Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y57A10A_9
(1377 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535685|ref|NP_496589.1| ROLler: helically twisted, animals ... 509 e-143
gi|39591412|emb|CAE73466.1| Hypothetical protein CBG20917 [Caeno... 404 e-111
gi|39591507|emb|CAE73561.1| Hypothetical protein CBG21031 [Caeno... 199 2e-49
gi|17537301|ref|NP_494562.1| COLlagen structural gene (37.0 kD) ... 89 2e-16
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno... 83 1e-14
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 81 7e-14
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 81 7e-14
gi|39580392|emb|CAE70951.1| Hypothetical protein CBG17762 [Caeno... 81 7e-14
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 80 9e-14
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 80 9e-14
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 80 1e-13
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 80 1e-13
gi|1589837|gb|AAC48358.1| cuticle preprocollagen [Meloidogyne in... 80 1e-13
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 80 1e-13
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 80 1e-13
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 80 1e-13
gi|1184072|gb|AAC47437.1| COL-1 80 1e-13
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 80 1e-13
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 79 2e-13
gi|17539418|ref|NP_501561.1| COLlagen structural gene (col-119) ... 77 7e-13
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno... 77 1e-12
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 77 1e-12
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno... 76 2e-12
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 75 3e-12
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e... 75 4e-12
gi|17542184|ref|NP_501700.1| COLlagen structural gene (29.4 kD) ... 74 6e-12
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >... 73 2e-11
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno... 73 2e-11
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl... 73 2e-11
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ... 73 2e-11
gi|39588428|emb|CAE72779.1| Hypothetical protein CBG20034 [Caeno... 72 2e-11
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno... 72 3e-11
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ... 72 3e-11
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-... 72 4e-11
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 69 2e-10
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 68 6e-10
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 68 6e-10
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [... 68 6e-10
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 67 8e-10
gi|39588940|emb|CAE69570.1| Hypothetical protein CBG15782 [Caeno... 66 2e-09
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 66 2e-09
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [... 66 2e-09
gi|17561476|ref|NP_505888.1| COLlagen structural gene (col-155) ... 66 2e-09
gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33) [... 66 2e-09
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 66 2e-09
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 65 3e-09
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 65 3e-09
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 65 4e-09
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 65 4e-09
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 65 4e-09
gi|39582210|emb|CAE64161.1| Hypothetical protein CBG08781 [Caeno... 65 4e-09
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 65 5e-09
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 64 6e-09
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ... 64 6e-09
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno... 64 6e-09
gi|39596499|emb|CAE63118.1| Hypothetical protein CBG07415 [Caeno... 64 8e-09
gi|39596527|emb|CAE63146.1| Hypothetical protein CBG07448 [Caeno... 64 8e-09
gi|17543166|ref|NP_500138.1| COLlagen structural gene (29.0 kD) ... 64 1e-08
gi|39583745|emb|CAE63849.1| Hypothetical protein CBG08408 [Caeno... 64 1e-08
gi|115399|sp|P16252|CAC2_HAECO Cuticle collagen 2C >gnl|BL_ORD_I... 63 2e-08
gi|321007|pir||B44984 collagen - nematode (Haemonchus contortus)... 63 2e-08
gi|687634|gb|AAA62504.1| collagen 63 2e-08
gi|39592242|emb|CAE75463.1| Hypothetical protein CBG23461 [Caeno... 62 2e-08
gi|39596498|emb|CAE63117.1| Hypothetical protein CBG07414 [Caeno... 62 2e-08
gi|32698037|emb|CAE11316.1| Hypothetical protein H06A10.2 [Caeno... 62 2e-08
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 62 3e-08
gi|159171|gb|AAA29174.1| collagen 8E 62 4e-08
gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT... 62 4e-08
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno... 62 4e-08
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ... 61 5e-08
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 61 7e-08
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 60 9e-08
gi|17551424|ref|NP_510247.1| COLlagen structural gene (col-183) ... 60 9e-08
gi|17568109|ref|NP_510274.1| COLlagen structural gene (col-44) [... 60 1e-07
gi|115397|sp|P08124|CC01_CAEEL Cuticle collagen 1 precursor (Squ... 60 1e-07
gi|39593552|emb|CAE61844.1| Hypothetical protein CBG05818 [Caeno... 59 4e-07
gi|17568107|ref|NP_510273.1| COLlagen structural gene (col-9) [C... 58 5e-07
gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114) ... 58 5e-07
gi|7498195|pir||T34203 hypothetical protein D2024.8 - Caenorhabd... 58 5e-07
gi|39588941|emb|CAE69571.1| Hypothetical protein CBG15783 [Caeno... 58 6e-07
gi|17557099|ref|NP_499700.1| COLlagen structural gene (30.3 kD) ... 57 1e-06
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 57 1e-06
gi|39596517|emb|CAE63136.1| Hypothetical protein CBG07436 [Caeno... 57 1e-06
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 56 2e-06
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 56 2e-06
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 56 2e-06
gi|39580360|emb|CAE61465.1| Hypothetical protein CBG05357 [Caeno... 54 7e-06
gi|17539916|ref|NP_500598.1| COLlagen structural gene (col-110) ... 53 2e-05
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 51 6e-05
gi|4809258|gb|AAD30169.1| collagen [Haemonchus contortus] 51 7e-05
gi|39587615|emb|CAE58553.1| Hypothetical protein CBG01712 [Caeno... 51 7e-05
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 50 1e-04
gi|15789646|ref|NP_279470.1| Vng0394c [Halobacterium sp. NRC-1] ... 50 1e-04
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 50 2e-04
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 50 2e-04
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 50 2e-04
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 50 2e-04
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 50 2e-04
gi|17532741|ref|NP_495367.1| DumPY : shorter than wild-type DPY-... 50 2e-04
gi|7332272|gb|AAA17398.2| collagen [Caenorhabditis elegans] 50 2e-04
gi|543967|sp|P35799|CCD2_CAEEL Cuticle collagen dpy-2 precursor 50 2e-04
gi|7494560|pir||T37285 collagen dpy-2 - Caenorhabditis elegans 50 2e-04
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 49 2e-04
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 49 4e-04
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 49 4e-04
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 49 4e-04
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 48 5e-04
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 48 6e-04
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 47 0.001
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 47 0.001
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 46 0.002
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 46 0.002
gi|40215963|gb|AAR82806.1| GM08848p [Drosophila melanogaster] 46 0.002
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 45 0.004
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 45 0.004
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 45 0.004
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno... 45 0.004
gi|23103184|ref|ZP_00089671.1| COG1530: Ribonucleases G and E [A... 45 0.004
gi|39580220|emb|CAE72976.1| Hypothetical protein CBG20316 [Caeno... 45 0.004
gi|15234855|ref|NP_192732.1| avirulence-responsive family protei... 45 0.005
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 45 0.005
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 45 0.005
gi|45825083|gb|AAS77449.1| AT25482p [Drosophila melanogaster] 44 0.007
gi|24645663|ref|NP_731472.1| CG12819-PB [Drosophila melanogaster... 44 0.007
gi|24645665|ref|NP_731473.1| CG12819-PA [Drosophila melanogaster... 44 0.007
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 44 0.007
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 44 0.007
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 44 0.007
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 44 0.009
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 44 0.009
gi|34526573|dbj|BAC85246.1| unnamed protein product [Homo sapiens] 44 0.009
gi|124738|sp|P24711|INVO_TARBA Involucrin >gnl|BL_ORD_ID|1371644... 44 0.009
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati... 44 0.009
gi|25145834|ref|NP_501273.2| COLlagen structural gene (col-14) [... 44 0.012
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 44 0.012
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 44 0.012
gi|7497485|pir||T29810 hypothetical protein C46A5.3 - Caenorhabd... 44 0.012
gi|39595004|emb|CAE70872.1| Hypothetical protein CBG17662 [Caeno... 44 0.012
gi|32403428|ref|XP_322327.1| predicted protein [Neurospora crass... 44 0.012
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 44 0.012
gi|39581447|emb|CAE74729.1| Hypothetical protein CBG22547 [Caeno... 43 0.015
gi|39585885|emb|CAE61299.1| Hypothetical protein CBG05125 [Caeno... 43 0.015
gi|41203898|ref|XP_372522.1| similar to Plasmodium falciparum tr... 43 0.015
gi|32419136|ref|XP_330046.1| hypothetical protein [Neurospora cr... 43 0.020
gi|38566922|emb|CAE76225.1| related to putative cytoplasmic stru... 43 0.020
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 42 0.026
gi|47229698|emb|CAG06894.1| unnamed protein product [Tetraodon n... 42 0.026
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 42 0.026
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 42 0.026
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 42 0.026
gi|627056|pir||A54641 interspersed repeat antigen precursor - ma... 42 0.045
gi|15144509|gb|AAK84476.1| unknown [Lycopersicon esculentum] 41 0.058
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 41 0.058
gi|17548032|ref|NP_521434.1| PUTATIVE PROLIN-RICH TRANSMEMBRANE ... 41 0.058
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 41 0.076
gi|17532621|ref|NP_494879.1| COLlagen structural gene (col-20) [... 41 0.076
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 41 0.076
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 40 0.100
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 40 0.13
gi|26346793|dbj|BAC37045.1| unnamed protein product [Mus musculus] 40 0.17
gi|34881305|ref|XP_228502.2| similar to hypothetical protein FLJ... 40 0.17
gi|19353460|gb|AAH24403.1| 6330577E15Rik protein [Mus musculus] 40 0.17
gi|12854679|dbj|BAB30105.1| unnamed protein product [Mus musculu... 39 0.22
gi|46441609|gb|EAL00905.1| hypothetical protein CaO19.14090 [Can... 39 0.22
gi|12847716|dbj|BAB27680.1| unnamed protein product [Mus musculus] 39 0.22
gi|33468989|ref|NP_080653.1| RIKEN cDNA 6330577E15 [Mus musculus... 39 0.22
gi|39590295|emb|CAE66033.1| Hypothetical protein CBG11229 [Caeno... 39 0.22
gi|11345238|gb|AAG34657.1| involucrin [Mus musculus] 39 0.29
gi|11345240|gb|AAG34658.1| involucrin [Mus musculus] 39 0.29
gi|48675827|ref|NP_778228.2| hypothetical protein LOC144100 [Hom... 39 0.29
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 39 0.29
gi|39595771|emb|CAE67274.1| Hypothetical protein CBG12722 [Caeno... 39 0.29
gi|27693901|gb|AAH33239.1| LOC144100 protein [Homo sapiens] 39 0.29
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 39 0.29
gi|5453820|ref|NP_006176.1| nuclear mitotic apparatus protein 1 ... 39 0.38
gi|4504487|ref|NP_002143.1| histidine-rich calcium-binding prote... 39 0.38
gi|41054992|ref|NP_955762.1| hypothetical protein D430021I08 [Mu... 39 0.38
gi|6691467|dbj|BAA89307.1| AHM1 [Triticum aestivum] 39 0.38
gi|31208933|ref|XP_313433.1| ENSANGP00000019634 [Anopheles gambi... 39 0.38
gi|50400858|sp|Q14980|NUMA_HUMAN Nuclear mitotic apparatus prote... 39 0.38
gi|743447|prf||2012303A SP-H antigen 39 0.38
gi|47229450|emb|CAF99438.1| unnamed protein product [Tetraodon n... 35 0.48
gi|49086382|ref|XP_405243.1| hypothetical protein AN1106.2 [Aspe... 38 0.50
gi|11345242|gb|AAG34659.1| involucrin [Mus musculus] 38 0.50
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 38 0.50
gi|47223062|emb|CAG07149.1| unnamed protein product [Tetraodon n... 38 0.50
gi|18767668|gb|AAL54912.2| putative transcriptional repressor [C... 38 0.50
gi|23468050|ref|ZP_00123621.1| COG5295: Autotransporter adhesin ... 38 0.65
gi|47216852|emb|CAG11659.1| unnamed protein product [Tetraodon n... 38 0.65
gi|39588000|emb|CAE57231.1| Hypothetical protein CBG00101 [Caeno... 38 0.65
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 37 0.84
gi|50400728|sp|Q61043|NIN_MOUSE Ninein 37 0.84
gi|543968|sp|P35800|CCDA_CAEEL Cuticle collagen dpy-10 precursor... 37 0.84
gi|37360452|dbj|BAC98204.1| mKIAA1565 protein [Mus musculus] 37 0.84
gi|45198327|ref|NP_985356.1| AFL194Wp [Eremothecium gossypii] >g... 37 0.84
gi|1513204|gb|AAC48703.1| involucrin 37 0.84
gi|33438168|dbj|BAC41447.2| mKIAA0774 protein [Mus musculus] 37 1.1
gi|8980843|gb|AAF82299.1| GRIP-associated protein 1 short form [... 37 1.1
gi|39597300|emb|CAE59528.1| Hypothetical protein CBG02923 [Caeno... 37 1.1
gi|7494559|pir||T28887 collagen dpy-10 - Caenorhabditis elegans 37 1.1
gi|49091988|ref|XP_407455.1| hypothetical protein AN3318.2 [Aspe... 37 1.1
gi|47221289|emb|CAG13225.1| unnamed protein product [Tetraodon n... 37 1.1
gi|32267162|ref|NP_861194.1| conserved hypothetical protein [Hel... 37 1.1
gi|32565701|ref|NP_495366.2| collagen triple helix repeat family... 37 1.1
gi|47223756|emb|CAF98526.1| unnamed protein product [Tetraodon n... 37 1.1
gi|16758652|ref|NP_446259.1| GRIP-associated protein 1 [Rattus n... 37 1.1
gi|6679062|ref|NP_032723.1| ninein [Mus musculus] >gnl|BL_ORD_ID... 37 1.1
gi|21264565|ref|NP_006006.3| AT rich interactive domain 1A (SWI-... 37 1.4
gi|14150463|gb|AAK54505.1| OSA1 nuclear protein [Homo sapiens] 37 1.4
gi|10092180|gb|AAG12599.1| hypothetical protein, 3' partial; 203... 37 1.4
gi|11320942|gb|AAG33967.1| BRG1-Associated Factor 250a [Homo sap... 37 1.4
gi|7512296|pir||T00022 B120 protein - human >gnl|BL_ORD_ID|13775... 37 1.4
gi|8489817|gb|AAF75765.1| SWI-SNF complex protein p270 [Homo sap... 37 1.4
gi|14591502|ref|NP_143582.1| hypothetical protein PH1744 [Pyroco... 37 1.4
gi|47218036|emb|CAG11441.1| unnamed protein product [Tetraodon n... 37 1.4
gi|23489064|gb|EAA21475.1| hypothetical protein [Plasmodium yoel... 37 1.4
gi|13195757|gb|AAG17549.2| chromatin remodelling factor p250 [Ho... 37 1.4
gi|6063557|dbj|BAA85417.1| similar to dJ522J7.2 (Z98885) [Oryza ... 37 1.4
gi|45384402|ref|NP_990272.1| chromo-helicase-DNA-binding on the ... 37 1.4
gi|39595279|emb|CAE60316.1| Hypothetical protein CBG03907 [Caeno... 37 1.4
gi|21264569|ref|NP_060920.4| AT rich interactive domain 1A (SWI-... 37 1.4
gi|47215854|emb|CAG02317.1| unnamed protein product [Tetraodon n... 37 1.4
gi|5689365|dbj|BAA83073.1| B120 [Homo sapiens] 37 1.4
gi|28828697|gb|AAO51294.1| similar to Dictyostelium discoideum (... 37 1.4
gi|38110844|gb|EAA56506.1| hypothetical protein MG06477.4 [Magna... 37 1.4
gi|12643538|sp|O14497|SMF1_HUMAN SWI/SNF-related, matrix-associa... 37 1.4
gi|15808996|ref|NP_291044.1| AT rich interactive domain 1A (Swi1... 37 1.4
gi|39590294|emb|CAE66032.1| Hypothetical protein CBG11227 [Caeno... 37 1.4
gi|21264575|ref|NP_624361.1| AT rich interactive domain 1A (SWI-... 37 1.4
gi|14133259|dbj|BAB55599.1| SWI related protein [Homo sapiens] 37 1.4
gi|34871766|ref|XP_216340.2| similar to Osa1 nuclear protein [Ra... 37 1.4
gi|15232902|ref|NP_186889.1| forkhead-associated domain-containi... 37 1.4
gi|15227458|ref|NP_181107.1| hydroxyproline-rich glycoprotein fa... 37 1.4
gi|46125725|ref|XP_387416.1| hypothetical protein FG07240.1 [Gib... 37 1.4
gi|29612592|gb|AAH49647.1| Similar to RIKEN cDNA A030010B05 gene... 37 1.4
gi|27370088|ref|NP_766331.1| RIKEN cDNA A430081P20 [Mus musculus... 37 1.4
gi|22597104|gb|AAN03446.1| SWI/SNF chromatin remodeling complex ... 37 1.4
gi|14017929|dbj|BAB47485.1| KIAA1856 protein [Homo sapiens] 36 1.9
gi|7209719|dbj|BAA92310.1| This gene is isolated by means of dif... 36 1.9
gi|6680506|ref|NP_032438.1| involucrin [Mus musculus] >gnl|BL_OR... 36 1.9
gi|21732274|emb|CAD38530.1| hypothetical protein [Homo sapiens] 36 1.9
gi|42657819|ref|XP_376567.1| KIAA1856 protein [Homo sapiens] >gn... 36 1.9
gi|115410|sp|P12114|CCS1_CAEEL Cuticle collagen sqt-1 >gnl|BL_OR... 36 1.9
gi|17535735|ref|NP_496421.1| SQuaT SQT-1, ROLler: helically twis... 36 1.9
gi|38086436|ref|XP_125419.2| similar to Non-POU-domain-containin... 36 1.9
gi|47230549|emb|CAF99742.1| unnamed protein product [Tetraodon n... 36 1.9
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 36 1.9
gi|34851919|ref|XP_226464.2| similar to AT motif-binding factor ... 36 1.9
gi|17507553|ref|NP_490679.1| COLlagen structural gene (col-45) [... 36 1.9
gi|34860607|ref|XP_342347.1| nuclear factor kappa B p105 subunit... 36 1.9
gi|45187542|ref|NP_983765.1| ADL331Cp [Eremothecium gossypii] >g... 36 1.9
gi|21751834|dbj|BAC04046.1| unnamed protein product [Homo sapiens] 36 1.9
gi|1149501|emb|CAA62475.1| pipsqueak [Drosophila melanogaster] 36 1.9
gi|38073487|ref|XP_355243.1| similar to This gene is isolated by... 36 1.9
gi|46202237|ref|ZP_00053526.2| COG1357: Uncharacterized low-comp... 36 1.9
gi|46127785|ref|XP_388446.1| hypothetical protein FG08270.1 [Gib... 36 1.9
gi|17560304|ref|NP_506124.1| suppressor of white apricot homolog... 36 1.9
gi|9910376|ref|NP_064623.1| inner centromere protein antigens 13... 36 1.9
gi|40255135|ref|NP_689971.2| YTH domain family 3 [Homo sapiens] ... 36 1.9
gi|2133667|pir||S66149 gene pipsqueak protein A long form - frui... 36 1.9
gi|18978162|ref|NP_579519.1| transcriptional regulatory protein ... 36 1.9
gi|16551561|dbj|BAB71122.1| unnamed protein product [Homo sapiens] 36 1.9
gi|22832760|gb|AAH13626.1| Col3a1 protein [Mus musculus] 36 1.9
gi|21493022|ref|NP_005091.2| A-kinase anchor protein 12 isoform ... 36 2.5
gi|50510823|dbj|BAD32397.1| mKIAA1167 protein [Mus musculus] 36 2.5
gi|14520523|ref|NP_125998.1| hypothetical protein PAB0208 [Pyroc... 36 2.5
gi|21493024|ref|NP_653080.1| A-kinase anchor protein 12 isoform ... 36 2.5
gi|46592839|ref|NP_997553.1| GRIP-associated protein 1 [Mus musc... 36 2.5
gi|7512469|pir||JW0057 gravin - human >gnl|BL_ORD_ID|321887 gi|2... 36 2.5
gi|44889483|ref|NP_004056.2| cerebellar degeneration-related pro... 36 2.5
gi|18025476|gb|AAK95420.1| BPLF1 [cercopithicine herpesvirus 15] 36 2.5
gi|46123749|ref|XP_386428.1| hypothetical protein FG06252.1 [Gib... 36 2.5
gi|28838590|gb|AAH47728.1| AKAP12 protein [Homo sapiens] 36 2.5
gi|45185971|ref|NP_983687.1| ACR285Cp [Eremothecium gossypii] >g... 36 2.5
gi|27679456|ref|XP_223013.1| similar to hypothetical protein FLJ... 36 2.5
gi|50548795|ref|XP_501867.1| hypothetical protein [Yarrowia lipo... 36 2.5
gi|12836501|dbj|BAB23683.1| unnamed protein product [Mus musculus] 36 2.5
gi|38565531|gb|AAR24088.1| atherin [Oryctolagus cuniculus] 33 2.9
gi|133504|sp|P27864|RRP1_DROME Recombination repair protein 1 (D... 35 3.2
gi|17136678|ref|NP_476841.1| CG3178-PA [Drosophila melanogaster]... 35 3.2
gi|41149177|ref|XP_372320.1| similar to bA182L21.1 (novel protei... 35 3.2
gi|50426151|ref|XP_461672.1| unnamed protein product [Debaryomyc... 35 3.2
gi|32043647|ref|ZP_00140909.1| COG0542: ATPases with chaperone a... 35 3.2
gi|15595656|ref|NP_249150.1| probable ClpA/B protease ATP bindin... 35 3.2
gi|23484951|gb|EAA20114.1| KED, putative [Plasmodium yoelii yoelii] 35 3.2
gi|30962830|gb|AAH52631.1| Ythdf3 protein [Mus musculus] 35 3.2
gi|49096160|ref|XP_409540.1| hypothetical protein AN5403.2 [Aspe... 35 3.2
gi|46048312|ref|NP_766265.2| YTH domain family 3 [Mus musculus] ... 35 3.2
gi|40018515|ref|NP_954552.1| BERF4 frame, homology with BERF1 an... 35 3.2
gi|41149179|ref|XP_372321.1| similar to bA182L21.1 (novel protei... 35 3.2
gi|27695637|gb|AAH42999.1| ASXL2 protein [Homo sapiens] 35 3.2
gi|15828978|ref|NP_326338.1| conserved hypothetical protein [Myc... 35 3.2
gi|26343683|dbj|BAC35498.1| unnamed protein product [Mus musculu... 35 3.2
gi|586121|sp|P37709|TRHY_RABIT Trichohyalin >gnl|BL_ORD_ID|29628... 35 3.2
gi|26333099|dbj|BAC30267.1| unnamed protein product [Mus musculus] 35 3.2
gi|39594827|emb|CAE70695.1| Hypothetical protein CBG17418 [Caeno... 35 3.2
gi|45187592|ref|NP_983815.1| ADL281Cp [Eremothecium gossypii] >g... 35 3.2
gi|34855501|ref|XP_342218.1| similar to hypothetical protein FLJ... 35 3.2
gi|34865346|ref|XP_216723.2| similar to ninein [Rattus norvegicus] 35 3.2
gi|330359|gb|AAA45879.1| nuclear antigen precursor 35 3.2
gi|44890479|gb|AAH67040.1| Ythdf3 protein [Mus musculus] 35 3.2
gi|9625618|ref|NP_039869.1| EBNA3C (EBNA 4B) latent protein [Hum... 35 3.2
gi|93172|pir||A31666 hypothetical protein - human herpesvirus 4 35 3.2
gi|15722064|emb|CAC78758.1| bA182L21.1 (novel protein similar to... 35 3.2
gi|23273663|gb|AAH36350.1| Sart3 protein [Mus musculus] 35 3.2
gi|23821033|ref|NP_084376.1| PYM protein [Mus musculus] >gnl|BL_... 35 4.2
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna... 35 4.2
gi|13811671|gb|AAK40236.1| glutamate-rich protein [Plasmodium re... 35 4.2
gi|38146001|ref|NP_060733.2| additional sex combs like 2; polyco... 35 4.2
gi|47219137|emb|CAG01800.1| unnamed protein product [Tetraodon n... 35 4.2
gi|39585497|emb|CAE70580.1| Hypothetical protein CBG17237 [Caeno... 35 4.2
gi|6330248|dbj|BAA86497.1| KIAA1183 protein [Homo sapiens] 35 4.2
gi|24646442|ref|NP_650250.2| CG7518-PB [Drosophila melanogaster]... 35 4.2
gi|12697915|dbj|BAB21776.1| KIAA1685 protein [Homo sapiens] 35 4.2
gi|50257382|gb|EAL20091.1| hypothetical protein CNBF4170 [Crypto... 35 4.2
gi|38092041|ref|XP_137868.3| similar to proline-rich peptides 63... 35 4.2
gi|37998957|dbj|BAD00088.1| chimeric MOZ-ASXH2 fusion protein [H... 35 4.2
gi|50547527|ref|XP_501233.1| hypothetical protein [Yarrowia lipo... 35 4.2
gi|24646440|ref|NP_731761.1| CG7518-PA [Drosophila melanogaster]... 35 4.2
gi|33285221|gb|AAK39144.2| Groundhog (hedgehog-like family) prot... 35 4.2
gi|24662032|ref|NP_729571.1| CG6711-PA [Drosophila melanogaster]... 35 4.2
gi|46316674|ref|ZP_00217253.1| COG0810: Periplasmic protein TonB... 35 4.2
gi|32410929|ref|XP_325945.1| hypothetical protein [Neurospora cr... 35 4.2
gi|37522025|ref|NP_925402.1| unknown protein [Gloeobacter violac... 35 4.2
gi|117576|sp|P06915|CSP_PLABE Circumsporozoite protein precursor... 35 4.2
gi|17561848|ref|NP_504535.1| GRounDhog, hedgehog-like (grd-9) [C... 35 4.2
gi|38105280|gb|EAA51724.1| hypothetical protein MG03319.4 [Magna... 35 4.2
gi|160200|gb|AAA29541.1| circumsporozoite protein 35 4.2
gi|1070657|pir||OZZQMB circumsporozoite protein precursor - Plas... 35 4.2
gi|160178|gb|AAA29531.1| circumsporozoite protein 35 4.2
gi|21483578|gb|AAM52764.1| SD05989p [Drosophila melanogaster] 35 4.2
gi|23503317|ref|NP_699207.1| hypothetical protein FLJ90575 [Homo... 35 4.2
gi|49073192|ref|XP_400828.1| hypothetical protein UM03213.1 [Ust... 35 5.5
gi|32141042|gb|AAP70486.1| histidine-rich calcium binding protei... 35 5.5
gi|3064146|gb|AAC14219.1| mucin-like protein [Trypanosoma cruzi] 35 5.5
gi|46390695|dbj|BAD16196.1| myosin heavy chain homolog-like prot... 35 5.5
gi|26389809|dbj|BAC25794.1| unnamed protein product [Mus musculus] 35 5.5
gi|30984499|ref|NP_851931.1| RNA-binding tegument protein [Cerco... 35 5.5
gi|26335613|dbj|BAC31507.1| unnamed protein product [Mus musculus] 35 5.5
gi|17551704|ref|NP_508747.1| COLlagen structural gene (33.9 kD) ... 35 5.5
gi|42733661|gb|AAO50832.2| similar to Dictyostelium discoideum (... 35 5.5
gi|18157365|dbj|BAB83759.1| RNA binding protein [Cercopithecine ... 35 5.5
gi|100774|pir||S07924 alpha/beta-gliadin precursor - wheat >gnl|... 35 5.5
gi|121096|sp|P04727|GDA7_WHEAT ALPHA/BETA-GLIADIN CLONE PW8142 P... 35 5.5
gi|6708502|gb|AAD09454.2| superfast myosin heavy chain [Felis ca... 35 5.5
gi|627172|pir||A54063 TATA-binding protein-associated factor II ... 35 5.5
gi|50545443|ref|XP_500259.1| hypothetical protein [Yarrowia lipo... 35 5.5
gi|33468903|ref|NP_034600.1| heterochromatin protein 1, binding ... 35 5.5
gi|33620941|gb|AAM29663.2| Hypothetical protein C18C4.5b [Caenor... 34 7.1
gi|7496266|pir||T34107 hypothetical protein C18C4.5 - Caenorhabd... 34 7.1
gi|25149347|ref|NP_741538.1| myosin heavy chain (5G32) [Caenorha... 34 7.1
gi|50511147|dbj|BAD32559.1| mKIAA1862 protein [Mus musculus] 34 7.1
gi|41406552|ref|NP_959388.1| hypothetical protein MAP0454 [Mycob... 34 7.1
gi|26345920|dbj|BAC36611.1| unnamed protein product [Mus musculus] 34 7.1
gi|22035604|ref|NP_663719.1| mitogen-activated protein kinase ki... 34 7.1
gi|47226842|emb|CAG06684.1| unnamed protein product [Tetraodon n... 34 7.1
gi|33303438|gb|AAQ02295.1| dentin matrix protein 1 [Peromyscus a... 34 7.1
gi|1513206|gb|AAC48704.1| involucrin 34 7.1
gi|2160784|gb|AAB58938.1| myasthenia gravis autoantigen gravin [... 34 7.1
gi|17551374|ref|NP_510617.1| COLlagen structural gene (col-186) ... 34 7.1
gi|12851999|dbj|BAB29232.1| unnamed protein product [Mus musculus] 34 7.1
gi|39585517|emb|CAE65277.1| Hypothetical protein CBG10175 [Caeno... 34 7.1
gi|27526238|emb|CAC82378.1| Lasp protein [Drosophila melanogaster] 34 7.1
gi|31207233|ref|XP_312583.1| ENSANGP00000014957 [Anopheles gambi... 34 7.1
gi|12854146|dbj|BAB29941.1| unnamed protein product [Mus musculus] 34 7.1
gi|7494034|pir||T18314 hypothetical protein L7610.4 - Leishmania... 34 7.1
gi|17569991|ref|NP_510853.1| bile lipase like (XS293) [Caenorhab... 34 7.1
gi|6323362|ref|NP_013434.1| Involved in chitin synthase III acti... 34 7.1
gi|25152945|ref|NP_741957.1| carboxyl ester lipase like (XS293) ... 34 7.1
gi|46048307|ref|NP_598683.2| RIKEN cDNA A930040G15 [Mus musculus... 34 7.1
gi|49899749|gb|AAH76786.1| Unknown (protein for MGC:83700) [Xeno... 34 7.1
gi|11359883|pir||T46481 hypothetical protein DKFZp434A025.1 - hu... 34 7.1
gi|17569987|ref|NP_510852.1| bile lipase like (XS293) [Caenorhab... 34 7.1
gi|34862448|ref|XP_345770.1| similar to PYM protein [Rattus norv... 34 7.1
gi|17569989|ref|NP_510854.1| carboxyl ester lipase like (XS293) ... 34 7.1
gi|34859473|ref|XP_218972.2| nuclear mitotic apparatus protein 1... 34 7.1
gi|7670352|dbj|BAA95028.1| unnamed protein product [Mus musculus] 34 7.1
gi|322618|pir||S28147 U1 snRNP 70K protein - Arabidopsis thalian... 34 7.1
gi|25149352|ref|NP_741539.1| myosin heavy chain (5G32) [Caenorha... 34 7.1
gi|47221237|emb|CAG13173.1| unnamed protein product [Tetraodon n... 34 7.1
gi|34902512|ref|NP_912602.1| GABA-A receptor epsilon-like subuni... 34 9.3
gi|6005856|ref|NP_009183.1| POU domain, class 6, transcription f... 34 9.3
gi|46105324|ref|XP_380466.1| hypothetical protein FG00290.1 [Gib... 34 9.3
gi|23483514|gb|EAA19159.1| hypothetical protein [Plasmodium yoel... 34 9.3
gi|310893|gb|AAA18800.1| membrane protein 34 9.3
gi|33303428|gb|AAQ02290.1| dentin matrix protein 1 [Neotomodon a... 34 9.3
gi|50842774|ref|YP_056001.1| hypothetical protein, putative ribo... 34 9.3
gi|28201884|sp|P78424|PO62_HUMAN POU domain, class 6, transcript... 34 9.3
gi|50551733|ref|XP_503341.1| hypothetical protein [Yarrowia lipo... 34 9.3
gi|46111839|ref|XP_382977.1| hypothetical protein FG02801.1 [Gib... 34 9.3
gi|45201034|ref|NP_986604.1| AGL062Cp [Eremothecium gossypii] >g... 34 9.3
gi|17986031|ref|NP_523441.1| CG3696-PA [Drosophila melanogaster]... 34 9.3
gi|23482074|gb|EAA18164.1| hypothetical protein [Plasmodium yoel... 34 9.3
gi|21450183|ref|NP_659062.1| solute carrier family 24 (sodium/po... 34 9.3
gi|50305909|ref|XP_452915.1| unnamed protein product [Kluyveromy... 34 9.3
gi|45201381|ref|NP_986951.1| AGR285Wp [Eremothecium gossypii] >g... 34 9.3
gi|32492176|emb|CAE04163.1| OSJNBb0034I13.6 [Oryza sativa (japon... 34 9.3
gi|23506121|gb|AAN28957.1| Wal1 protein [Eremothecium gossypii] 34 9.3
gi|50546559|ref|XP_500749.1| hypothetical protein [Yarrowia lipo... 34 9.3
gi|15213856|gb|AAK92202.1| adiponectin [Macaca mulatta] 34 9.3
gi|25143523|ref|NP_740785.1| putative nuclear protein, with a co... 34 9.3
gi|32418162|ref|XP_329559.1| hypothetical protein [Neurospora cr... 34 9.3
gi|40253888|dbj|BAD05822.1| repressor protein [Oryza sativa (jap... 34 9.3
gi|34532305|dbj|BAC86381.1| unnamed protein product [Homo sapiens] 34 9.3
gi|42659351|ref|XP_166630.7| similar to KIAA2020 protein [Homo s... 34 9.3
gi|24899204|dbj|BAC23116.1| KIAA2020 protein [Homo sapiens] 34 9.3
gi|18481620|gb|AAL73485.1| repressor protein [Oryza sativa] 34 9.3
gi|50256527|gb|EAL19252.1| hypothetical protein CNBH3510 [Crypto... 34 9.3
gi|7493836|gb|AAF07822.2| multidomain presynaptic cytomatrix pro... 34 9.3
gi|28829619|gb|AAO52136.1| similar to Dictyostelium. Serine/thre... 34 9.3
gi|34856336|ref|XP_218734.2| similar to necdin-like protein 1 [R... 34 9.3
gi|10048483|ref|NP_064483.1| multidomain presynaptic cytomatrix ... 34 9.3
gi|42659531|ref|XP_374817.1| similar to bA182L21.1 (novel protei... 34 9.3
gi|29738493|ref|XP_290463.1| similar to bA182L21.1 (novel protei... 34 9.3
gi|33859528|ref|NP_034061.1| procollagen, type IV, alpha 1 [Mus ... 27 9.4
gi|34879634|ref|XP_214400.2| similar to collagen alpha 1(IV) cha... 27 9.4
gi|49117309|gb|AAH72650.1| Col4a1 protein [Mus musculus] 27 9.4
>gi|17535685|ref|NP_496589.1| ROLler: helically twisted, animals roll
when moving ROL-1, collagen like (46.6 kD) (rol-1)
[Caenorhabditis elegans]
gi|7510235|pir||T31631 hypothetical protein Y57A10A.i -
Caenorhabditis elegans
gi|5832926|emb|CAB55014.1| Hypothetical protein Y57A10A.11
[Caenorhabditis elegans]
Length = 458
Score = 509 bits (1312), Expect = e-143
Identities = 270/458 (58%), Positives = 270/458 (58%)
Frame = +1
Query: 1 MEVDSNTKAYRIIGYVTVTVSTLAIIALCVTLPIVHGYIKEVQHSMKIEMNQCQNNAKTL 180
MEVDSNTKAYRIIGYVTVTVSTLAIIALCVTLPIVHGYIKEVQHSMKIEMNQCQNNAKTL
Sbjct: 1 MEVDSNTKAYRIIGYVTVTVSTLAIIALCVTLPIVHGYIKEVQHSMKIEMNQCQNNAKTL 60
Query: 181 WTDVYMLRASFTRGFNRTARQAGYEYSNDETTPFAPPKFGYPVVGEAKEEANPYDXXXXX 360
WTDVYMLRASFTRGFNRTARQAGYEYSNDETTPFAPPKFGYPVVGEAKEEANPYD
Sbjct: 61 WTDVYMLRASFTRGFNRTARQAGYEYSNDETTPFAPPKFGYPVVGEAKEEANPYDAPAPP 120
Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSVPSYPDASE 540
GSVPSYPDASE
Sbjct: 121 PPKTEAPTTTTKKTTTTTTTTTTTTSTTTTEAPTTTKTTTTRRPSTTTTGSVPSYPDASE 180
Query: 541 AETTHGYXXXXXXXXXXXXXXXPASEPSQPTSTLEYLKSTVPPEEPHGTSGPSGTTAAPT 720
AETTHGY PASEPSQPTSTLEYLKSTVPPEEPHGTSGPSGTTAAPT
Sbjct: 181 AETTHGYDDVAVVTDAPTVSDAPASEPSQPTSTLEYLKSTVPPEEPHGTSGPSGTTAAPT 240
Query: 721 AEVTHEDHEESTATCDNCCLXXXXXXXXXXXXXXXXXXXXXXXXXXNSGKPTKRPCNPVT 900
AEVTHEDHEESTATCDNCCL NSGKPTKRPCNPVT
Sbjct: 241 AEVTHEDHEESTATCDNCCLPGPAGPPGAPGRPGPPGKAGANGLPGNSGKPTKRPCNPVT 300
Query: 901 KPPCVPCXXXXXXXXXXXXXXXXXXXXXVFGEKGPQGPVGAXXXXXXXXXXXXXXXXXXX 1080
KPPCVPC VFGEKGPQGPVGA
Sbjct: 301 KPPCVPCPQGPLGPAGPAGPQGNLGGPGVFGEKGPQGPVGAPGQKGRRGEKGKDGEPGAP 360
Query: 1081 XXXXXNVKEVPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1260
NVKEVPA
Sbjct: 361 GAPGENVKEVPAIPGPQGTPGPRGRQGPRGAPGIPGKDGLGGDQGAPGEPGADGEPGMDG 420
Query: 1261 VPGNPGRDGTHGHGGEKGVCPKYCSADGGVFYEDGTRR 1374
VPGNPGRDGTHGHGGEKGVCPKYCSADGGVFYEDGTRR
Sbjct: 421 VPGNPGRDGTHGHGGEKGVCPKYCSADGGVFYEDGTRR 458