-09
gi|45384096|ref|NP_990462.1| deltaEF1 [Gallus gallus] >gnl|BL_OR... 64 7e-09
gi|29244118|ref|NP_808352.1| hypothetical protein LOC232337; cDN... 64 7e-09
gi|141651|sp|P18727|ZG52_XENLA Gastrula zinc finger protein XLCG... 64 7e-09
gi|11359986|pir||T47181 hypothetical protein DKFZp434F0616.1 - h... 64 7e-09
gi|20521730|dbj|BAA82972.2| KIAA1020 protein [Homo sapiens] 64 7e-09
gi|28279935|gb|AAH44333.1| MGC53639 protein [Xenopus laevis] 64 7e-09
gi|27498865|ref|XP_046861.2| KRAB box containing C2H2 type zinc ... 64 9e-09
gi|12314165|emb|CAC12728.1| bA526D8.4 (novel KRAB box containing... 64 9e-09
gi|5454182|ref|NP_006291.1| zinc finger protein 230 [Homo sapien... 64 9e-09
gi|45384536|ref|NP_990567.1| gammaFBP-A [Gallus gallus] >gnl|BL_... 63 1e-08
gi|1519546|gb|AAB72012.1| XFDL141 [Xenopus laevis] 63 1e-08
gi|479058|emb|CAA55652.1| gammaFBP-B [Gallus gallus] 63 1e-08
gi|38086044|ref|XP_205300.3| RIKEN cDNA 6330583I20 gene [Mus mus... 63 1e-08
gi|20454977|sp|Q90850|HIC1_CHICK Hypermethylated in cancer 1 pro... 63 1e-08
gi|38648696|gb|AAH63066.1| Unknown (protein for MGC:67278) [Mus ... 63 1e-08
gi|34858365|ref|XP_342746.1| hypothetical protein XP_342745 [Rat... 63 1e-08
gi|14718539|gb|AAK72951.1| HIC-3 [Homo sapiens] 63 1e-08
gi|7021053|dbj|BAA91367.1| unnamed protein product [Homo sapiens... 63 2e-08
gi|50795897|ref|XP_428145.1| PREDICTED: similar to zinc finger p... 63 2e-08
gi|13124583|sp|Q60542|TCF8_MESAU Transcription factor 8 (Zinc fi... 63 2e-08
gi|37655175|ref|NP_062537.2| zinc finger protein 26 (KOX 20) [Ho... 63 2e-08
gi|30584287|gb|AAP36392.1| Homo sapiens zinc finger protein 26 (... 63 2e-08
gi|50760431|ref|XP_418019.1| PREDICTED: similar to hypothetical ... 63 2e-08
gi|34860149|ref|XP_219346.2| similar to RIKEN cDNA G630024C07 ge... 63 2e-08
gi|21749858|dbj|BAC03673.1| unnamed protein product [Homo sapiens] 62 2e-08
gi|28175524|gb|AAH43301.1| BC043301 protein [Mus musculus] 62 2e-08
gi|28077091|ref|NP_110378.2| transcription factor 8 (represses i... 62 2e-08
gi|6166575|sp|P37275|TCF8_HUMAN Transcription factor 8 (NIL-2-A ... 62 2e-08
gi|41151491|ref|XP_092995.4| zinc finger protein 21 (KOX 14) [Ho... 62 2e-08
gi|47226672|emb|CAG07831.1| unnamed protein product [Tetraodon n... 62 2e-08
gi|33504519|ref|NP_878289.1| hypermethylated in cancer 2 [Danio ... 62 2e-08
gi|50756215|ref|XP_415063.1| PREDICTED: similar to hypermethylat... 62 2e-08
gi|6325444|ref|NP_015512.1| Transcription factor IIIA (TFIIIA) w... 62 2e-08
gi|50755701|ref|XP_414860.1| PREDICTED: similar to p120E4F [Gall... 62 2e-08
gi|1518090|gb|AAB07010.1| zinc finger protein XFDL 141 [Xenopus ... 62 2e-08
gi|47217262|emb|CAG01485.1| unnamed protein product [Tetraodon n... 62 2e-08
gi|28893511|ref|NP_796336.1| mesenchymal stem cell protein DSC43... 62 2e-08
gi|14456631|emb|CAC41951.1| dJ54B20.4 (novel KRAB box containing... 62 2e-08
gi|38571662|gb|AAH62882.1| G630024C07Rik protein [Mus musculus] 62 2e-08
gi|47227761|emb|CAG08924.1| unnamed protein product [Tetraodon n... 62 2e-08
gi|6911896|emb|CAB72252.1| heavy metal-responsive transcription ... 62 3e-08
gi|24661613|ref|NP_648311.2| CG3743-PA [Drosophila melanogaster]... 62 3e-08
gi|1362790|pir||A56242 E-box-binding repressor ZEB - human (frag... 62 3e-08
gi|11065699|emb|CAC14279.1| heavy metal-responsive transcription... 62 3e-08
gi|644840|gb|AAA62155.1| ZEB 62 3e-08
gi|50748368|ref|XP_421215.1| PREDICTED: similar to hypothetical ... 62 3e-08
gi|6005970|ref|NP_009078.1| zinc finger protein 175 [Homo sapien... 62 3e-08
gi|1518092|gb|AAB07011.1| zinc finger protein XFDL 156 [Xenopus ... 62 3e-08
gi|47086801|ref|NP_997782.1| YY1 transcription factor [Danio rer... 62 3e-08
gi|38081850|ref|XP_204906.3| similar to zinc finger protein 91 (... 62 3e-08
gi|141650|sp|P18724|ZG49_XENLA Gastrula zinc finger protein XLCG... 62 3e-08
gi|8394006|ref|NP_059060.1| zinc finger protein 146; pancreas zi... 62 3e-08
gi|109837|pir||S10245 finger protein, testis - mouse >gnl|BL_ORD... 62 3e-08
gi|38081848|ref|XP_139814.4| similar to KRAB zinc finger protein... 62 3e-08
gi|12644133|sp|P17141|ZF37_MOUSE Zinc finger protein 37 (Zfp-37)... 62 3e-08
gi|27734903|ref|NP_775819.1| zinc finger protein 584 [Homo sapie... 62 3e-08
gi|38566704|ref|NP_766342.1| Kruppel-like zinc finger protein [M... 62 4e-08
gi|16307459|gb|AAH10277.1| Kruppel-like zinc finger protein [Mus... 62 4e-08
gi|29539555|dbj|BAC67660.1| KIAA2033 protein [Homo sapiens] 62 4e-08
gi|7959277|dbj|BAA96032.1| KIAA1508 protein [Homo sapiens] 62 4e-08
gi|40254940|ref|NP_065931.2| zinc finger protein 530 [Homo sapie... 62 4e-08
gi|14042803|dbj|BAB55400.1| unnamed protein product [Homo sapiens] 62 4e-08
gi|47077047|dbj|BAD18456.1| unnamed protein product [Homo sapiens] 62 4e-08
gi|25014093|ref|NP_689492.2| zinc finger protein 585B; zinc fing... 62 4e-08
gi|2689443|gb|AAC24609.1| R28830_2 [Homo sapiens] 62 4e-08
gi|41208815|ref|XP_371192.1| similar to KIAA2033 protein [Homo s... 62 4e-08
gi|6756073|ref|NP_035676.1| zinc finger homeobox 1a; transcripti... 62 4e-08
gi|1220420|gb|AAB08442.1| zinc finger protein 62 4e-08
gi|2134079|pir||I51699 gene XGF 5.1C protein - African clawed fr... 61 5e-08
gi|39580765|emb|CAE58934.1| Hypothetical protein CBG02201 [Caeno... 61 5e-08
gi|732429|sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 (... 61 5e-08
gi|14017829|dbj|BAB47435.1| KIAA1806 protein [Homo sapiens] 61 5e-08
gi|50540468|ref|NP_001002314.1| hypermethylated in cancer 1 [Dan... 61 5e-08
gi|24307875|ref|NP_008886.1| zinc finger protein 11b (KOX 2) [Ho... 61 5e-08
gi|6249687|gb|AAF06067.1| R31155_1 [Homo sapiens] 61 5e-08
gi|31230865|ref|XP_318440.1| ENSANGP00000002806 [Anopheles gambi... 61 5e-08
gi|46443779|gb|EAL03058.1| hypothetical protein CaO19.3928 [Cand... 61 5e-08
gi|20336724|ref|NP_115809.1| zinc finger protein 333 [Homo sapie... 61 5e-08
gi|12831178|gb|AAK08499.1| zinc finger protein [Agelaius phoenic... 61 5e-08
gi|65328|emb|CAA50390.1| XGF 5.1A [Xenopus laevis] 61 5e-08
gi|2134063|pir||S65084 finger protein XFG 5-1 - African clawed f... 61 5e-08
gi|17506787|ref|NP_492723.1| drosophila ODD-skipped-like (odd-3)... 61 5e-08
gi|47085865|ref|NP_998285.1| zgc:64207 [Danio rerio] >gnl|BL_ORD... 61 5e-08
gi|47230118|emb|CAG10532.1| unnamed protein product [Tetraodon n... 61 5e-08
gi|50417587|gb|AAH77645.1| Unknown (protein for MGC:86496) [Xeno... 61 5e-08
gi|33859678|ref|NP_060349.1| hypothetical protein FLJ20557 [Homo... 61 5e-08
gi|38304048|gb|AAH62078.1| Unknown (protein for MGC:72612) [Ratt... 61 5e-08
gi|3264846|gb|AAC24607.1| R27945_2 [Homo sapiens] 61 5e-08
gi|49095098|ref|XP_409010.1| hypothetical protein AN4873.2 [Aspe... 61 5e-08
gi|1079317|pir||JC2426 transcription activator/repressor protein... 61 6e-08
gi|39930431|ref|NP_081561.1| RIKEN cDNA 1700029I01 [Mus musculus... 61 6e-08
gi|42662547|ref|XP_293284.4| similar to Zinc finger protein 81 (... 61 6e-08
gi|26345140|dbj|BAC36219.1| unnamed protein product [Mus musculus] 61 6e-08
gi|88893|pir||A40350 transcription repressor protein YY1 - human... 61 6e-08
gi|1272334|gb|AAB17130.1| zinc finger homeodomain enhancer-bindi... 61 6e-08
gi|189174|gb|AAA59926.1| DNA-binding protein 61 6e-08
gi|31982421|ref|NP_033563.2| YY1 transcription factor; UCRBP tra... 61 6e-08
gi|4507955|ref|NP_003394.1| YY1 transcription factor [Homo sapie... 61 6e-08
gi|192941|gb|AAA37521.1| delta-transcription factor 61 6e-08
gi|47059080|ref|NP_033580.2| zinc finger protein 37 [Mus musculu... 61 6e-08
gi|39795281|gb|AAH63757.1| Zinc finger protein 37 [Mus musculus] 61 6e-08
gi|2136416|pir||S60520 finger protein ZNF81.1 - human (fragment)... 61 6e-08
gi|19353747|gb|AAH24863.1| Zfp37 protein [Mus musculus] 61 6e-08
gi|37674207|ref|NP_083262.1| zinc finger protein 336; GDNF-induc... 61 6e-08
gi|13124577|sp|Q62947|TCF8_RAT Transcription factor 8 (Zinc fing... 61 6e-08
gi|42495034|gb|AAS17752.1| zinc finger protein 81 [Homo sapiens] 61 6e-08
gi|30316362|sp|P51508|ZN81_HUMAN Zinc finger protein 81 (HFZ20) ... 61 6e-08
gi|38079031|ref|XP_142529.3| similar to 1700029I01Rik protein [M... 61 6e-08
gi|109839|pir||S22954 finger protein zfp-37 - mouse >gnl|BL_ORD_... 61 6e-08
gi|34876216|ref|XP_341540.1| transcription factor 8 [Rattus norv... 61 6e-08
gi|49257349|gb|AAH73606.1| Unknown (protein for MGC:82910) [Xeno... 61 6e-08
gi|50346348|gb|AAT74924.1| transcription factor YY1 [Ovis aries] 61 6e-08
gi|34858894|ref|XP_342537.1| similar to zinc finger protein 336 ... 61 6e-08
gi|38086643|ref|XP_145533.2| similar to RIKEN cDNA 2810426N06 [M... 61 6e-08
gi|27545350|ref|NP_775412.1| YY1 transcription factor [Rattus no... 61 6e-08
gi|33086536|gb|AAP92580.1| Ab2-002 [Rattus norvegicus] 61 6e-08
gi|50748694|ref|XP_421365.1| PREDICTED: similar to YY1 transcrip... 61 6e-08
gi|38078982|ref|XP_355536.1| similar to 1700029I01Rik protein [M... 61 6e-08
gi|32261316|ref|NP_079009.2| hypothetical protein FLJ14345 [Homo... 61 6e-08
gi|29290629|emb|CAD83038.1| bM64F17.5.1 (zinc finger protein 37,... 61 6e-08
gi|10436789|dbj|BAB14911.1| unnamed protein product [Homo sapiens] 61 6e-08
gi|12858185|dbj|BAB31226.1| unnamed protein product [Mus musculus] 61 6e-08
gi|23592815|ref|XP_147946.2| RIKEN cDNA 9130001M19 [Mus musculus... 61 6e-08
gi|47225202|emb|CAF98829.1| unnamed protein product [Tetraodon n... 60 8e-08
gi|40796098|gb|AAR91692.1| KRAB-zinc finger protein [Mus musculus] 60 8e-08
gi|27369668|ref|NP_766074.1| hypothetical protein A830058L05 [Mu... 60 8e-08
gi|34786010|gb|AAH57947.1| Hypothetical protein A830058L05 [Mus ... 60 8e-08
gi|38093988|ref|XP_143009.4| similar to zinc finger protein [Mus... 60 8e-08
gi|7019581|ref|NP_037381.1| zinc finger protein 214 [Homo sapien... 60 8e-08
gi|29387154|gb|AAH48313.1| ZNF11B protein [Homo sapiens] 60 8e-08
gi|39583566|emb|CAE65670.1| Hypothetical protein CBG10736 [Caeno... 60 8e-08
gi|22749331|ref|NP_689868.1| zinc finger protein 585A [Homo sapi... 60 8e-08
gi|33859648|ref|NP_035884.1| zinc finger protein 27 [Mus musculu... 60 8e-08
gi|37589486|gb|AAH59037.1| Zfp27 protein [Mus musculus] 60 8e-08
gi|27370134|ref|NP_766351.1| expressed sequence BB114266 [Mus mu... 60 8e-08
gi|39645791|gb|AAH63820.1| ZNF585A protein [Homo sapiens] 60 8e-08
gi|50757095|ref|XP_415376.1| PREDICTED: similar to KIAA1993 prot... 60 8e-08
gi|26354576|dbj|BAC40916.1| unnamed protein product [Mus musculus] 60 8e-08
gi|42657603|ref|XP_212581.3| similar to dJ25J6.2 (novel zinc fin... 60 1e-07
gi|24307925|ref|NP_008904.1| zinc finger protein 32 (KOX 30) [Ho... 60 1e-07
gi|15620753|emb|CAB55432.2| dJ25J6.2 (novel zinc finger protein)... 60 1e-07
gi|45708956|gb|AAH67397.1| Unknown (protein for MGC:76572) [Mus ... 60 1e-07
gi|4837719|gb|AAD30654.1| hypermethylated in cancer 1 [Mus muscu... 60 1e-07
gi|10434163|dbj|BAB14154.1| unnamed protein product [Homo sapiens] 60 1e-07
gi|41350647|gb|AAS00544.1| zinc finger transcription factor KRAB... 60 1e-07
gi|46854957|gb|AAH69668.1| ZNF415 protein [Homo sapiens] 60 1e-07
gi|39645359|gb|AAH63880.1| ZNF415 protein [Homo sapiens] 60 1e-07
gi|45501220|gb|AAH67102.1| PRDM15 protein [Homo sapiens] 60 1e-07
gi|34873170|ref|XP_220706.2| similar to hypermethylated in cance... 60 1e-07
gi|47228115|emb|CAF97744.1| unnamed protein product [Tetraodon n... 60 1e-07
gi|46048068|ref|NP_071398.2| PR domain containing 15; zinc finge... 60 1e-07
gi|345614|pir||S32037 finger protein XFG-5.2 - African clawed fr... 60 1e-07
gi|7023703|dbj|BAA92059.1| unnamed protein product [Homo sapiens... 60 1e-07
gi|37655177|ref|NP_060825.2| zinc finger protein 415 [Homo sapiens] 60 1e-07
gi|31377695|ref|NP_078896.2| hypothetical protein FLJ12586 [Homo... 60 1e-07
gi|6005966|ref|NP_009076.1| zinc finger protein 146 [Homo sapien... 60 1e-07
gi|5729871|ref|NP_006488.1| hypermethylated in cancer 1 [Homo sa... 60 1e-07
gi|31544063|ref|NP_036111.2| zinc finger protein 260 [Mus muscul... 60 1e-07
gi|6754194|ref|NP_034560.1| hypermethylated in cancer 1 [Mus mus... 60 1e-07
gi|31088936|ref|NP_068735.1| zinc finger protein 70; zinc finger... 60 1e-07
gi|453460|emb|CAA50014.1| zinc finger protein [Xenopus laevis] 60 1e-07
gi|47211796|emb|CAF93710.1| unnamed protein product [Tetraodon n... 60 1e-07
gi|34866833|ref|XP_235439.2| similar to 1500031N24Rik protein [R... 60 1e-07
gi|20454955|sp|Q14526|HIC1_HUMAN Hypermethylated in cancer 1 pro... 60 1e-07
gi|50750802|ref|XP_422151.1| PREDICTED: similar to Zinc finger h... 60 1e-07
gi|47218590|emb|CAG10289.1| unnamed protein product [Tetraodon n... 60 1e-07
gi|47223788|emb|CAF98558.1| unnamed protein product [Tetraodon n... 60 1e-07
gi|26328731|dbj|BAC28104.1| unnamed protein product [Mus musculus] 60 1e-07
gi|28972281|dbj|BAC65594.1| mKIAA0569 protein [Mus musculus] 60 1e-07
gi|22122799|ref|NP_666343.1| hypothetical protein MGC18736 [Mus ... 60 1e-07
gi|49066922|ref|XP_397751.1| hypothetical protein UM00136.1 [Ust... 60 1e-07
gi|47208823|emb|CAF91912.1| unnamed protein product [Tetraodon n... 60 1e-07
gi|8925962|gb|AAF81689.1| Smad-interacting protein 1 [Xenopus la... 60 1e-07
gi|40254564|ref|NP_056568.2| zinc finger homeobox 1b [Mus muscul... 60 1e-07
gi|13124525|sp|Q9R0G7|SIP1_MOUSE Zinc finger homeobox protein 1b... 60 1e-07
gi|49077902|ref|XP_402759.1| hypothetical protein UM05144.1 [Ust... 60 1e-07
gi|27369519|ref|NP_765991.1| RIKEN cDNA 2810021J22 [Mus musculus... 60 1e-07
gi|7662184|ref|NP_055610.1| zinc finger homeobox 1b; Smad-intera... 60 1e-07
gi|11359850|pir||JC7259 Smad interacting protein 1 - African cla... 60 1e-07
gi|38094000|ref|XP_358120.1| similar to 1700029I01Rik protein [M... 60 1e-07
gi|20898862|ref|XP_128440.1| RIKEN cDNA 4930432O21 [Mus musculus... 60 1e-07
gi|20380039|gb|AAH27792.1| Zfp334 protein [Mus musculus] 60 1e-07
gi|21687264|ref|NP_653294.1| zinc finger protein 558 [Homo sapie... 60 1e-07
gi|13938351|gb|AAH07307.1| Similar to zinc finger protein 268 [H... 60 1e-07
gi|34854264|ref|XP_242005.2| similar to mKIAA0569 protein [Rattu... 60 1e-07
gi|30410744|ref|NP_848498.1| zinc finger protein 334 [Mus muscul... 60 1e-07
gi|40788290|dbj|BAA25495.2| KIAA0569 protein [Homo sapiens] 60 1e-07
gi|50729991|ref|XP_416740.1| PREDICTED: similar to PRDM15 protei... 60 1e-07
gi|31322975|gb|AAP43944.1| ZAG-1 [Caenorhabditis elegans] >gnl|B... 60 1e-07
gi|37552118|ref|XP_039908.3| hypothetical protein BC007307 [Homo... 60 1e-07
gi|47224015|emb|CAG12844.1| unnamed protein product [Tetraodon n... 59 2e-07
gi|423155|pir||S33994 finger protein ZNF11B - human (fragment) 59 2e-07
gi|4838135|gb|AAD30857.1| hypermethylated in cancer zinc finger/... 59 2e-07
gi|193352|gb|AAA37640.1| finger protein (put.); putative 59 2e-07
gi|30425364|ref|NP_848542.1| zinc finger protein 2 [Mus musculus... 59 2e-07
gi|38524600|ref|NP_071386.2| hypothetical zinc finger protein FL... 59 2e-07
gi|9665238|ref|NP_062566.1| zinc finger protein 386 (Kruppel-lik... 59 2e-07
gi|41150659|ref|XP_047617.6| KIAA1349 protein [Homo sapiens] 59 2e-07
gi|50754007|ref|XP_414213.1| PREDICTED: similar to zinc finger p... 59 2e-07
gi|20140878|sp|Q9P2J8|Z624_HUMAN Zinc finger protein 624 59 2e-07
gi|19263667|gb|AAH25265.1| Zinc finger protein 3 [Homo sapiens] 59 2e-07
gi|16551486|dbj|BAB71107.1| unnamed protein product [Homo sapiens] 59 2e-07
gi|21707625|gb|AAH34102.1| BC029716 protein [Mus musculus] 59 2e-07
gi|21361866|ref|NP_116313.2| zinc finger protein 3 [Homo sapiens... 59 2e-07
gi|19684002|gb|AAH26030.1| ZNF239 protein [Homo sapiens] 59 2e-07
gi|11968150|ref|NP_071927.1| zinc finger protein 336; GDNF-induc... 59 2e-07
gi|47271360|ref|NP_065838.1| zinc finger protein 624 [Homo sapie... 59 2e-07
gi|10437963|dbj|BAB15134.1| unnamed protein product [Homo sapiens] 59 2e-07
gi|6677607|ref|NP_033579.1| zinc finger protein 29 [Mus musculus... 59 2e-07
gi|37574009|gb|AAH58613.1| Unknown (protein for MGC:60813) [Mus ... 59 2e-07
gi|50736248|ref|XP_419094.1| PREDICTED: similar to Zinc finger p... 59 2e-07
gi|38564322|ref|NP_003435.1| zinc finger protein 154 (pHZ-92) [H... 59 2e-07
gi|7243079|dbj|BAA92587.1| KIAA1349 protein [Homo sapiens] 59 2e-07
gi|5640017|gb|AAD45929.1| zinc finger protein ZFP113 [Mus musculus] 59 2e-07
gi|1731406|sp|Q06732|Z11B_HUMAN Zinc finger protein 11B >gnl|BL_... 59 2e-07
gi|141709|sp|P18741|ZO15_XENLA Oocyte zinc finger protein XLCOF1... 59 2e-07
gi|4481920|emb|CAB38535.1| Ozrf1 protein [Mus musculus] 59 2e-07
gi|7021169|dbj|BAA91398.1| unnamed protein product [Homo sapiens] 59 2e-07
gi|30584085|gb|AAP36291.1| Homo sapiens zinc finger protein 3 (A... 59 2e-07
gi|46577682|sp|P17036|ZN38_HUMAN Zinc finger protein 38 (Zinc fi... 59 2e-07
gi|34536093|dbj|BAC87537.1| unnamed protein product [Homo sapiens] 59 2e-07
gi|12643896|sp|Q9UL36|Z236_HUMAN Zinc finger protein 236 >gnl|BL... 59 2e-07
gi|31228815|ref|XP_318115.1| ENSANGP00000003603 [Anopheles gambi... 59 2e-07
gi|139805|sp|P08045|XFIN_XENLA Zinc finger protein Xfin >gnl|BL_... 59 2e-07
gi|85769|pir||S00647 finger protein - African clawed frog 59 2e-07
gi|24899172|dbj|BAC23100.1| KIAA2003 protein [Homo sapiens] 59 2e-07
gi|87436|pir||S00754 zinc finger protein kox25 - human (fragment... 59 2e-07
gi|33504487|ref|NP_062721.2| zinc finger protein 113 [Mus muscul... 59 2e-07
gi|10092586|ref|NP_031371.1| zinc finger protein 236 [Homo sapie... 59 2e-07
gi|32490587|ref|NP_870992.1| zinc finger protein 29 [Homo sapien... 59 2e-07
gi|50738544|ref|XP_419307.1| PREDICTED: similar to zinc finger p... 59 2e-07
gi|6677609|ref|NP_033576.1| zinc finger protein 2 [Mus musculus]... 59 2e-07
gi|42661699|ref|XP_064856.7| similar to KIAA2033 protein [Homo s... 59 2e-07
gi|16551429|dbj|BAB71096.1| unnamed protein product [Homo sapiens] 59 2e-07
gi|32413427|ref|XP_327193.1| hypothetical protein [Neurospora cr... 59 2e-07
gi|44890412|gb|AAH67000.1| Unknown (protein for MGC:86131) [Mus ... 59 2e-07
gi|28892783|ref|NP_795936.1| RIKEN cDNA 6330416L07 gene [Mus mus... 59 2e-07
gi|50310253|ref|XP_455146.1| unnamed protein product [Kluyveromy... 59 2e-07
gi|15559662|gb|AAH14187.1| Hypothetical protein BC016816 [Homo s... 59 2e-07
gi|20270323|ref|NP_620138.1| hypothetical protein BC016816 [Homo... 59 2e-07
gi|29789439|ref|NP_796292.1| zinc finger protein Zip67; Zip67 [M... 59 2e-07
gi|11181880|emb|CAC16114.1| bA1021O19.1 (zinc finger protein 33a... 59 2e-07
gi|13506753|gb|AAK28319.1| kruppel-like zinc finger factor X17 [... 59 2e-07
gi|21756829|dbj|BAC04966.1| unnamed protein product [Homo sapiens] 59 2e-07
gi|38081810|ref|XP_354988.1| similar to RIKEN cDNA 1300003B13 [M... 59 2e-07
gi|42733610|ref|NP_003424.2| zinc finger protein 132 (clone pHZ-... 59 2e-07
gi|38505215|ref|NP_079316.2| zinc finger protein 614 [Homo sapiens] 59 2e-07
gi|34860447|ref|XP_217093.2| similar to RIKEN cDNA E430039K05 ge... 59 2e-07
gi|31221160|ref|XP_317014.1| ENSANGP00000006611 [Anopheles gambi... 59 2e-07
gi|38078980|ref|XP_355535.1| similar to 1700029I01Rik protein [M... 59 2e-07
gi|1731408|sp|P52740|Z132_HUMAN Zinc finger protein 132 >gnl|BL_... 59 2e-07
gi|26353122|dbj|BAC40191.1| unnamed protein product [Mus musculus] 59 2e-07
gi|7706192|ref|NP_057727.1| mesenchymal stem cell protein DSC43 ... 59 2e-07
gi|13529452|gb|AAH05456.1| Zfp111 protein [Mus musculus] 59 2e-07
gi|141654|sp|P18730|ZG58_XENLA Gastrula zinc finger protein XLCG... 59 2e-07
gi|46402247|ref|NP_997128.1| similar to Hypothetical protein MGC... 59 2e-07
gi|49076938|ref|XP_402389.1| hypothetical protein UM04774.1 [Ust... 59 2e-07
gi|34854434|ref|XP_218041.2| similar to KRAB-containing zinc-fin... 59 2e-07
gi|498152|dbj|BAA06541.1| KIAA0065 [Homo sapiens] 59 2e-07
gi|20384656|gb|AAK40312.1| Egr-1 [Clarias gariepinus] 59 2e-07
gi|141708|sp|P18740|ZO14_XENLA Oocyte zinc finger protein XLCOF1... 59 2e-07
gi|34190613|gb|AAH26192.2| LOC51333 protein [Homo sapiens] 59 2e-07
gi|40225843|gb|AAH11870.2| LOC51333 protein [Homo sapiens] 59 2e-07
gi|48097117|ref|XP_391847.1| similar to CG5249-PA [Apis mellifera] 59 2e-07
gi|11136122|sp|Q9UK11|Z223_HUMAN Zinc finger protein 223 >gnl|BL... 59 2e-07
gi|18490120|gb|AAH22246.1| ZNF614 protein [Homo sapiens] 59 2e-07
gi|26354248|dbj|BAC40752.1| unnamed protein product [Mus musculus] 59 2e-07
gi|42661598|ref|XP_290838.3| similar to zinc finger protein [Hom... 59 2e-07
gi|15021888|dbj|BAB62218.1| hypothetical protein [Macaca fascicu... 59 2e-07
gi|9910606|ref|NP_064324.1| zinc finger protein 111 [Mus musculu... 59 2e-07
gi|28274682|ref|NP_008905.1| zinc finger protein 33a; zinc finge... 59 2e-07
gi|47222201|emb|CAG11080.1| unnamed protein product [Tetraodon n... 59 3e-07
gi|15787775|emb|CAC88162.1| bB479F17.3 (zinc finger protein 41) ... 59 3e-07
gi|18916783|dbj|BAB85542.1| KIAA1956 protein [Homo sapiens] 59 3e-07
gi|50415556|gb|AAH77581.1| Unknown (protein for MGC:83714) [Xeno... 59 3e-07
gi|27485348|ref|XP_030892.2| similar to zinc finger protein 347;... 59 3e-07
gi|46577503|sp|Q8NB50|ZF62_HUMAN Zinc finger protein 62 homolog ... 59 3e-07
gi|2134067|pir||S65088 finger protein XFO 6 - African clawed fro... 59 3e-07
gi|34364774|emb|CAE45826.1| hypothetical protein [Homo sapiens] 59 3e-07
gi|27501301|ref|XP_033853.2| hypothetical zinc finger protein FL... 59 3e-07
gi|31240167|ref|XP_320497.1| ENSANGP00000015762 [Anopheles gambi... 59 3e-07
gi|47219711|emb|CAG12633.1| unnamed protein product [Tetraodon n... 59 3e-07
gi|26329059|dbj|BAC28268.1| unnamed protein product [Mus musculus] 59 3e-07
gi|50732101|ref|XP_418478.1| PREDICTED: similar to RIKEN cDNA 93... 59 3e-07
gi|1082929|pir||A54661 zinc finger protein ZNF41 - human (fragme... 59 3e-07
gi|34785283|gb|AAH56632.1| LOC224598 protein [Mus musculus] 59 3e-07
gi|38044286|ref|NP_775902.2| zinc finger protein 547 [Homo sapiens] 59 3e-07
gi|16604252|ref|NP_443092.1| zinc finger protein 300; kruppel-li... 59 3e-07
gi|18600761|ref|XP_088140.1| similar to hypothetical protein [Ho... 59 3e-07
gi|7020745|dbj|BAA91257.1| unnamed protein product [Homo sapiens] 59 3e-07
gi|34860777|ref|XP_230857.2| similar to Hypothetical protein BC0... 59 3e-07
gi|34303941|ref|NP_689816.2| zinc finger protein 567 [Homo sapie... 59 3e-07
gi|26339168|dbj|BAC33255.1| unnamed protein product [Mus musculu... 59 3e-07
gi|141718|sp|P18749|ZO6_XENLA Oocyte zinc finger protein XLCOF6 59 3e-07
gi|27503767|gb|AAH42681.1| Similar to hypothetical protein FLJ32... 59 3e-07
gi|13507660|ref|NP_109638.1| zinc finger protein 202; zinc finge... 59 3e-07
gi|9651099|dbj|BAB03562.1| hypothetical protein [Macaca fascicul... 59 3e-07
gi|10190696|ref|NP_065708.1| zinc finger protein 304 [Homo sapie... 59 3e-07
gi|14456629|emb|CAC41948.1| dJ54B20.2 (novel KRAB box containing... 59 3e-07
gi|23510455|ref|NP_700359.1| zinc finger protein 41 [Homo sapien... 59 3e-07
gi|7656871|ref|NP_055295.1| zinc finger protein 544 [Homo sapien... 59 3e-07
gi|45501063|gb|AAH67271.1| Zinc finger protein 544 [Homo sapiens] 59 3e-07
gi|38348488|ref|NP_941021.1| Unknown (protein for MGC:67181) [Mu... 59 3e-07
gi|20141930|sp|P51814|ZN41_HUMAN Zinc finger protein 41 59 3e-07
gi|48097350|ref|XP_391883.1| similar to zinc finger protein 236 ... 59 3e-07
gi|27370692|gb|AAH37455.1| LOC224598 protein [Mus musculus] 59 3e-07
gi|47210224|emb|CAF90906.1| unnamed protein product [Tetraodon n... 59 3e-07
gi|34932608|ref|XP_225695.2| similar to Zinc finger protein 236 ... 59 3e-07
gi|30911112|ref|NP_851783.1| zinc finger protein 120 isoform 1 [... 59 3e-07
gi|19113985|ref|NP_593073.1| zinc finger protein [Schizosaccharo... 59 3e-07
gi|44890695|gb|AAH66875.1| Unknown (protein for MGC:76795) [Mus ... 59 3e-07
gi|21703956|ref|NP_663459.1| similar to zinc finger protein 40 [... 59 3e-07
gi|18589819|ref|XP_085836.1| KIAA1956 protein [Homo sapiens] >gn... 59 3e-07
gi|8809810|gb|AAF79951.1| KRAB zinc finger protein [Mus musculus] 59 3e-07
gi|26333705|dbj|BAC30570.1| unnamed protein product [Mus musculus] 59 3e-07
gi|34868042|ref|XP_239504.2| similar to PR-domain zinc finger pr... 58 4e-07
gi|34854772|ref|XP_218291.2| similar to RIKEN cDNA 2810439M05 [R... 58 4e-07
gi|31231647|ref|XP_318560.1| ENSANGP00000024280 [Anopheles gambi... 58 4e-07
gi|34871562|ref|XP_220549.2| similar to Zinc finger protein 287 ... 58 4e-07
gi|48103802|ref|XP_395651.1| similar to ENSANGP00000009800 [Apis... 58 4e-07
gi|141622|sp|P15620|ZF35_MOUSE Zinc finger protein 35 (Zfp-35) >... 58 4e-07
gi|34878337|ref|XP_226100.2| similar to Zinc finger protein 35 (... 58 4e-07
gi|19343985|gb|AAH25728.1| FLJ23506 protein [Homo sapiens] 58 4e-07
gi|13376240|ref|NP_079109.1| hypothetical protein FLJ23506 [Homo... 58 4e-07
gi|23271315|gb|AAH36110.1| Zinc finger protein 595 [Homo sapiens... 58 4e-07
gi|46577467|sp|Q8C827|ZF62_MOUSE Zinc finger protein 62 homolog ... 58 4e-07
gi|26390437|dbj|BAC25897.1| unnamed protein product [Mus musculus] 58 4e-07
gi|38103934|gb|EAA50569.1| hypothetical protein MG04328.4 [Magna... 58 4e-07
gi|22094085|ref|NP_033588.1| zinc finger protein 62 [Mus musculu... 58 4e-07
gi|34222391|ref|NP_899061.1| zinc finger protein 605 [Homo sapie... 58 4e-07
gi|13435780|gb|AAH04747.1| Zfp386 protein [Mus musculus] 58 4e-07
gi|30268309|emb|CAD89946.1| hypothetical protein [Homo sapiens] 58 4e-07
gi|50732625|ref|XP_425963.1| PREDICTED: similar to Zinc finger p... 58 4e-07
gi|127237|sp|P24399|Z239_MOUSE Zinc finger protein 239 (Zfp-239)... 58 4e-07
gi|49087122|ref|NP_032642.2| zinc finger protein 239; Kruppel zi... 58 4e-07
gi|38088236|ref|XP_142421.3| similar to hypothetical protein FLJ... 58 4e-07
gi|26352984|dbj|BAC40122.1| unnamed protein product [Mus musculus] 58 4e-07
gi|18959274|ref|NP_579857.1| zinc finger protein 111 [Rattus nor... 58 4e-07
gi|20819192|ref|XP_133164.1| RIKEN cDNA 2810409K11 [Mus musculus... 58 4e-07
gi|20141961|sp|Q14591|Z271_HUMAN Zinc finger protein 271 (Zinc f... 58 4e-07
gi|41350818|gb|AAH65692.1| Zfp62 protein [Mus musculus] 58 4e-07
gi|33284893|emb|CAE17574.1| SI:bZ1C10.3 (novel zinc finger prote... 58 4e-07
gi|28395039|ref|NP_775951.1| hypothetical protein MGC33584 [Homo... 58 4e-07
gi|21693132|dbj|BAC02702.1| KIAA1993 protein [Homo sapiens] 58 4e-07
gi|31198163|ref|XP_308029.1| ENSANGP00000019462 [Anopheles gambi... 58 4e-07
gi|24646290|ref|NP_650197.1| CG5245-PA [Drosophila melanogaster]... 58 4e-07
gi|33870368|gb|AAH15152.2| MGC33584 protein [Homo sapiens] 58 4e-07
gi|47218514|emb|CAF98046.1| unnamed protein product [Tetraodon n... 56 4e-07
gi|23274126|gb|AAH23805.1| Similar to hypothetical protein FLJ38... 58 5e-07
gi|18916806|dbj|BAB85548.1| KIAA1962 protein [Homo sapiens] 58 5e-07
gi|34147201|ref|NP_898990.1| expressed sequence AI987944 [Mus mu... 58 5e-07
gi|21754843|dbj|BAC04574.1| unnamed protein product [Homo sapiens] 58 5e-07
gi|141653|sp|P18729|ZG57_XENLA Gastrula zinc finger protein XLCG... 58 5e-07
gi|5441613|emb|CAB46855.1| hypothetical protein [Canis familiaris] 58 5e-07
gi|220637|dbj|BAA01477.1| zinc finger protein [Mus musculus] 58 5e-07
gi|47220020|emb|CAG12168.1| unnamed protein product [Tetraodon n... 58 5e-07
gi|6756057|ref|NP_035885.1| zinc finger protein 35 [Mus musculus... 58 5e-07
gi|22748873|ref|NP_689625.1| zinc finger protein 572 [Homo sapie... 58 5e-07
gi|31873880|emb|CAD97876.1| hypothetical protein [Homo sapiens] 58 5e-07
gi|26338916|dbj|BAC33129.1| unnamed protein product [Mus musculus] 58 5e-07
gi|34868543|ref|XP_233031.2| similar to Zinc finger protein 37 (... 58 5e-07
gi|2789430|dbj|BAA24380.1| repressor protein [Homo sapiens] 58 5e-07
gi|18643896|emb|CAB94232.2| zinc finger protein [Homo sapiens] >... 58 5e-07
gi|19921116|ref|NP_609448.1| CG12299-PA [Drosophila melanogaster... 58 5e-07
gi|38037008|gb|AAR08420.1| Kruppel-like protein 1 [Apis mellifera] 58 5e-07
gi|4508037|ref|NP_003419.1| zinc finger protein 84 (HPF2) [Homo ... 58 5e-07
gi|5032245|ref|NP_005665.1| zinc finger protein 239; zinc finger... 58 5e-07
gi|50751200|ref|XP_426629.1| PREDICTED: similar to hypothetical ... 58 5e-07
gi|48101631|ref|XP_392694.1| kruppel-like protein 1 [Apis mellif... 58 5e-07
gi|29476835|gb|AAH48350.1| ZNF84 protein [Homo sapiens] 58 5e-07
gi|6647873|sp|O60765|TC17_HUMAN Zinc finger protein 354A (Transc... 58 5e-07
gi|40789005|dbj|BAA76816.2| KIAA0972 protein [Homo sapiens] 58 5e-07
gi|20304115|ref|NP_612356.1| zinc finger protein 551 [Homo sapie... 58 5e-07
gi|26350051|dbj|BAC38665.1| unnamed protein product [Mus musculus] 58 5e-07
gi|50256915|gb|EAL19633.1| hypothetical protein CNBG2610 [Crypto... 58 5e-07
gi|26334231|dbj|BAC30833.1| unnamed protein product [Mus musculus] 58 5e-07
gi|6756047|ref|NP_036110.1| zinc finger protein 146 [Mus musculu... 58 5e-07
gi|2501710|sp|Q28151|OZF_BOVIN Zinc finger protein OZF 58 5e-07
gi|50290987|ref|XP_447926.1| unnamed protein product [Candida gl... 58 5e-07
gi|28603846|ref|NP_776192.1| hypothetical protein LOC286075 [Hom... 58 5e-07
gi|42659229|ref|XP_376895.1| zinc finger protein 510 [Homo sapie... 58 5e-07
gi|46329597|gb|AAH68587.1| ZNF510 protein [Homo sapiens] 58 5e-07
gi|22748995|ref|NP_689685.1| zinc finger protein 578 [Homo sapie... 58 5e-07
gi|26336609|dbj|BAC31987.1| unnamed protein product [Mus musculus] 58 5e-07
gi|26347455|dbj|BAC37376.1| unnamed protein product [Mus musculus] 58 5e-07
gi|34854130|ref|XP_344848.1| similar to PR-domain zinc finger pr... 58 5e-07
gi|1313934|emb|CAA57406.1| ozf [Bos taurus] 58 5e-07
gi|47216468|emb|CAG02119.1| unnamed protein product [Tetraodon n... 58 5e-07
gi|31657109|ref|NP_003566.1| zinc finger protein 282; HTLV-I U5 ... 58 5e-07
gi|12643382|sp|Q9UDV7|Z282_HUMAN Zinc finger protein 282 (HTLV-I... 58 5e-07
gi|29839723|sp|Q8TF39|YJ62_HUMAN Hypothetical zinc finger protei... 58 5e-07
gi|20540024|ref|XP_088567.4| zinc finger protein 483 [Homo sapiens] 58 5e-07
gi|27693942|gb|AAH41704.1| Similar to expressed sequence AI44943... 58 5e-07
gi|27734134|ref|NP_775600.1| RIKEN cDNA D430004I08 [Mus musculus... 58 5e-07
gi|38084428|ref|XP_355109.1| similar to zinc finger protein 236 ... 58 5e-07
gi|106024|pir||B32891 finger protein 2, placental - human 58 5e-07
gi|12845782|dbj|BAB26897.1| unnamed protein product [Mus musculus] 57 7e-07
gi|50767109|ref|XP_423029.1| PREDICTED: similar to Zinc finger p... 57 7e-07
gi|31248030|ref|XP_316619.1| ENSANGP00000002585 [Anopheles gambi... 57 7e-07
gi|29243904|ref|NP_808233.1| expressed sequence AI854635 [Mus mu... 57 7e-07
gi|48095675|ref|XP_394504.1| similar to zinc finger protein 28; ... 57 7e-07
gi|49904140|gb|AAH76871.1| Unknown (protein for MGC:84640) [Xeno... 57 7e-07
gi|26326665|dbj|BAC27076.1| unnamed protein product [Mus musculus] 57 7e-07
gi|22749241|ref|NP_689819.1| zinc finger protein 540 [Homo sapie... 57 7e-07
gi|20864378|ref|XP_134220.1| similar to data source:SPTR, source... 57 7e-07
gi|38088420|ref|XP_142533.2| similar to DKFZP572C163 protein [Mu... 57 7e-07
gi|26325530|dbj|BAC26519.1| unnamed protein product [Mus musculus] 57 7e-07
gi|17530791|ref|NP_478137.1| zinc finger protein 354B [Homo sapi... 57 7e-07
gi|21362279|ref|NP_573471.1| zinc finger protein 287; zinc finge... 57 7e-07
gi|6693371|gb|AAF24967.1| ZNF225 [Homo sapiens] 57 7e-07
gi|50511017|dbj|BAD32494.1| mKIAA1611 protein [Mus musculus] 57 7e-07
gi|11611571|dbj|BAB19000.1| hypothetical protein [Macaca fascicu... 57 7e-07
gi|33341134|gb|AAQ15128.1| zinc finger protein 276 [Homo sapiens... 57 7e-07
gi|29789126|ref|NP_067301.1| RB-associated KRAB repressor [Mus m... 57 7e-07
gi|31874584|emb|CAD98037.1| hypothetical protein [Homo sapiens] 57 7e-07
gi|40805102|ref|NP_689500.2| zinc finger protein 276 homolog; zi... 57 7e-07
gi|20988840|gb|AAH30261.1| ZNF222 protein [Homo sapiens] 57 7e-07
gi|32698886|ref|NP_872330.1| zinc finger protein 595 [Homo sapie... 57 7e-07
gi|7656698|gb|AAF66075.1| Zinc finger protein 222 [Homo sapiens] 57 7e-07
gi|7019587|ref|NP_037492.1| zinc finger protein 222 [Homo sapien... 57 7e-07
gi|21756241|dbj|BAC04843.1| unnamed protein product [Homo sapiens] 57 7e-07
gi|47271376|ref|NP_940882.2| zinc finger protein 615 [Homo sapie... 57 7e-07
gi|37537689|ref|NP_005640.2| zinc finger protein 354A; transcrip... 57 7e-07
gi|40556276|ref|NP_955008.1| zinc finger protein 341 [Mus muscul... 57 7e-07
gi|28436927|gb|AAH47105.1| Zinc finger protein 354A [Homo sapiens] 57 7e-07
gi|21704192|ref|NP_663566.1| similar to zinc finger protein 97 [... 57 7e-07
gi|21703954|ref|NP_663458.1| RIKEN cDNA 6720480D16 [Mus musculus... 57 7e-07
gi|47077237|dbj|BAD18539.1| unnamed protein product [Homo sapiens] 57 7e-07
gi|30722298|emb|CAD91161.1| hypothetical protein [Homo sapiens] 57 7e-07
gi|9502402|gb|AAF88105.1| ZNF225 [amino acids 79-706] [Homo sapi... 57 7e-07
gi|21749307|dbj|BAC03571.1| unnamed protein product [Homo sapiens] 57 7e-07
gi|21358403|ref|NP_647982.1| CG5249-PA [Drosophila melanogaster]... 57 7e-07
gi|38093419|ref|XP_142545.2| similar to DKFZP572C163 protein [Mu... 57 7e-07
gi|31544067|ref|NP_033603.2| zinc finger protein interacting wit... 57 7e-07
gi|1572600|gb|AAC52877.1| Zik1 [Mus musculus] 57 7e-07
gi|31201225|ref|XP_309560.1| ENSANGP00000003937 [Anopheles gambi... 57 7e-07
gi|34868351|ref|XP_232947.2| hypothetical protein XP_232947 [Rat... 57 7e-07
gi|17512545|gb|AAH19219.1| 2610036F08Rik protein [Mus musculus] 57 7e-07
gi|7243635|gb|AAF43390.1| RB-associated KRAB repressor [Mus musc... 57 7e-07
gi|18858601|ref|NP_571323.1| early growth response 1; etID309970... 57 7e-07
gi|29422200|gb|AAO84523.1| zinc finger protein [Pavo cristatus] 57 7e-07
gi|47218917|emb|CAF98115.1| unnamed protein product [Tetraodon n... 57 7e-07
gi|34147234|ref|NP_899008.1| hypothetical protein D930016N04 [Mu... 57 7e-07
gi|34535692|dbj|BAC87399.1| unnamed protein product [Homo sapiens] 57 7e-07
gi|10190686|ref|NP_065703.1| zinc finger protein 286; zinc finge... 57 7e-07
gi|37589510|gb|AAH59913.1| Rbak protein [Mus musculus] 57 7e-07
gi|48257252|gb|AAH32781.2| ZFP276 protein [Homo sapiens] 57 7e-07
gi|20522000|dbj|BAB47503.2| KIAA1874 protein [Homo sapiens] 57 7e-07
gi|40789270|ref|NP_689573.2| zinc finger protein 573 [Homo sapie... 57 9e-07
gi|12845153|dbj|BAB26638.1| unnamed protein product [Mus musculus] 57 9e-07
gi|538413|gb|AAA40580.1| zinc finger protein 57 9e-07
gi|31222093|ref|XP_317117.1| ENSANGP00000019687 [Anopheles gambi... 57 9e-07
gi|47221021|emb|CAG12715.1| unnamed protein product [Tetraodon n... 57 9e-07
gi|47077094|dbj|BAD18475.1| unnamed protein product [Homo sapiens] 57 9e-07
gi|15929979|gb|AAH15418.1| ZNF573 protein [Homo sapiens] 57 9e-07
gi|20982820|ref|XP_135702.1| similar to Zinc finger protein 7 (Z... 57 9e-07
gi|34870459|ref|XP_221920.2| similar to RB-associated KRAB repre... 57 9e-07
gi|27734192|ref|NP_775563.1| hypothetical protein 9630041N07 [Mu... 57 9e-07
gi|21755813|dbj|BAC04764.1| unnamed protein product [Homo sapiens] 57 9e-07
gi|26332292|dbj|BAC29876.1| unnamed protein product [Mus musculus] 57 9e-07
gi|37573972|gb|AAH46465.2| RIKEN cDNA 9830132G07 [Mus musculus] 57 9e-07
gi|27369918|ref|NP_766231.1| RIKEN cDNA 9830132G07 [Mus musculus... 57 9e-07
gi|7662110|ref|NP_055539.1| zinc finger protein 305 [Homo sapien... 57 9e-07
gi|30802122|gb|AAH51263.1| ZNF573 protein [Homo sapiens] 57 9e-07
gi|12643428|sp|P35789|ZN93_HUMAN Zinc finger protein 93 (Zinc fi... 57 9e-07
gi|7305545|ref|NP_038772.1| zinc finger protein 354B; transcript... 57 9e-07
gi|7305637|ref|NP_038871.1| Zinc finger protein 118 [Mus musculu... 57 9e-07
gi|38093901|ref|XP_142976.2| similar to KRAB zinc finger protein... 57 9e-07
gi|38077821|ref|XP_128010.2| expressed sequence AW495315 [Mus mu... 57 9e-07
gi|46575668|gb|AAH69071.1| Zinc finger, imprinted 3 [Homo sapiens] 57 9e-07
gi|31225426|ref|XP_317570.1| ENSANGP00000007242 [Anopheles gambi... 57 9e-07
gi|18858925|ref|NP_571784.1| zinc finger homeobox 1 [Danio rerio... 57 9e-07
gi|22095021|ref|NP_666021.1| zinc finger protein 7; zinc finger ... 57 9e-07
gi|34880505|ref|XP_222679.2| similar to FRBZ1 [Rattus norvegicus] 57 9e-07
gi|29422256|gb|AAO84551.1| zinc finger protein [Capito niger] 57 9e-07
>gi|17509625|ref|NP_492877.1| hypermethylated in cancer 2 like (51.4
kD) (1L803) [Caenorhabditis elegans]
gi|6580258|emb|CAB04928.2| Hypothetical protein W06H12.1
[Caenorhabditis elegans]
gi|6580326|emb|CAB63395.1| Hypothetical protein W06H12.1
[Caenorhabditis elegans]
Length = 480
Score = 655 bits (1689), Expect = 0.0
Identities = 328/404 (81%), Positives = 328/404 (81%)
Frame = +1
Query: 1 KCTTCGATSVGLLSDCHDXXXXXXXXXXXXXXEEPPRRKPSAAGGDHDDEELECXXXXXX 180
KCTTCGATSVGLLSDCHD EEPPRRKPSAAGGDHDDEELEC
Sbjct: 77 KCTTCGATSVGLLSDCHDSATSTTTTVSHRSSEEPPRRKPSAAGGDHDDEELECSSIESR 136
Query: 181 XXXXXXXXXHTSAEDDETNQTMMVPTDVADVINAIVAXXXXXXXXXXXXXXKSPQXXXXX 360
HTSAEDDETNQTMMVPTDVADVINAIVA KSPQ
Sbjct: 137 SIRSVSSSVHTSAEDDETNQTMMVPTDVADVINAIVAGTNGSSNSNTTSSSKSPQEEEEE 196
Query: 361 HDLVMKXXXXXXXXXXXXXXXXXEKLENPLQDTALLDQFLQASLLGQTPTVTPASEENEE 540
HDLVMK EKLENPLQDTALLDQFLQASLLGQTPTVTPASEENEE
Sbjct: 197 HDLVMKSILSTTTSTSNTKLELSEKLENPLQDTALLDQFLQASLLGQTPTVTPASEENEE 256
Query: 541 DKEQNAVLTSFLQILFANQQAGNAILDAGXXXXXXXXXXXQPSPPADPTASLDSLAMFES 720
DKEQNAVLTSFLQILFANQQAGNAILDAG QPSPPADPTASLDSLAMFES
Sbjct: 257 DKEQNAVLTSFLQILFANQQAGNAILDAGSSENDGSTSSSQPSPPADPTASLDSLAMFES 316
Query: 721 LLAESMNGNVLDANTSSADQKAAARKRKSTPMKVPKSENGAGYICPMDGCNKVFKEKGSV 900
LLAESMNGNVLDANTSSADQKAAARKRKSTPMKVPKSENGAGYICPMDGCNKVFKEKGSV
Sbjct: 317 LLAESMNGNVLDANTSSADQKAAARKRKSTPMKVPKSENGAGYICPMDGCNKVFKEKGSV 376
Query: 901 HRHFVTHIGMRFNCDKCKASYTQKHALMLHQKIHANPDAYQCRGCGTNYTTQNGLRLHRQ 1080
HRHFVTHIGMRFNCDKCKASYTQKHALMLHQKIHANPDAYQCRGCGTNYTTQNGLRLHRQ
Sbjct: 377 HRHFVTHIGMRFNCDKCKASYTQKHALMLHQKIHANPDAYQCRGCGTNYTTQNGLRLHRQ 436
Query: 1081 RNPACMEVSNALEFNTSLNTSISEALSGPLSKNSSPTKQMVSAP 1212
RNPACMEVSNALEFNTSLNTSISEALSGPLSKNSSPTKQMVSAP
Sbjct: 437 RNPACMEVSNALEFNTSLNTSISEALSGPLSKNSSPTKQMVSAP 480