Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y54G2A_11
         (519 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|25153735|ref|NP_741349.1| c-type lectin precursor family memb...   331   5e-90
gi|39587933|emb|CAE67952.1| Hypothetical protein CBG13555 [Caeno...   248   3e-65
gi|25153712|ref|NP_741312.1| GalNAc-specific lectin like family ...   228   4e-59
gi|17561704|ref|NP_503546.1| GalNAc-specific lectin like family ...   227   1e-58
gi|25153708|ref|NP_741307.1| c-type lectin family member (4C0) [...   224   7e-58
gi|25153821|ref|NP_741309.1| polycystic kidney disease 1-like 2 ...   220   1e-56
gi|37620064|emb|CAB04352.2| Hypothetical protein F38A1.4 [Caenor...   220   1e-56
gi|25153704|ref|NP_741305.1| c-type lectin precursor family memb...   215   4e-55
gi|39580406|emb|CAE70966.1| Hypothetical protein CBG17779 [Caeno...   203   1e-51
gi|25396269|pir||A88962 protein F59A7.1 [imported] - Caenorhabdi...   194   1e-48
gi|17543492|ref|NP_500439.1| GalNAc-specific lectin like precurs...   192   3e-48
gi|17543576|ref|NP_500259.1| anticoagulant protein-B like family...   191   6e-48
gi|39593474|emb|CAE61766.1| Hypothetical protein CBG05726 [Caeno...   188   5e-47
gi|25396033|pir||F88656 protein F56D6.1 [imported] - Caenorhabdi...   186   2e-46
gi|32566297|ref|NP_500438.2| predicted CDS, c-type lectin family...   186   2e-46
gi|48060080|gb|AAF60602.3| Hypothetical protein Y46C8AL.5 [Caeno...   184   1e-45
gi|25148862|ref|NP_500442.2| c-type lectin family member (4E711)...   184   1e-45
gi|25148869|ref|NP_500449.2| c-type lectin precursor family memb...   184   1e-45
gi|25396032|pir||E88656 protein F56D6.2 [imported] - Caenorhabdi...   183   1e-45
gi|25148855|ref|NP_500437.2| c-type lectin precursor family memb...   183   1e-45
gi|30025078|gb|AAP13752.1| Hypothetical protein Y46C8AL.9 [Caeno...   182   4e-45
gi|32566137|ref|NP_500447.2| c-type lectin family member (4E729)...   182   4e-45
gi|17542574|ref|NP_500308.1| A Crystal Structure of like family ...   181   5e-45
gi|25148642|ref|NP_500258.2| c-type lectin precursor family memb...   181   6e-45
gi|48060081|gb|AAF60603.2| Hypothetical protein Y46C8AL.6 [Caeno...   179   2e-44
gi|17543498|ref|NP_500443.1| predicted CDS, RNA-directed DNA pol...   179   2e-44
gi|48060079|gb|AAF60599.2| Hypothetical protein Y46C8AL.4 [Caeno...   174   8e-43
gi|17543494|ref|NP_500440.1| predicted CDS, c-type lectin precur...   174   8e-43
gi|17543502|ref|NP_500446.1| predicted CDS, c-type lectin precur...   174   8e-43
gi|30025075|gb|AAP13751.1| Hypothetical protein Y46C8AR.2b [Caen...   174   1e-42
gi|33300304|emb|CAE17830.1| Hypothetical protein F38A1.14 [Caeno...   159   2e-38
gi|17543580|ref|NP_500257.1| c-type lectin precursor family memb...   159   3e-38
gi|17562686|ref|NP_507836.1| agkisasin-b like precursor family m...   154   1e-36
gi|17543508|ref|NP_500448.1| c-type lectin family member (22.4 k...   152   2e-36
gi|25153825|ref|NP_741310.1| c-type lectin family member (4C9) [...   142   3e-33
gi|37620063|emb|CAB04357.2| Hypothetical protein F38A1.7 [Caenor...   142   3e-33
gi|39579290|emb|CAE56946.1| Hypothetical protein CBG24793 [Caeno...   114   1e-24
gi|39581194|emb|CAE73599.1| Hypothetical protein CBG21085 [Caeno...   114   1e-24
gi|39587934|emb|CAE67953.1| Hypothetical protein CBG13556 [Caeno...   112   4e-24
gi|31746577|gb|AAF59584.2| Hypothetical protein Y54G2A.14 [Caeno...   111   8e-24
gi|39587916|emb|CAE67935.1| Hypothetical protein CBG13535 [Caeno...   107   2e-22
gi|17543574|ref|NP_500262.1| c-type lectin precursor family memb...   105   3e-22
gi|39579883|emb|CAE56619.1| Hypothetical protein CBG24375 [Caeno...   105   6e-22
gi|17544700|ref|NP_502450.1| serum lectin like precursor family ...   102   4e-21
gi|38176075|gb|AAC69343.2| Hypothetical protein Y73C8C.2 [Caenor...   101   8e-21
gi|17543590|ref|NP_500260.1| c-type lectin family member (4D604)...   100   1e-20
gi|39588558|emb|CAE58081.1| Hypothetical protein CBG01162 [Caeno...    94   2e-18
gi|39588559|emb|CAE58082.1| Hypothetical protein CBG01163 [Caeno...    90   2e-17
gi|17561482|ref|NP_503676.1| c-type lectin precursor family memb...    90   2e-17
gi|17566234|ref|NP_503855.1| c-type lectin family member (5D599)...    83   2e-15
gi|39587935|emb|CAE67954.1| Hypothetical protein CBG13557 [Caeno...    75   7e-13
gi|17541218|ref|NP_500091.1| predicted CDS, c-type lectin family...    70   2e-11
gi|47270749|gb|AAC04420.2| Hypothetical protein K03H6.4 [Caenorh...    70   2e-11
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno...    67   2e-10
gi|17544698|ref|NP_502451.1| phospholipase A2 receptor precursor...    54   1e-06
gi|39586804|emb|CAE65847.1| Hypothetical protein CBG10980 [Caeno...    53   3e-06
gi|33243078|gb|AAQ01209.1| C-type lectin CTL-6 [Bitis arietans]        51   1e-05
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa]            50   2e-05
gi|11066256|gb|AAG28522.1| halyxin B-chain precursor [Gloydius h...    50   2e-05
gi|50801414|ref|XP_424170.1| PREDICTED: similar to mannose recep...    50   2e-05
gi|39585191|emb|CAE57434.1| Hypothetical protein CBG00395 [Caeno...    50   3e-05
gi|33332305|gb|AAQ11364.1| crotocetin-1 [Crotalus durissus terri...    49   4e-05
gi|4337052|gb|AAD18056.1| fibrinogen clotting inhibitor B chain ...    49   4e-05
gi|7497641|pir||T20063 hypothetical protein C49C3.13 - Caenorhab...    49   5e-05
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec...    49   5e-05
gi|32566191|ref|NP_503091.2| c-type lectin family member (4S295)...    49   5e-05
gi|33243082|gb|AAQ01211.1| C-type lectin CTL-1 [Echis ocellatus]       49   7e-05
gi|21260584|gb|AAM43809.1| C-type lectin-like protein TMVA B cha...    48   9e-05
gi|25245527|gb|AAN72437.1| flavocetin-A beta chain [Trimeresurus...    48   9e-05
gi|31559797|ref|NP_853527.1| mannose receptor-like [Mus musculus...    48   1e-04
gi|31322514|gb|AAP22987.1| mannose receptor precursor-like isofo...    48   1e-04
gi|13445904|gb|AAK26430.1| agkisasin-b [Deinagkistrodon acutus]        48   1e-04
gi|31322510|gb|AAP22985.1| mannose receptor precursor-like isofo...    48   1e-04
gi|5764609|gb|AAD51335.1| CD23 homolog [Ancylostoma ceylanicum]        48   1e-04
gi|31322506|gb|AAP22983.1| mannose receptor precursor-like isofo...    48   1e-04
gi|31559055|gb|AAP50528.1| agkisasin-b [Deinagkistrodon acutus]        48   1e-04
gi|31322508|gb|AAP22984.1| mannose receptor precursor-like isofo...    48   1e-04
gi|33341214|gb|AAQ15168.1| stejaggregin-A beta chain-2 [Trimeres...    47   1e-04
gi|6980876|pdb|1QDD|A Chain A, Crystal Structure Of Human Lithos...    47   1e-04
gi|321190|pir||A45751 pancreatic stone protein precursor - human...    47   2e-04
gi|29725633|ref|NP_002900.2| regenerating islet-derived 1 alpha ...    47   2e-04
gi|12060181|dbj|BAB20441.1| anticoagulant protein-B [Deinagkistr...    47   2e-04
gi|33332307|gb|AAQ11365.1| crotocetin [Crotalus durissus terrifi...    47   2e-04
gi|39587936|emb|CAE67955.1| Hypothetical protein CBG13558 [Caeno...    47   2e-04
gi|14719571|pdb|1IOD|B Chain B, Crystal Structure Of The Complex...    47   2e-04
gi|1942639|pdb|1LIT|  Human Lithostathine                              47   2e-04
gi|33638231|gb|AAQ24216.1| coagulation factor IX-binding protein...    47   2e-04
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;...    47   2e-04
gi|17565466|ref|NP_507951.1| lithostathine like family member (5...    46   3e-04
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica]        46   3e-04
gi|33504575|ref|NP_872425.1| secretory protein LOC348174 [Homo s...    46   3e-04
gi|33341216|gb|AAQ15169.1| stejaggregin-A beta chain-3 [Trimeres...    46   3e-04
gi|50418413|gb|AAH78143.1| Secretory protein LOC348174 [Homo sap...    46   3e-04
gi|22760438|dbj|BAC11199.1| unnamed protein product [Homo sapiens]     46   3e-04
gi|1839442|gb|AAB47093.1| platelet glycoprotein Ib-binding prote...    46   3e-04
gi|47223929|emb|CAG06106.1| unnamed protein product [Tetraodon n...    46   3e-04
gi|7674107|sp|Q9YGP1|LECG_TRIST Galactose-binding lectin precurs...    46   4e-04
gi|10120636|pdb|1EGG|A Chain A, Structure Of A C-Type Carbohydra...    46   4e-04
gi|20562943|gb|AAM22789.1| ACF 1/2 B-chain [Deinagkistrodon acutus]    45   6e-04
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica]        45   6e-04
gi|47217439|emb|CAG10208.1| unnamed protein product [Tetraodon n...    45   6e-04
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n...    45   7e-04
gi|33341212|gb|AAQ15167.1| stejaggregin-A beta chain-1 [Trimeres...    45   7e-04
gi|190981|gb|AAA36559.1| regenerating protein (reg)                    45   0.001
gi|33243080|gb|AAQ01210.1| C-type lectin CTL-8 [Bitis arietans] ...    45   0.001
gi|37575445|gb|AAQ93687.1| mucrocetin beta chain [Protobothrops ...    45   0.001
gi|6677703|ref|NP_033068.1| regenerating islet-derived 1; rat re...    44   0.001
gi|34877265|ref|XP_225585.2| similar to macrophage mannose recep...    44   0.001
gi|33341190|gb|AAQ15156.1| factor IX/X binding protein beta chai...    44   0.002
gi|47218860|emb|CAG02845.1| unnamed protein product [Tetraodon n...    44   0.002
gi|477362|pir||A48925 mannose receptor precursor, macrophage - m...    44   0.002
gi|181168|gb|AAA35726.1| proteoglycan core protein                     44   0.002
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic...    44   0.002
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (...    44   0.002
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr...    44   0.002
gi|18252678|gb|AAL66390.1| antithrombin 1 B chain [Deinagkistrod...    44   0.002
gi|33332301|gb|AAQ11362.1| convulxin subunit b [Crotalus durissu...    44   0.002
gi|25090034|sp|O93427|CVXB_CRODU Convulxin beta precursor (CVX b...    44   0.002
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr...    44   0.002
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA...    44   0.002
gi|6678932|ref|NP_032651.1| mannose receptor, C type 1 [Mus musc...    44   0.002
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro...    44   0.002
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus]                       44   0.002
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ...    44   0.002
gi|1514645|emb|CAA42701.1| cartilage aggregating proteoglycan [S...    44   0.002
gi|50729858|ref|XP_416682.1| PREDICTED: similar to Chondrolectin...    44   0.002
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma...    44   0.002
gi|399126|sp|P22030|BOTB_BOTJA Botrocetin, beta chain (Platelet ...    44   0.002
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno...    44   0.002
gi|33243086|gb|AAQ01213.1| C-type lectin CTL-3 [Echis carinatus ...    44   0.002
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo...    44   0.002
gi|17538888|ref|NP_503095.1| predicted CDS, c-type lectin family...    44   0.002
gi|1082777|pir||B56395 secretory phospholipase A2 receptor precu...    43   0.003
gi|23321263|gb|AAN23126.1| agglucetin-beta 1 subunit precursor [...    43   0.003
gi|19923389|ref|NP_031392.2| phospholipase A2 receptor 1 [Homo s...    43   0.003
gi|26344636|dbj|BAC35967.1| unnamed protein product [Mus musculus]     43   0.003
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le...    43   0.004
gi|2851436|sp|P23807|IXB_TRIFL Coagulation factor IX/factor X-bi...    43   0.004
gi|2134245|pir||JC5059 bitiscetin beta chain - puff adder >gnl|B...    43   0.004
gi|23321265|gb|AAN23127.1| agglucetin-beta 2 subunit precursor [...    43   0.004
gi|37360054|dbj|BAC98005.1| mKIAA0709 protein [Mus musculus]           43   0.004
gi|3023232|sp|P81114|ABA4_TRIAB Alboaggregin A subunit 4               43   0.004
gi|7512196|pir||JC7105 aggretin beta chain - Malayan pit viper >...    42   0.005
gi|31335113|gb|AAO32796.1| polycystic kidney disease 1-like 2 [H...    42   0.005
gi|11344844|gb|AAG34498.1| CD94 [Macaca mulatta]                       42   0.005
gi|33341210|gb|AAQ15166.1| stejaggregin-A alpha chain [Trimeresu...    42   0.005
gi|20978415|sp|Q9MZK9|CD94_MACMU Natural killer cells antigen CD...    42   0.005
gi|8347155|gb|AAF74529.1| CD94 [Macaca mulatta]                        42   0.005
gi|2627436|gb|AAB86683.1| PKD1 gene product [Takifugu rubripes]        42   0.005
gi|37181871|gb|AAQ88739.1| LHPE306 [Homo sapiens]                      42   0.006
gi|42660902|ref|XP_375369.1| similar to LHPE306 [Homo sapiens]         42   0.006
gi|25395663|pir||B88392 protein R06B10.3 [imported] - Caenorhabd...    42   0.006
gi|17554488|ref|NP_497312.1| pancreatitis-associated protein pre...    42   0.006
gi|34877879|ref|XP_341575.1| similar to collectin placenta 1 [Ra...    42   0.008
gi|6677705|ref|NP_033069.1| regenerating islet-derived 2; rat re...    42   0.008
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti...    42   0.008
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens]    42   0.008
gi|33341200|gb|AAQ15161.1| stejaggregin-B alpha chain-2 [Trimere...    42   0.008
gi|33341208|gb|AAQ15165.1| stejaggregin-B alpha chain-4 [Trimere...    42   0.008
gi|33341198|gb|AAQ15160.1| stejaggregin-B alpha chain-1 [Trimere...    42   0.008
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens]            42   0.008
gi|39655010|pdb|1V4L|B Chain B, Crystal Structure Of A Platelet ...    42   0.008
gi|38493076|pdb|1UOS|B Chain B, The Crystal Structure Of The Sna...    42   0.008
gi|3212544|pdb|1IXX|B Chain B, Crystal Structure Of Coagulation ...    42   0.008
gi|17559330|ref|NP_504977.1| c-type lectin precursor family memb...    42   0.008
gi|26335321|dbj|BAC31361.1| unnamed protein product [Mus musculus]     41   0.010
gi|21901969|dbj|BAC05523.1| collectin placenta 1 [Mus musculus] ...    41   0.010
gi|20977545|ref|NP_624360.1| chondrolectin [Mus musculus] >gnl|B...    41   0.010
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb...    41   0.010
gi|30794342|ref|NP_851369.1| surfactant, pulmonary-associated pr...    41   0.010
gi|423283|pir||S33603 surfactant protein D - bovine                    41   0.010
gi|39654959|pdb|1UMR|C Chain C, Crystal Structure Of The Platele...    41   0.010
gi|7245413|pdb|1C3A|B Chain B, Crystal Structure Of Flavocetin-A...    41   0.010
gi|47218445|emb|CAG03717.1| unnamed protein product [Tetraodon n...    41   0.010
gi|33341186|gb|AAQ15154.1| factor IX/X binding protein beta chai...    41   0.010
gi|26345454|dbj|BAC36378.1| unnamed protein product [Mus musculus]     41   0.014
gi|17538882|ref|NP_503093.1| predicted CDS, c-type lectin family...    41   0.014
gi|26326981|dbj|BAC27234.1| unnamed protein product [Mus musculus]     41   0.014
gi|20127636|ref|NP_079220.2| chondrolectin precursor; transmembr...    41   0.014
gi|13898378|gb|AAK48711.1| E-selectin [Ovis aries]                     41   0.014
gi|27670608|ref|XP_221686.1| similar to c-type lectin protein MT...    41   0.014
gi|12851982|dbj|BAB29226.1| unnamed protein product [Mus musculus]     41   0.014
gi|20978414|sp|Q9MZ41|CD94_PANTR Natural killer cells antigen CD...    41   0.014
gi|4504889|ref|NP_002253.1| killer cell lectin-like receptor sub...    41   0.014
gi|32469212|dbj|BAC78902.1| C-type lectin [Echidna delicatula]         41   0.014
gi|5542082|pdb|1B6E|  Human Cd94                                       41   0.014
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb...    41   0.014
gi|2597921|emb|CAA04230.1| C-type lectin [Homo sapiens]                41   0.014
gi|7669499|ref|NP_031360.1| killer cell lectin-like receptor sub...    41   0.014
gi|18875404|ref|NP_573501.1| CD209a antigen [Mus musculus] >gnl|...    40   0.018
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus]                 40   0.018
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep...    40   0.018
gi|6715115|gb|AAF26287.1| agkisacutacin B chain [Deinagkistrodon...    40   0.018
gi|11277029|pir||JC7135 agkisacutacin beta chain precursor - sha...    40   0.018
gi|12583677|dbj|BAB21452.1| factor XI/factor X binding protein A...    40   0.018
gi|33598942|ref|NP_443124.2| polycystin 1-like 2 isoform a [Homo...    40   0.018
gi|31075310|gb|AAP43904.1| chondrolectin variant CHODLFdeltaE [H...    40   0.018
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B...    40   0.018
gi|2851435|sp|P23806|IXA_TRIFL Coagulation factor IX/factor X-bi...    40   0.018
gi|33341192|gb|AAQ15157.1| factor IX/X binding protein beta chai...    40   0.018
gi|33598940|ref|NP_877417.1| polycystin 1-like 2 isoform b [Homo...    40   0.018
gi|6981470|ref|NP_036773.1| regenerating islet-derived 1; RATLIT...    40   0.018
gi|16660119|gb|AAL27539.1| DC-SIGN neck-less isoform [Mus musculus]    40   0.018
gi|10434231|dbj|BAB14181.1| unnamed protein product [Homo sapien...    40   0.018
gi|16923229|gb|AAL29936.1| lectin 2c [Girardia tigrina]                40   0.018
gi|2134244|pir||JC5058 bitiscetin alpha chain - puff adder >gnl|...    40   0.023
gi|50737082|ref|XP_419148.1| PREDICTED: similar to collectin sub...    40   0.023
gi|31075306|gb|AAP43902.1| chondrolectin variant CHODLdeltaE [Ho...    40   0.023
gi|47228322|emb|CAG07717.1| unnamed protein product [Tetraodon n...    40   0.023
gi|46195838|ref|NP_996866.1| yolk sac IgY receptor [Gallus gallu...    40   0.023
gi|47210804|emb|CAF89796.1| unnamed protein product [Tetraodon n...    40   0.023
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor...    40   0.023
gi|18485494|ref|NP_569716.1| collectin sub-family member 12 [Mus...    40   0.030
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ...    40   0.030
gi|33341196|gb|AAQ15159.1| stejaggregin-B beta chain-2 [Trimeres...    40   0.030
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens]                     40   0.030
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]...    40   0.030
gi|33341202|gb|AAQ15162.1| stejaggregin-B alpha chain-3 [Trimere...    40   0.030
gi|25245561|gb|AAN72438.1| flavocetin-A alpha chain [Trimeresuru...    40   0.030
gi|4337050|gb|AAD18055.1| fibrinogen clotting inhibitor A chain ...    40   0.030
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ...    40   0.030
gi|50732401|ref|XP_418618.1| PREDICTED: similar to Macrophage ma...    40   0.030
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f...    40   0.030
gi|47223875|emb|CAG06052.1| unnamed protein product [Tetraodon n...    40   0.030
gi|47213064|emb|CAF91578.1| unnamed protein product [Tetraodon n...    39   0.040
gi|10835248|ref|NP_006498.1| regenerating islet-derived 1 beta p...    39   0.040
gi|33341194|gb|AAQ15158.1| stejaggregin-B beta chain-1 [Trimeres...    39   0.040
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus]     39   0.040
gi|8347153|gb|AAF74528.1| CD94-B [Macaca mulatta]                      39   0.040
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h...    39   0.040
gi|33341184|gb|AAQ15153.1| factor IX/X binding protein alpha cha...    39   0.040
gi|48428079|sp|Q8MHY9|CD94_PONPY Natural killer cells antigen CD...    39   0.040
gi|21902259|gb|AAM78484.1| natural killer cell receptor [Pongo p...    39   0.040
gi|21902253|gb|AAM78481.1| natural killer cell receptor [Pongo p...    39   0.040
gi|21902257|gb|AAM78483.1| natural killer cell receptor [Pongo p...    39   0.040
gi|29570599|emb|CAD69922.1| surfactant protein D [Bos taurus]          39   0.040
gi|39593192|emb|CAE64661.1| Hypothetical protein CBG09433 [Caeno...    39   0.040
gi|33243098|gb|AAQ01219.1| C-type lectin CTL-4 [Echis pyramidum ...    39   0.040
gi|33243090|gb|AAQ01215.1| C-type lectin CTL-8 [Echis carinatus ...    39   0.040
gi|47216729|emb|CAG01003.1| unnamed protein product [Tetraodon n...    39   0.052
gi|31541842|ref|NP_083962.1| polycystin 1-like 2; polycystic kid...    39   0.052
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co...    39   0.052
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ...    39   0.052
gi|34870126|ref|XP_221778.2| similar to DC-SIGN [Rattus norvegicus]    39   0.052
gi|1352704|sp|P49259|PA2R_BOVIN 180 kDa secretory phospholipase ...    39   0.052
gi|211655|gb|AAA48720.1| proteoglycan core protein                     39   0.052
gi|17551160|ref|NP_509202.1| lithostathine like precursor family...    39   0.068
gi|27806407|ref|NP_776606.1| selectin E [endothelial adhesion mo...    39   0.068
gi|18959248|ref|NP_579840.1| oxidised low density lipoprotein (l...    39   0.068
gi|37575443|gb|AAQ93686.1| mucrocetin alpha chain [Protobothrops...    39   0.068
gi|21260582|gb|AAM43808.1| C-type lectin-like protein TMVA A cha...    39   0.068
gi|13876737|gb|AAK43585.1| C-type lectin-like protein 2 [Bungaru...    39   0.068
gi|33598009|ref|NP_885652.1| DNA repair protein [Bordetella para...    39   0.068
gi|1352705|sp|P49260|PA2R_RABIT 180 kDa secretory phospholipase ...    39   0.068
gi|33602915|ref|NP_890475.1| DNA repair protein [Bordetella bron...    39   0.068
gi|33593489|ref|NP_881133.1| DNA repair protein [Bordetella pert...    39   0.068
gi|2146870|pir||S72579 hypothetical protein C35D10.1 - Caenorhab...    39   0.068
gi|17552508|ref|NP_498022.1| c-type lectin and CUB domain contai...    39   0.068
gi|7993934|sp|P81996|ECHB_ECHCA Echicetin beta subunit >gnl|BL_O...    39   0.068
gi|2764394|emb|CAA03845.1| CD94-B protein [Homo sapiens]               38   0.088
gi|39585193|emb|CAE57436.1| Hypothetical protein CBG00397 [Caeno...    38   0.088
gi|17539722|ref|NP_502373.1| UDP-glucuronosyltransferase family ...    38   0.12
gi|691753|dbj|BAA06444.1| phospholipase A2 receptor [Homo sapiens]     38   0.12
gi|20196239|dbj|BAB47156.2| skin mucus 31.7 kDa lectin AJL-2 [An...    38   0.12
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ...    38   0.12
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [...    38   0.12
gi|50732663|ref|XP_425982.1| PREDICTED: similar to Macrophage ma...    38   0.12
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID...    38   0.12
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote...    38   0.12
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus]        38   0.12
gi|833853|gb|AAA67565.1| versican V2 core protein precursor            38   0.12
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ...    38   0.12
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p...    38   0.12
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi...    38   0.12
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ...    38   0.12
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [...    38   0.12
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr...    38   0.12
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens]        38   0.12
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ...    38   0.12
gi|4808979|gb|AAD30040.1| receptor protein-tyrosine kinase; HTK2...    38   0.12
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens]        38   0.12
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|...    38   0.12
gi|25090912|sp|P82596|PLC_HALLA Perlucin                               38   0.12
gi|2120992|pir||I40317 DNA repair protein - Bordetella pertussis...    38   0.12
gi|48476206|gb|AAT44378.1| REJ2CRD [Hemicentrotus pulcherrimus]        38   0.12
gi|206105|gb|AAA41836.1| proteoglycan                                  37   0.15
gi|39590706|emb|CAE65076.1| Hypothetical protein CBG09931 [Caeno...    37   0.15
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n...    37   0.15
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr...    37   0.15
gi|3287903|sp|P81397|RHCA_AGKRH Rhodocetin alpha subunit               37   0.15
gi|129887|sp|P07897|PGCA_RAT Aggrecan core protein precursor (Ca...    37   0.15
gi|33243094|gb|AAQ01217.1| C-type lectin CTL-9 [Echis carinatus ...    37   0.15
gi|6671523|ref|NP_031450.1| aggrecan 1; aggrecan, structural pro...    37   0.15
gi|3023230|sp|P81112|ABA2_TRIAB Alboaggregin A subunit 2               37   0.15
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE...    37   0.15
gi|16923227|gb|AAL29934.1| lectin 2b [Girardia tigrina]                37   0.15
gi|11277030|pir||S78774 perlucin - Haliotis laevigata                  37   0.15
gi|48476212|gb|AAT44381.1| REJ2CRD [Strongylocentrotus pallidus]       37   0.15
gi|48476204|gb|AAT44377.1| REJ2CRD [Allocentrotus fragilis]            37   0.15
gi|15225819|ref|NP_180260.1| ubiquitin-associated (UBA)/TS-N dom...    37   0.20
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g...    37   0.20
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens]          37   0.20
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_...    37   0.20
gi|17570059|ref|NP_509919.1| asialoglycoprotein receptor family ...    37   0.20
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul...    37   0.20
gi|7188569|gb|AAF37805.1| lectin-like receptor F1, splice varian...    37   0.20
gi|20149720|ref|NP_619589.1| oxidized low density lipoprotein (l...    37   0.20
gi|39655009|pdb|1V4L|A Chain A, Crystal Structure Of A Platelet ...    37   0.20
gi|34922645|sp|Q9PSN0|LECG_BITAR Galactose-specific lectin (PAL)...    37   0.20
gi|7705574|ref|NP_057607.1| killer cell lectin-like receptor sub...    37   0.20
gi|625317|pir||LNRC3 lectin BRA3-2 precursor - barnacle (Megabal...    37   0.20
gi|13810902|gb|AAK40085.1| brevican soluble core protein precurs...    37   0.20
gi|1730116|sp|P07439|LEC3_MEGRO Lectin BRA-3 precursor >gnl|BL_O...    37   0.20
gi|3023231|sp|P81113|ABA3_TRIAB Alboaggregin A subunit 3               37   0.20
gi|6677921|ref|NP_033186.1| surfactant associated protein D [Mus...    37   0.20
gi|10121695|gb|AAG13327.1| mannose receptor C type 2 [Gillichthy...    37   0.20
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas...    37   0.26
gi|13898376|gb|AAK48710.1| E-selectin [Odocoileus hemionus]            37   0.26
gi|126130|sp|P21963|LECG_CROAT Galactose-specific lectin >gnl|BL...    37   0.26
gi|28981404|gb|AAH48780.1| Similar to phospholipase A2, group IB...    37   0.26
gi|47226918|emb|CAG05810.1| unnamed protein product [Tetraodon n...    37   0.26
gi|39586117|emb|CAE69193.1| Hypothetical protein CBG15230 [Caeno...    37   0.26
gi|47564066|ref|NP_001001158.1| DEC-205/CD205 protein [Bos tauru...    37   0.26
gi|32699622|sp|Q9PRS8|OC17_CHICK Ovocleidin 17 (OC-17) >gnl|BL_O...    37   0.26
gi|9910412|ref|NP_064369.1| C-type lectin-like receptor 2 [Mus m...    37   0.26
gi|39581873|emb|CAE60767.1| Hypothetical protein CBG04455 [Caeno...    37   0.26
gi|47523028|ref|NP_999275.1| lung surfactant protein D [Sus scro...    37   0.26
gi|47551311|ref|NP_999836.1| echinoidin [Strongylocentrotus purp...    37   0.26
gi|24266774|gb|AAN52336.1| nematocyst outer wall antigen precurs...    36   0.34
gi|7513707|pir||JE0111 lectin-like oxidized LDL receptor - mouse       36   0.34
gi|3212543|pdb|1IXX|A Chain A, Crystal Structure Of Coagulation ...    36   0.34
gi|1478015|gb|AAB36402.1| ECLV IX/X-bp beta subunit=Ca(2+)-depen...    36   0.34
gi|31615312|pdb|1GZ2|A Chain A, Crystal Structure Of The Ovoclei...    36   0.34
gi|33417124|gb|AAH56052.1| Colec11-prov protein [Xenopus laevis]       36   0.34
gi|33243092|gb|AAQ01216.1| C-type lectin CTL-27 [Echis ocellatus]      36   0.34
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris]    36   0.34
gi|34922643|sp|Q9PSM4|LECG_LACST Galactose-specific lectin (Muti...    36   0.44
gi|47219432|emb|CAG10796.1| unnamed protein product [Tetraodon n...    36   0.44
gi|1364010|pir||JC4329 coagulation factor IX-binding protein A c...    36   0.44
gi|34870064|ref|XP_221789.2| similar to DC-SIGN [Rattus norvegicus]    36   0.44
gi|625318|pir||LNRC1 lectin BRA3-1 precursor - barnacle (Megabal...    36   0.44
gi|26331710|dbj|BAC29585.1| unnamed protein product [Mus musculus]     36   0.44
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B...    35   0.57
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus]                     35   0.57
gi|1143285|gb|AAA87847.1| brevican core protein                        35   0.57
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_...    35   0.57
gi|12831201|gb|AAK08513.1| natural killer cell receptor protein ...    35   0.57
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n...    35   0.57
gi|50872143|ref|NP_001002890.1| killer cell lectin-like receptor...    35   0.57
gi|17553354|ref|NP_497168.1| predicted CDS, C type lectin (3A790...    35   0.57
gi|4808975|gb|AAD30038.1| receptor protein-tyrosine kinase; HTK2...    35   0.57
gi|40792609|gb|AAR90331.1| CD94/NKR-P1-like protein [Ciona intes...    35   0.57
gi|19584340|emb|CAD28466.1| hypothetical protein [Homo sapiens]        35   0.75
gi|45259478|dbj|BAD12391.1| aggrecan [Danio rerio]                     35   0.75
gi|3023233|sp|P81115|ABBA_TRIAB Alboaggregin B alpha subunit           35   0.75
gi|18641360|ref|NP_569057.1| collectin sub-family member 12 isof...    35   0.75
gi|25392184|pir||JC7595 scavenger receptor with C-type lectin ty...    35   0.75
gi|38174510|gb|AAH60789.1| Collectin sub-family member 12, isofo...    35   0.75
gi|24137227|gb|AAN47097.1| dendritic cell-associated C-type lect...    35   0.75
gi|12831199|gb|AAK08512.1| natural killer cell receptor protein ...    35   0.75
gi|27545354|ref|NP_775414.1| killer cell lectin-like receptor su...    35   0.75
gi|34328454|ref|NP_085102.3| killer cell lectin-like receptor su...    35   0.75
gi|39582561|emb|CAE63880.1| Hypothetical protein CBG08446 [Caeno...    35   0.75
gi|49455204|emb|CAF22244.1| NKp80 receptor [Macaca mulatta]            35   0.75
gi|47605899|sp|Q8MI05|KLR1_MACFA Killer cell lectin-like recepto...    35   0.75
gi|17555734|ref|NP_499381.1| von Willebrand factor, type A and c...    35   0.75
gi|24655071|ref|NP_728586.1| CG9134-PA [Drosophila melanogaster]...    35   0.75
gi|4808977|gb|AAD30039.1| receptor protein-tyrosine kinase; HTK2...    35   0.75
gi|50800509|ref|XP_428473.1| PREDICTED: similar to amino acid fe...    35   0.75
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans]        35   0.75
gi|32450274|gb|AAH53817.1| MGC64513 protein [Xenopus laevis]           35   0.75
gi|24655067|ref|NP_612091.1| CG9134-PB [Drosophila melanogaster]...    35   0.75
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat...    35   0.98
gi|50751073|ref|XP_422246.1| PREDICTED: similar to E-selectin pr...    35   0.98
gi|50771662|ref|XP_423145.1| PREDICTED: similar to E-selectin pr...    35   0.98
gi|12841992|dbj|BAB25429.1| unnamed protein product [Mus musculu...    35   0.98
gi|13385824|ref|NP_080604.1| regenerating islet-derived family, ...    35   0.98
gi|17559336|ref|NP_504976.1| predicted CDS, tetranectin like pre...    35   0.98
gi|17543490|ref|NP_500441.1| predicted CDS, putative protein of ...    35   0.98
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ...    35   0.98
gi|33243102|gb|AAQ01221.1| C-type lectin CTL-7 [Echis pyramidum ...    35   0.98
gi|16923225|gb|AAL29932.1| lectin 2a [Girardia tigrina]                35   0.98
gi|25527245|pir||JC7786 lectin CEL-I, N-acetyl-D-galactosamine-s...    35   0.98
gi|17531345|ref|NP_494427.1| predicted CDS, c-type lectin and CU...    34   1.3
gi|28202063|ref|NP_780735.1| C-type lectin-like receptor-1 [Mus ...    34   1.3
gi|34098771|sp|Q9YI92|MMHB_AGKHA Mamushigin beta chain precursor...    34   1.3
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_...    34   1.3
gi|7245412|pdb|1C3A|A Chain A, Crystal Structure Of Flavocetin-A...    34   1.3
gi|40792606|gb|AAR90330.1| CD94/NKR-P1-like protein [Ciona intes...    34   1.3
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor...    34   1.3
gi|47551243|ref|NP_999802.1| receptor for egg jelly 2 protein [S...    34   1.3
gi|46395875|sp|Q8HY02|C209_HYLSY CD209 antigen (Dendritic cell-s...    34   1.3
gi|29349586|ref|NP_813089.1| two-component system sensor histidi...    34   1.3
gi|34870118|ref|XP_221808.2| similar to DC-SIGN [Rattus norvegicus]    34   1.3
gi|31127134|gb|AAH52840.1| C-type lectin-like receptor-1 [Mus mu...    34   1.7
gi|26340354|dbj|BAC33840.1| unnamed protein product [Mus musculus]     34   1.7
gi|21541951|sp|P83300|ACAL_ANSAN Ansocalcin                            34   1.7
gi|33243072|gb|AAQ01206.1| C-type lectin CTL-1 [Bitis arietans]        34   1.7
gi|31879369|dbj|BAC77706.1| EMS16 A chain [Echis multisquamatus]       34   1.7
gi|32469210|dbj|BAC78901.1| C-type lectin [Gymnothorax flavimarg...    34   1.7
gi|19424220|ref|NP_598234.1| Fc receptor, IgE, low affinity II, ...    34   1.7
gi|27803388|gb|AAO19649.1| CD94-1/NKR-P1-related receptor [Botry...    34   1.7
gi|46396751|sp|P83515|STR2_STRCA Struthiocalcin-2 (SCA-2)              34   1.7
gi|34013698|gb|AAQ56012.1| lectin protein type I [Hippocampus co...    34   1.7
gi|17560376|ref|NP_508027.1| bone morphogenetic protein 1 family...    34   1.7
gi|19070849|gb|AAL84004.1| CD23 [Rattus norvegicus]                    34   1.7
gi|38493055|pdb|1UKM|A Chain A, Crystal Structure Of Ems16, An A...    34   1.7
gi|47214539|emb|CAG04559.1| unnamed protein product [Tetraodon n...    34   1.7
gi|17538770|ref|NP_502375.1| predicted CDS, receptor for egg jel...    33   2.2
gi|18252680|gb|AAL66391.1| antithrombin 1 A chain [Deinagkistrod...    33   2.2
gi|31879371|dbj|BAC77707.1| EMS16 B chain [Echis multisquamatus]       33   2.2
gi|3287904|sp|P81398|RHCB_AGKRH Rhodocetin beta subunit                33   2.2
gi|47230595|emb|CAF99788.1| unnamed protein product [Tetraodon n...    33   2.2
gi|50766697|ref|XP_423011.1| PREDICTED: similar to amino acid fe...    33   2.2
gi|47228554|emb|CAG05374.1| unnamed protein product [Tetraodon n...    33   2.2
gi|19571560|emb|CAD27470.1| SPAPB18E9.04c [Schizosaccharomyces p...    33   2.2
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ...    33   2.2
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ...    33   2.2
gi|50786686|ref|XP_423496.1| PREDICTED: similar to amino acid fe...    33   2.8
gi|49258206|ref|NP_001001856.1| collectin 46 [Bos taurus] >gnl|B...    33   2.8
gi|13236930|gb|AAB28792.2| low affinity IgE Fc receptor isoform ...    33   2.8
gi|560482|emb|CAA45532.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m...    33   2.8
gi|560484|emb|CAA45533.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m...    33   2.8
gi|13236931|gb|AAB28793.2| low affinity IgE Fc receptor isoform ...    33   2.8
gi|34858498|ref|XP_342766.1| similar to NATURAL KILLER CELL SURF...    33   2.8
gi|39583088|emb|CAE60628.1| Hypothetical protein CBG04271 [Caeno...    33   2.8
gi|13236929|gb|AAB28791.2| low affinity IgE Fc receptor isoform ...    33   2.8
gi|7110216|gb|AAF36830.1| C-type lectin-like receptor-1 [Homo sa...    33   2.8
gi|37577103|ref|NP_057595.2| C-type lectin-like receptor-1 [Homo...    33   2.8
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8...    33   2.8
gi|22760992|dbj|BAC11410.1| unnamed protein product [Homo sapien...    33   2.8
gi|225342|prf||1301209A lectin                                         33   2.8
gi|18476520|gb|AAL58516.1| Fc epsilon receptor II subtype b vari...    33   2.8
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]...    33   2.8
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus]                      33   2.8
gi|18476522|gb|AAL58517.1| Fc epsilon receptor II subtype b vari...    33   2.8
gi|14579651|gb|AAK69351.1| akitonin precursor [Deinagkistrodon a...    33   2.8
gi|7305051|ref|NP_038545.1| Fc receptor, IgE, low affinity II, a...    33   2.8
gi|50744990|ref|XP_426207.1| PREDICTED: similar to collectin sub...    33   2.8
gi|39594761|emb|CAE70629.1| Hypothetical protein CBG17315 [Caeno...    33   2.8
gi|34870122|ref|XP_221790.2| similar to SIGNR4 [Rattus norvegicus]     33   3.7
gi|13384604|ref|NP_072092.2| C-type lectin, superfamily member 1...    33   3.7
gi|37675379|ref|NP_922941.1| C-type lectin, superfamily member 1...    33   3.7
gi|4838459|gb|AAD31000.1| C-type lectin Tc-ctl-4 [Toxocara canis]      33   3.7
gi|37675373|ref|NP_922938.1| C-type lectin, superfamily member 1...    33   3.7
gi|50762093|ref|XP_424932.1| PREDICTED: similar to embryonic bla...    33   3.7
gi|4505501|ref|NP_002534.1| oxidised low density lipoprotein (le...    33   3.7
gi|33468736|dbj|BAC81565.1| oxidised low density lipoprotein (le...    33   3.7
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor...    33   3.7
gi|6981136|ref|NP_036877.1| killer cell lectin-like receptor, su...    33   3.7
gi|50750535|ref|XP_422038.1| PREDICTED: similar to Lymphocyte an...    33   3.7
gi|50728260|ref|XP_416058.1| PREDICTED: similar to amino acid fe...    33   3.7
gi|38090330|ref|XP_146887.2| similar to layilin [Mus musculus]         33   3.7
gi|6009875|dbj|BAA85102.1| PfG3 [Ptychodera flava]                     33   3.7
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ...    33   3.7
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab...    33   3.7
gi|26352257|dbj|BAC39765.1| unnamed protein product [Mus musculus]     33   3.7
gi|18857993|ref|NP_572491.1| CG12111-PA [Drosophila melanogaster...    33   3.7
gi|3790610|gb|AAC68695.1| layilin [Cricetulus griseus]                 33   3.7
gi|18148877|dbj|BAB83468.1| Vp260 like protein [Chlorella virus]       32   4.8
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga...    32   4.8
gi|39546567|gb|AAR28091.1| natural killer complex C-type lectin ...    32   4.8
gi|23321261|gb|AAN23125.1| agglucetin-alpha 2 subunit precursor ...    32   4.8
gi|47230594|emb|CAF99787.1| unnamed protein product [Tetraodon n...    32   4.8
gi|45382191|ref|NP_990760.1| 17.5 [Gallus gallus] >gnl|BL_ORD_ID...    32   4.8
gi|6755821|ref|NP_035736.1| tetranectin (plasminogen binding pro...    32   4.8
gi|23272041|gb|AAH35043.1| Tetranectin (plasminogen binding prot...    32   4.8
gi|48094797|ref|XP_394269.1| similar to CG15828-PB [Apis mellifera]    32   4.8
gi|31212723|ref|XP_315346.1| ENSANGP00000020938 [Anopheles gambi...    32   4.8
gi|48375116|gb|AAT42221.1| mannan-binding C-type lectin [Stichop...    32   4.8
gi|31212725|ref|XP_315347.1| ENSANGP00000020910 [Anopheles gambi...    32   4.8
gi|3023251|sp|P81116|ABBB_TRIAB Alboaggregin B beta subunit            32   4.8
gi|32965103|gb|AAP91739.1| L-selectin precursor-like [Ciona inte...    32   6.3
gi|382753|prf||1901176A surfactant protein A                           32   6.3
gi|49070172|ref|XP_399375.1| hypothetical protein UM01760.1 [Ust...    32   6.3
gi|13774945|gb|AAK39100.1| natural killer cell receptor protein ...    32   6.3
gi|47523602|ref|NP_999433.1| E-selectin [Sus scrofa] >gnl|BL_ORD...    32   6.3
gi|2136497|pir||JC5092 E-selectin - pig >gnl|BL_ORD_ID|1017740 g...    32   6.3
gi|48892879|ref|ZP_00326191.1| COG0642: Signal transduction hist...    32   6.3
gi|1346436|sp|P98110|LEM2_PIG E-selectin precursor (Endothelial ...    32   6.3
gi|47209097|emb|CAF91609.1| unnamed protein product [Tetraodon n...    32   6.3
gi|691755|dbj|BAA06445.1| phospholipase A2 receptor [Rattus sp.]       32   6.3
gi|27721871|ref|XP_236746.1| similar to tetranectin [Rattus norv...    32   6.3
gi|47551233|ref|NP_999801.1| receptor for egg jelly 3 [Strongylo...    32   6.3
gi|45382787|ref|NP_989997.1| tetranectin [Gallus gallus] >gnl|BL...    32   8.3
gi|38637015|dbj|BAD03273.1| hypothetical protein [Oryza sativa (...    32   8.3
gi|50776632|ref|XP_423269.1| PREDICTED: similar to amino acid fe...    32   8.3
gi|17565798|ref|NP_503499.1| agkisacutacin B-chain like (5C237) ...    32   8.3
gi|38089051|ref|XP_284376.2| RIKEN cDNA 2310066I10 [Mus musculus]      32   8.3
gi|28828928|gb|AAO51514.1| similar to Dictyostelium discoideum (...    32   8.3
gi|13876735|gb|AAK43584.1| C-type lectin-like protein 1 [Bungaru...    32   8.3
gi|50765129|ref|XP_422961.1| PREDICTED: similar to amino acid fe...    32   8.3
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (...    32   8.3
gi|34870066|ref|XP_221788.2| similar to SIGNR1 alpha [Rattus nor...    32   8.3
gi|42716324|gb|AAS37670.1| dectin-1 [Mus musculus]                     32   8.3
gi|20381202|gb|AAH27742.1| Clecsf12 protein [Mus musculus]             32   8.3
gi|7804476|dbj|BAA95671.1| C-type lectin [Cyprinus carpio]             32   8.3
gi|9910160|ref|NP_064392.1| C-type lectin, superfamily member 12...    32   8.3
gi|21357267|ref|NP_649312.1| CG6014-PA [Drosophila melanogaster]...    32   8.3
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ...    32   8.3


>gi|25153735|ref|NP_741349.1| c-type lectin precursor family member
           (19.0 kD) (4D609) [Caenorhabditis elegans]
 gi|16950521|gb|AAL32255.1| Hypothetical protein Y54G2A.33
           [Caenorhabditis elegans]
          Length = 172

 Score =  331 bits (848), Expect = 5e-90
 Identities = 155/155 (100%), Positives = 155/155 (100%)
 Frame = +1

Query: 1   MKFLLYVAAIIGLASGACFDNGDKEIQGMCFKLVPQMLTYQDARDWCHYKNPVTSSNLAY 180
           MKFLLYVAAIIGLASGACFDNGDKEIQGMCFKLVPQMLTYQDARDWCHYKNPVTSSNLAY
Sbjct: 1   MKFLLYVAAIIGLASGACFDNGDKEIQGMCFKLVPQMLTYQDARDWCHYKNPVTSSNLAY 60

Query: 181 VPNQFTANFLASYARSAFGSNDGYFWIGLSRTSSNSPFTWDNGQPLGYTNFGTQLGQNYI 360
           VPNQFTANFLASYARSAFGSNDGYFWIGLSRTSSNSPFTWDNGQPLGYTNFGTQLGQNYI
Sbjct: 61  VPNQFTANFLASYARSAFGSNDGYFWIGLSRTSSNSPFTWDNGQPLGYTNFGTQLGQNYI 120

Query: 361 AESIVNTKWNAFGASDKNFFVCSYDPAAPPTFSPL 465
           AESIVNTKWNAFGASDKNFFVCSYDPAAPPTFSPL
Sbjct: 121 AESIVNTKWNAFGASDKNFFVCSYDPAAPPTFSPL 155




[DB home][top]