Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y57G11C_18
(396 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17543764|ref|NP_502790.1| nadh dehydrogenase 1 alpha subcompl... 269 8e-72
gi|39583448|emb|CAE73906.1| Hypothetical protein CBG21512 [Caeno... 249 9e-66
gi|31194307|ref|XP_306101.1| ENSANGP00000015544 [Anopheles gambi... 67 6e-11
gi|33521688|gb|AAQ21387.1| NADH-ubiquinone oxidoreductase [Ixode... 66 1e-10
gi|31210517|ref|XP_314225.1| ENSANGP00000014522 [Anopheles gambi... 66 2e-10
gi|19922002|ref|NP_610629.1| CG7712-PA [Drosophila melanogaster]... 66 2e-10
gi|50729240|ref|XP_425471.1| PREDICTED: similar to NADH dehydrog... 63 1e-09
gi|47217026|emb|CAG01654.1| unnamed protein product [Tetraodon n... 63 2e-09
gi|27663138|ref|XP_235518.1| similar to NADH dehydrogenase (ubiq... 59 2e-08
gi|47678589|emb|CAG30415.1| NDUFA6 [Homo sapiens] 59 3e-08
gi|4505359|ref|NP_002481.1| NADH dehydrogenase (ubiquinone) 1 al... 59 3e-08
gi|28461207|ref|NP_786985.1| NADH dehydrogenase (ubiquinone) 1 a... 57 8e-08
gi|41055750|ref|NP_957262.1| similar to NADH dehydrogenase (ubiq... 57 8e-08
gi|48145545|emb|CAG32995.1| NDUFA6 [Homo sapiens] 57 8e-08
gi|34979815|gb|AAQ83896.1| NADH-ubiquinone oxidoreductase subuni... 56 2e-07
gi|13385492|ref|NP_080263.1| NADH dehydrogenase (ubiquinone) 1 a... 56 2e-07
gi|49098717|ref|XP_410694.1| hypothetical protein AN6557.2 [Aspe... 50 1e-05
gi|46125117|ref|XP_387112.1| conserved hypothetical protein [Gib... 47 1e-04
gi|50260540|gb|EAL23195.1| hypothetical protein CNBA5390 [Crypto... 46 2e-04
gi|31231947|ref|XP_318620.1| ENSANGP00000020885 [Anopheles gambi... 39 0.024
gi|31204765|ref|XP_311331.1| ENSANGP00000001657 [Anopheles gambi... 39 0.031
gi|28828651|gb|AAO51254.1| similar to Plasmodium falciparum. Hyp... 38 0.040
gi|28830022|gb|AAO52512.1| similar to Streptococcus pneumoniae. ... 37 0.069
gi|20128875|ref|NP_569927.1| CG14796-PA [Drosophila melanogaster... 35 0.45
gi|18399551|ref|NP_566416.1| complex 1 family protein / LVR fami... 34 0.76
gi|29248306|gb|EAA39843.1| GLP_399_42515_38688 [Giardia lamblia ... 33 0.99
gi|31324675|gb|AAP48591.1| mineralocorticoid receptor +4 isoform... 33 1.3
gi|31324673|gb|AAP48590.1| mineralocorticoid receptor [Callithri... 33 1.3
gi|6978465|ref|NP_036908.1| adrenergic receptor kinase, beta 1; ... 33 1.3
gi|15485640|emb|CAC67405.1| mineralocorticoid receptor delta [Ho... 33 1.3
gi|4505199|ref|NP_000892.1| nuclear receptor subfamily 3, group ... 33 1.3
gi|46137839|ref|XP_390611.1| hypothetical protein FG10435.1 [Gib... 33 1.3
gi|7513164|pir||PC4395 mucin 3 - human (fragment) >gnl|BL_ORD_ID... 33 1.7
gi|24376371|ref|NP_720479.1| iron-containing alcohol dehydrogena... 32 2.2
gi|20563137|gb|AAM27890.1| mineralocorticoid receptor [Astatotil... 32 2.2
gi|31221694|ref|XP_317076.1| ENSANGP00000019597 [Anopheles gambi... 32 2.2
gi|46432975|gb|EAK92434.1| hypothetical protein CaO19.8914 [Cand... 32 2.2
gi|27818324|gb|AAO24895.1| envelope glycoprotein gpUL73 [human h... 32 2.2
gi|6324467|ref|NP_014536.1| cell wall integrity and stress respo... 32 2.2
gi|21309880|gb|AAM46081.1| polyprotein [Ljungan virus strain 145SL] 32 2.9
gi|28828092|gb|AAO50775.1| similar to Dictyostelium discoideum (... 32 2.9
gi|46445626|gb|EAL04894.1| hypothetical protein CaO19.4906 [Cand... 32 2.9
gi|41147656|ref|XP_168583.4| similar to intestinal membrane muci... 32 2.9
gi|50555151|ref|XP_504984.1| YlTSR1 [Yarrowia lipolytica] >gnl|B... 32 2.9
gi|33859769|ref|NP_570933.1| adrenergic receptor kinase, beta 1;... 32 2.9
gi|18656445|gb|AAL77770.1| structural glycoprotein UL73 [human h... 32 2.9
gi|18656439|gb|AAL77767.1| structural glycoprotein UL73 [human h... 32 2.9
gi|260172|gb|AAB24228.1| beta-adrenergic receptor kinase; beta-A... 32 2.9
gi|27818294|gb|AAO24880.1| envelope glycoprotein gpUL73 [human h... 32 2.9
gi|19526645|gb|AAL89737.1| intestinal membrane mucin MUC17 [Homo... 32 2.9
gi|13398448|gb|AAK21896.1| G protein receptor kinase 2 [Mus musc... 32 2.9
gi|47605537|sp|Q99MK8|ARK1_MOUSE Beta-adrenergic receptor kinase... 32 2.9
gi|13096806|gb|AAH03196.1| Adrbk1 protein [Mus musculus] 32 2.9
gi|47225221|emb|CAF98848.1| unnamed protein product [Tetraodon n... 32 2.9
gi|27923323|gb|AAO27565.1| envelope glycoprotein gpUL73 [human h... 32 2.9
gi|50287941|ref|XP_446399.1| unnamed protein product [Candida gl... 32 2.9
gi|50288227|ref|XP_446542.1| unnamed protein product [Candida gl... 32 3.8
gi|38078628|ref|XP_355507.1| similar to TTC4 protein [Mus musculus] 32 3.8
gi|3121776|sp|Q64682|ARK1_MESAU Beta-adrenergic receptor kinase ... 32 3.8
gi|48120804|ref|XP_393229.1| similar to CG18251-PB [Apis mellifera] 32 3.8
gi|16903269|gb|AAL30450.1| phosphatidylinositol phosphate kinase... 32 3.8
gi|28829686|gb|AAO52202.1| similar to Dictyostelium discoideum (... 32 3.8
gi|48850583|ref|ZP_00304825.1| COG1968: Uncharacterized bacitrac... 32 3.8
gi|6321759|ref|NP_011835.1| cell wall integrity and stress respo... 31 4.9
gi|10437948|dbj|BAB15130.1| unnamed protein product [Homo sapiens] 31 4.9
gi|46249923|gb|AAH68508.1| PHACTR4 protein [Homo sapiens] 31 4.9
gi|40254957|ref|NP_076412.2| hypothetical protein FLJ13171 [Homo... 31 4.9
gi|34868150|ref|XP_343327.1| similar to myeloid/lymphoid or mixe... 31 4.9
gi|32965759|gb|AAP92087.1| UL73 protein [Human herpesvirus 5] 31 4.9
gi|32965757|gb|AAP92086.1| UL73 protein [Human herpesvirus 5] 31 4.9
gi|32965691|gb|AAP92053.1| UL73 protein [Human herpesvirus 5] >g... 31 4.9
gi|32965767|gb|AAP92091.1| UL73 protein [Human herpesvirus 5] 31 4.9
gi|23468374|gb|AAH29266.1| PHACTR4 protein [Homo sapiens] 31 4.9
gi|6322611|ref|NP_012685.1| Delayed Anaerobic Gene; Dan4p [Sacch... 31 4.9
gi|13470542|ref|NP_102110.1| RNA polymerase beta subunit [Mesorh... 31 4.9
gi|16740555|gb|AAH16152.1| Similar to hypothetical protein FLJ13... 31 4.9
gi|1703144|sp|P53487|ARP2_ACACA ACTIN-LIKE PROTEIN 2 >gnl|BL_ORD... 31 6.4
gi|15963511|gb|AAL11048.1| 28 kDa salivary protein precursor [Ph... 31 6.4
gi|50256587|gb|EAL19312.1| hypothetical protein CNBH4110 [Crypto... 31 6.4
gi|7474427|pir||G69765 allophanate hydrolase homolog ycsJ - Baci... 31 6.4
gi|50812187|ref|YP_054571.1| kipA [Bacillus subtilis subsp. subt... 31 6.4
gi|2270984|gb|AAB63673.1| orf4 [Sinorhizobium meliloti] 31 6.4
gi|50258872|gb|EAL21555.1| hypothetical protein CNBD0230 [Crypto... 30 8.4
gi|25411533|pir||F84512 Mutator-like transposase [imported] - Ar... 30 8.4
gi|9438229|gb|AAF86613.1| phospholipase C beta 1 [Homo sapiens] 30 8.4
gi|46434712|gb|EAK94114.1| hypothetical protein CaO19.2398 [Cand... 30 8.4
gi|30315966|sp|Q8VII8|MCR_MOUSE Mineralocorticoid receptor (MR) 30 8.4
gi|38089342|ref|XP_356093.1| nuclear receptor subfamily 3, group... 30 8.4
gi|20514679|ref|NP_620625.1| hypothetical protein SpV1-C74p05 [S... 30 8.4
gi|619564|emb|CAA58586.1| mineralocorticoid receptor [Tupaia bel... 30 8.4
gi|6323592|ref|NP_013663.1| RNA splicing and ER to Golgi transpo... 30 8.4
gi|2500913|sp|Q29131|MCR_TUPGB Mineralocorticoid receptor (MR) >... 30 8.4
gi|30315970|sp|Q9N0W8|MCR_SAISC Mineralocorticoid receptor (MR) ... 30 8.4
gi|34861766|ref|XP_215127.2| similar to secreted gel-forming muc... 30 8.4
gi|34913408|ref|NP_918051.1| B1074C08.27 [Oryza sativa (japonica... 30 8.4
>gi|17543764|ref|NP_502790.1| nadh dehydrogenase 1 alpha subcomplex
6 (15.0 kD) (4P560) [Caenorhabditis elegans]
gi|7510280|pir||T27224 hypothetical protein Y57G11C.12 -
Caenorhabditis elegans
gi|3881188|emb|CAB16513.1| Hypothetical protein Y57G11C.12
[Caenorhabditis elegans]
Length = 131
Score = 269 bits (688), Expect = 8e-72
Identities = 131/131 (100%), Positives = 131/131 (100%)
Frame = -1
Query: 396 MSATAGRVVRAGQHAVRTVAPIKSNNSAEARMSVLAAYKEFQRLTPKFWWDFGLHDMPLG 217
MSATAGRVVRAGQHAVRTVAPIKSNNSAEARMSVLAAYKEFQRLTPKFWWDFGLHDMPLG
Sbjct: 1 MSATAGRVVRAGQHAVRTVAPIKSNNSAEARMSVLAAYKEFQRLTPKFWWDFGLHDMPLG 60
Query: 216 VFRAVIKKQFTKNGHLTDVRVVDRLVGETHQHMKSIRYAFYNPDHVRNYLFAENVEAKPK 37
VFRAVIKKQFTKNGHLTDVRVVDRLVGETHQHMKSIRYAFYNPDHVRNYLFAENVEAKPK
Sbjct: 61 VFRAVIKKQFTKNGHLTDVRVVDRLVGETHQHMKSIRYAFYNPDHVRNYLFAENVEAKPK 120
Query: 36 DFLSKFLNGKE 4
DFLSKFLNGKE
Sbjct: 121 DFLSKFLNGKE 131