Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y59A8B_1
(1074 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17566062|ref|NP_507514.1| ubiquitin specific protease 8 (5S41... 729 0.0
gi|39585329|emb|CAE61651.1| Hypothetical protein CBG05585 [Caeno... 598 e-170
gi|27697056|gb|AAH43910.1| Usp8-prov protein [Xenopus laevis] 214 3e-54
gi|50753009|ref|XP_413830.1| PREDICTED: similar to Ubiquitin car... 199 7e-50
gi|34858657|ref|XP_215821.2| similar to mKIAA0055 protein [Rattu... 196 1e-48
gi|40789062|dbj|BAA06225.2| KIAA0055 [Homo sapiens] 195 1e-48
gi|731046|sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydro... 195 1e-48
gi|20071587|gb|AAH27052.1| Usp8 protein [Mus musculus] 195 2e-48
gi|31981044|ref|NP_062703.2| ubiquitin specific protease 8; puta... 195 2e-48
gi|5058999|gb|AAD38869.1| putative deubiquitinating enzyme UBPY ... 195 2e-48
gi|28972047|dbj|BAC65477.1| mKIAA0055 protein [Mus musculus] 195 2e-48
gi|41281376|ref|NP_005145.2| ubiquitin specific protease 8 [Homo... 193 5e-48
gi|11414862|dbj|BAB18534.1| deubiquitinating enzyme UBPY [Mus mu... 192 1e-47
gi|47230636|emb|CAF99829.1| unnamed protein product [Tetraodon n... 181 3e-44
gi|28571791|ref|NP_650948.2| CG5798-PA [Drosophila melanogaster]... 170 5e-41
gi|21483568|gb|AAM52759.1| SD04548p [Drosophila melanogaster] 168 2e-40
gi|50290225|ref|XP_447544.1| unnamed protein product [Candida gl... 166 9e-40
gi|49078566|ref|XP_403023.1| hypothetical protein UM05408.1 [Ust... 161 2e-38
gi|6320992|ref|NP_011071.1| Putative ubiquitin-specific protease... 158 2e-37
gi|19920418|ref|NP_608462.1| CG14619-PA [Drosophila melanogaster... 156 9e-37
gi|24643793|ref|NP_728455.1| CG14619-PC [Drosophila melanogaster... 156 9e-37
gi|50260291|gb|EAL22950.1| hypothetical protein CNBA7180 [Crypto... 155 2e-36
gi|24643795|ref|NP_728456.1| CG14619-PB [Drosophila melanogaster... 154 3e-36
gi|50288319|ref|XP_446588.1| unnamed protein product [Candida gl... 150 5e-35
gi|10720326|sp|O57429|UBP2_CHICK Ubiquitin carboxyl-terminal hyd... 150 5e-35
gi|3800762|gb|AAC68864.1| ubiquitin specific protease 52 [Gallus... 150 6e-35
gi|6320274|ref|NP_010354.1| Ubiquitin hydrolase, required for re... 149 1e-34
gi|706835|emb|CAA58985.1| deubiquinating enzyme [Saccharomyces c... 149 1e-34
gi|46436610|gb|EAK95969.1| hypothetical protein CaO19.7207 [Cand... 149 1e-34
gi|3800764|gb|AAC68865.1| ubiquitin specific protease 66 [Gallus... 147 3e-34
gi|45198525|ref|NP_985554.1| AFR007Wp [Eremothecium gossypii] >g... 145 2e-33
gi|21312902|ref|NP_083439.1| RIKEN cDNA 4930511O11 [Mus musculus... 145 2e-33
gi|50308817|ref|XP_454413.1| unnamed protein product [Kluyveromy... 144 3e-33
gi|31212665|ref|XP_315317.1| ENSANGP00000000895 [Anopheles gambi... 144 3e-33
gi|38174591|gb|AAH61020.1| RIKEN cDNA 4930511O11 [Mus musculus] 144 5e-33
gi|31206105|ref|XP_312004.1| ENSANGP00000018711 [Anopheles gambi... 142 1e-32
gi|7670525|dbj|BAA95110.1| unnamed protein product [Mus musculus] 142 1e-32
gi|50556092|ref|XP_505454.1| hypothetical protein [Yarrowia lipo... 142 2e-32
gi|27371223|gb|AAH41366.1| USP2 protein [Homo sapiens] 138 2e-31
gi|37674281|ref|NP_932760.1| ubiquitin-specific protease 2 isofo... 138 3e-31
gi|7949158|ref|NP_058088.1| ubiquitin-specific protease 2 isofor... 138 3e-31
gi|37674279|ref|NP_932759.1| ubiquitin-specific protease 2 isofo... 138 3e-31
gi|17028406|gb|AAH17517.1| Usp2 protein [Mus musculus] >gnl|BL_O... 138 3e-31
gi|16758612|ref|NP_446226.1| ubiquitin specific protease 2 [Ratt... 137 3e-31
gi|6573165|gb|AAF17575.1| testis ubiquitin specific processing p... 137 3e-31
gi|49088858|ref|XP_406209.1| hypothetical protein AN2072.2 [Aspe... 137 3e-31
gi|47228612|emb|CAG07344.1| unnamed protein product [Tetraodon n... 136 7e-31
gi|30584279|gb|AAP36388.1| Homo sapiens ubiquitin specific prote... 136 7e-31
gi|20141855|sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hyd... 136 7e-31
gi|28565285|ref|NP_741994.1| ubiquitin specific protease 2 isofo... 136 7e-31
gi|6492126|gb|AAF14190.1| deubiquitinating enzyme Ubp69 [Rattus ... 136 1e-30
gi|6492124|gb|AAF14189.1| deubiquitinating enzyme Ubp45 [Rattus ... 136 1e-30
gi|7305615|ref|NP_038947.1| ubiquitin-specific protease 21; ubiq... 135 1e-30
gi|50425649|ref|XP_461421.1| unnamed protein product [Debaryomyc... 135 2e-30
gi|19112524|ref|NP_595732.1| ubiquitin carboxyl-terminal hydrola... 135 2e-30
gi|45382531|ref|NP_990257.1| ubiquitin specific protease 46 [Gal... 135 2e-30
gi|48257066|gb|AAH03130.2| USP21 protein [Homo sapiens] 134 3e-30
gi|10720334|sp|Q9UK80|UB21_HUMAN Ubiquitin carboxyl-terminal hyd... 134 3e-30
gi|34859143|ref|XP_230564.2| similar to RIKEN cDNA 4930511O11 [R... 134 3e-30
gi|7363366|gb|AAF61308.1| NEDD8-specific protease [Homo sapiens] 134 5e-30
gi|3386550|gb|AAC28392.1| ubiquitin-specific protease UBP41 [Hom... 134 5e-30
gi|172730|gb|AAA35105.1| putative >gnl|BL_ORD_ID|257958 gi|73877... 133 6e-30
gi|21361712|ref|NP_004196.3| ubiquitin specific protease 2 isofo... 132 2e-29
gi|12847085|dbj|BAB27431.1| unnamed protein product [Mus musculus] 130 5e-29
gi|49523089|gb|AAH75590.1| Unknown (protein for MGC:89592) [Xeno... 130 7e-29
gi|47681481|gb|AAT37507.1| UBP protein [Homo sapiens] 129 9e-29
gi|30583377|gb|AAP35933.1| ubiquitin specific protease 3 [Homo s... 129 9e-29
gi|48527959|ref|NP_036607.2| ubiquitin-specific protease 21 isof... 128 2e-28
gi|21450103|ref|NP_659186.1| ubiquitin specific protease 3 [Mus ... 128 3e-28
gi|50752807|ref|XP_413755.1| PREDICTED: similar to ubiquitin spe... 127 4e-28
gi|48096646|ref|XP_392493.1| similar to ubiquitin specific prote... 127 6e-28
gi|49069198|ref|XP_398888.1| hypothetical protein UM01273.1 [Ust... 122 1e-26
gi|6681237|ref|NP_031913.1| deubiquitinating enzyme 1 [Mus muscu... 121 3e-26
gi|41019553|tpe|CAD66057.1| TPA: mouse deubiquitinating enzyme 6... 120 5e-26
gi|38087808|ref|XP_145847.2| similar to DUB-1 [Mus musculus] 120 5e-26
gi|38087821|ref|XP_357799.1| similar to deubiquitinating enzyme ... 120 7e-26
gi|31982806|ref|NP_034219.2| deubiquitinating enzyme 2 [Mus musc... 120 7e-26
gi|2739431|gb|AAB95194.1| hematopoietic-specific IL-2 deubiquiti... 120 7e-26
gi|14994718|gb|AAK77003.1| deubiquitinating enzyme 2A [Mus muscu... 120 7e-26
gi|31198819|ref|XP_308357.1| ENSANGP00000019067 [Anopheles gambi... 120 7e-26
gi|47225852|emb|CAF98332.1| unnamed protein product [Tetraodon n... 119 9e-26
gi|26354326|dbj|BAC40791.1| unnamed protein product [Mus musculus] 118 2e-25
gi|24658645|ref|NP_729095.1| CG5505-PB [Drosophila melanogaster]... 117 6e-25
gi|24658624|ref|NP_729093.1| CG5505-PF [Drosophila melanogaster]... 117 6e-25
gi|24658638|ref|NP_647986.2| CG5505-PE [Drosophila melanogaster]... 117 6e-25
gi|24658609|ref|NP_729091.1| CG5505-PA [Drosophila melanogaster]... 117 6e-25
gi|48475055|ref|NP_001001559.1| deubiquitinating enzyme 2A [Mus ... 117 6e-25
gi|33589646|gb|AAQ22589.1| AT24152p [Drosophila melanogaster] 117 6e-25
gi|24658632|ref|NP_729094.1| CG5505-PC [Drosophila melanogaster]... 117 6e-25
gi|24658617|ref|NP_729092.1| CG5505-PD [Drosophila melanogaster]... 117 6e-25
gi|28416398|gb|AAO42671.1| AT31021p [Drosophila melanogaster] 117 6e-25
gi|45267835|ref|NP_987090.1| ubiquitin specific protease 50 [Hom... 114 3e-24
gi|50725209|dbj|BAD33960.1| putative ubiquitin-specific protease... 114 3e-24
gi|42407867|dbj|BAD09009.1| putative ubiquitin-specific protease... 114 3e-24
gi|5730110|ref|NP_006528.1| ubiquitin specific protease 3 [Homo ... 113 7e-24
gi|5823525|gb|AAD53181.1| ubiquitin-specific protease nonstop [D... 113 7e-24
gi|17647743|ref|NP_524140.1| CG4166-PA [Drosophila melanogaster]... 113 7e-24
gi|16198231|gb|AAL13936.1| LD43147p [Drosophila melanogaster] 113 7e-24
gi|41351535|ref|NP_958811.1| deubiquitinating enzyme 1A [Mus mus... 112 2e-23
gi|48098856|ref|XP_394836.1| similar to ENSANGP00000018711 [Apis... 111 3e-23
gi|50305101|ref|XP_452509.1| unnamed protein product [Kluyveromy... 111 3e-23
gi|34785787|gb|AAH57482.1| Wu:fi15g04 protein [Danio rerio] 110 4e-23
gi|28502773|gb|AAH47168.1| Wu:fi15g04 protein [Danio rerio] 110 4e-23
gi|18400378|ref|NP_566486.1| ubiquitin-specific protease 25 (UBP... 110 7e-23
gi|24667051|ref|NP_649153.1| CG8334-PA [Drosophila melanogaster]... 109 1e-22
gi|11993477|gb|AAG42757.1| ubiquitin-specific protease 16 [Arabi... 109 1e-22
gi|18416380|ref|NP_567705.1| ubiquitin-specific protease 16, put... 109 1e-22
gi|46227980|gb|EAK88900.1| ubiquitin C-terminal hydrolase of the... 108 2e-22
gi|48527961|ref|NP_057656.3| ubiquitin-specific protease 21 isof... 108 2e-22
gi|18086363|gb|AAL57643.1| AT3g14400/MLN21_18 [Arabidopsis thali... 108 2e-22
gi|38087162|ref|XP_195683.2| similar to deubiquitinating enzyme ... 107 6e-22
gi|50260649|gb|EAL23302.1| hypothetical protein CNBA4180 [Crypto... 106 1e-21
gi|34864281|ref|XP_343416.1| similar to ubiquitin specific prote... 106 1e-21
gi|38173812|gb|AAH60846.1| USP42 protein [Homo sapiens] 105 2e-21
gi|41704912|sp|Q9H9J4|UB42_HUMAN Ubiquitin carboxyl-terminal hyd... 105 2e-21
gi|41147710|ref|XP_374396.1| similar to ubiquitin specific prote... 105 2e-21
gi|34870415|ref|XP_237865.2| similar to hypothetical protein FLJ... 104 3e-21
gi|38105890|gb|EAA52265.1| hypothetical protein MG04957.4 [Magna... 104 4e-21
gi|7487639|pir||T04192 hypothetical protein T4F9.30 - Arabidopsi... 104 4e-21
gi|42566404|ref|NP_192795.3| ubiquitin carboxyl-terminal hydrola... 104 4e-21
gi|38081578|ref|XP_132483.4| RIKEN cDNA A630018G05 gene [Mus mus... 104 4e-21
gi|31243025|ref|XP_321947.1| ENSANGP00000009880 [Anopheles gambi... 104 4e-21
gi|47226066|emb|CAG04440.1| unnamed protein product [Tetraodon n... 103 5e-21
gi|34859762|ref|XP_219069.2| similar to DUB-1 [Rattus norvegicus] 103 5e-21
gi|22026877|ref|NP_610943.2| CG8494-PA [Drosophila melanogaster]... 103 5e-21
gi|47208151|emb|CAF93184.1| unnamed protein product [Tetraodon n... 103 5e-21
gi|21429716|gb|AAM50536.1| AT06247p [Drosophila melanogaster] 103 5e-21
gi|13374862|emb|CAC34496.1| ubiquitin-specific protease-like pro... 103 7e-21
gi|50304791|ref|XP_452351.1| unnamed protein product [Kluyveromy... 103 7e-21
gi|49022846|dbj|BAC65678.4| mKIAA0891 protein [Mus musculus] 103 7e-21
gi|13529494|gb|AAH05470.1| Ubiquitin specific protease 11 [Mus m... 103 7e-21
gi|47825366|ref|NP_082080.2| ubiquitin-specific protease 19; ubi... 103 7e-21
gi|28436934|gb|AAH46824.1| similar to ubiquitin-specific proteas... 103 7e-21
gi|26339726|dbj|BAC33526.1| unnamed protein product [Mus musculus] 103 7e-21
gi|11993469|gb|AAG42753.1| ubiquitin-specific protease 8 [Arabid... 103 7e-21
gi|38258952|sp|Q99K46|UB11_MOUSE Ubiquitin carboxyl-terminal hyd... 103 7e-21
gi|18420426|ref|NP_568411.1| ubiquitin-specific protease 8, puta... 103 7e-21
gi|42657122|ref|XP_377830.1| similar to deubiquitinating enzyme ... 103 7e-21
gi|34932914|ref|XP_341473.1| similar to Ubiquitin carboxyl-termi... 103 7e-21
gi|48040522|ref|NP_001001516.1| ubiquitin specific protease 19; ... 103 7e-21
gi|41146881|ref|XP_373016.1| similar to deubiquitinating enzyme ... 103 9e-21
gi|47086475|ref|NP_997718.1| deubiquitinating enzyme DUB4 [Homo ... 102 1e-20
gi|41146891|ref|XP_373021.1| similar to deubiquitinating enzyme ... 102 1e-20
gi|7487236|pir||T00757 probable ubiquitin carboxyl terminal hydr... 102 1e-20
gi|18413358|ref|NP_567363.1| ubiquitin carboxyl-terminal hydrola... 102 1e-20
gi|7487641|pir||T04194 hypothetical protein T4F9.50 - Arabidopsi... 102 1e-20
gi|18405549|ref|NP_565944.1| ubiquitin-specific protease 5, puta... 102 1e-20
gi|21592289|ref|NP_660185.1| ubiquitin specific protease 15 [Rat... 102 2e-20
gi|39795322|gb|AAH63668.1| USP11 protein [Homo sapiens] 102 2e-20
gi|28972259|dbj|BAC65583.1| mKIAA0529 protein [Mus musculus] 102 2e-20
gi|21489969|ref|NP_081880.2| ubiquitin specific protease 15; gra... 102 2e-20
gi|34859746|ref|XP_219062.2| similar to DUB-1 [Rattus norvegicus] 102 2e-20
gi|24234683|ref|NP_004642.2| ubiquitin specific protease 11; ubi... 102 2e-20
gi|23503563|dbj|BAC20463.1| deubiquitinating enzyme [Homo sapiens] 102 2e-20
gi|1276912|gb|AAC50450.1| UHX1 protein >gnl|BL_ORD_ID|1108436 gi... 102 2e-20
gi|38258924|sp|P51784|UB11_HUMAN Ubiquitin carboxyl-terminal hyd... 102 2e-20
gi|42562472|ref|NP_174562.2| ubiquitin carboxyl-terminal hydrola... 102 2e-20
gi|25403162|pir||C86453 CDS protein F9L11.5 [imported] - Arabido... 102 2e-20
gi|50292819|ref|XP_448842.1| unnamed protein product [Candida gl... 101 3e-20
gi|14423962|sp|O94966|UB19_HUMAN Ubiquitin carboxyl-terminal hyd... 101 3e-20
gi|31211893|ref|XP_314931.1| ENSANGP00000001119 [Anopheles gambi... 101 3e-20
gi|31981834|ref|NP_663603.2| ubiquitin specific protease 11 [Mus... 101 3e-20
gi|14149627|ref|NP_006304.1| ubiquitin specific protease 15; deu... 101 3e-20
gi|28381406|sp|Q9Y4E8|UBPF_HUMAN Ubiquitin carboxyl-terminal hyd... 101 3e-20
gi|11077995|gb|AAG28973.1| ubiquitin C-terminal hydrolase [Homo ... 101 3e-20
gi|37531290|ref|NP_919947.1| putative ubiquitin carboxyl termina... 100 4e-20
gi|42516561|ref|NP_963920.1| ubiquitin specific protease 33 isof... 100 4e-20
gi|47219080|emb|CAG00219.1| unnamed protein product [Tetraodon n... 100 4e-20
gi|29747941|gb|AAH50042.1| Ubiquitin specific protease 15 [Mus m... 100 4e-20
gi|34879859|ref|XP_228809.2| similar to Ubiquitin carboxyl-termi... 100 6e-20
gi|13529590|gb|AAH05506.1| Usp33 protein [Mus musculus] 100 6e-20
gi|50546843|ref|XP_500891.1| hypothetical protein [Yarrowia lipo... 100 6e-20
gi|31202867|ref|XP_310382.1| ENSANGP00000005611 [Anopheles gambi... 100 6e-20
gi|39581466|emb|CAE67996.1| Hypothetical protein CBG13606 [Caeno... 100 8e-20
gi|50551497|ref|XP_503222.1| hypothetical protein [Yarrowia lipo... 100 8e-20
gi|4758564|ref|NP_004496.1| ubiquitin specific protease 6; tre-2... 100 1e-19
gi|32403906|ref|XP_322566.1| hypothetical protein [Neurospora cr... 100 1e-19
gi|10434504|dbj|BAB14279.1| unnamed protein product [Homo sapiens] 100 1e-19
gi|50419411|ref|XP_458232.1| unnamed protein product [Debaryomyc... 100 1e-19
gi|50403738|sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hyd... 100 1e-19
gi|38197496|gb|AAH00350.4| USP11 protein [Homo sapiens] 100 1e-19
gi|41148606|ref|XP_373238.1| similar to deubiquitinating enzyme ... 100 1e-19
gi|107238|pir||S22158 transforming protein (clones 210 and 213) ... 100 1e-19
gi|31239991|ref|XP_320409.1| ENSANGP00000009183 [Anopheles gambi... 100 1e-19
gi|38014646|gb|AAH60390.1| LOC398902 protein [Xenopus laevis] 99 1e-19
gi|47169480|tpe|CAE48377.1| TPA: ubiquitin specific protease 11 ... 99 2e-19
gi|42657831|ref|XP_376571.1| ubiquitin specific protease 42 [Hom... 98 3e-19
gi|37360390|dbj|BAC98173.1| mKIAA1453 protein [Mus musculus] 98 3e-19
gi|28514900|ref|XP_126772.2| RIKEN cDNA 2700002L06 [Mus musculus] 98 3e-19
gi|45382305|ref|NP_990171.1| ubiquitin specific protease 15; ubi... 98 4e-19
gi|34784440|gb|AAH57470.1| Unknown (protein for IMAGE:5413509) [... 98 4e-19
gi|41704671|sp|Q8TEY7|UB33_HUMAN Ubiquitin carboxyl-terminal hyd... 98 4e-19
gi|42516567|ref|NP_055832.3| ubiquitin specific protease 33 isof... 98 4e-19
gi|2137412|pir||I58376 hypothetical protein unp - mouse 98 4e-19
gi|5689531|dbj|BAA83049.1| KIAA1097 protein [Homo sapiens] 98 4e-19
gi|42516565|ref|NP_963918.1| ubiquitin specific protease 33 isof... 98 4e-19
gi|18698435|gb|AAL78315.1| pVHL-interacting deubiquitinating enz... 98 4e-19
gi|50294832|ref|XP_449827.1| unnamed protein product [Candida gl... 97 5e-19
gi|6322264|ref|NP_012338.1| Ubiquitin-specific protease present ... 97 5e-19
gi|19075305|ref|NP_587805.1| ubiquitin carboxyl-terminal hydrola... 97 5e-19
gi|18875422|ref|NP_573510.1| ubiquitin specific protease 33; pVH... 97 5e-19
gi|21619540|gb|AAH31366.1| Usp33 protein [Mus musculus] 97 6e-19
gi|27503316|gb|AAH42353.1| LOC398480 protein [Xenopus laevis] 97 6e-19
gi|29367503|gb|AAO72607.1| putative ubiquitin-specific protease ... 97 6e-19
gi|41349932|ref|NP_958804.1| deubiquitinating enzyme 3 [Homo sap... 97 6e-19
gi|47497222|dbj|BAD19267.1| putative hematopoietic-specific IL-2... 97 8e-19
gi|50754193|ref|XP_414281.1| PREDICTED: similar to ubiquitin spe... 97 8e-19
gi|47211964|emb|CAF96183.1| unnamed protein product [Tetraodon n... 97 8e-19
gi|2655204|gb|AAC53587.1| ubiquitin-specific protease [Mus muscu... 97 8e-19
gi|6755943|ref|NP_035808.1| ubiquitin specific protease 4 (proto... 97 8e-19
gi|26354498|dbj|BAC40877.1| unnamed protein product [Mus musculus] 97 8e-19
gi|38086908|ref|XP_142236.4| similar to Ubiquitin carboxyl-termi... 97 8e-19
gi|15030172|gb|AAH11341.1| Usp4 protein [Mus musculus] 97 8e-19
gi|42542785|gb|AAH66180.1| Usp4 protein [Mus musculus] >gnl|BL_O... 97 8e-19
gi|7959165|dbj|BAA95977.1| KIAA1453 protein [Homo sapiens] 96 1e-18
gi|47940448|gb|AAH71582.1| USP36 protein [Homo sapiens] 96 1e-18
gi|50548343|ref|XP_501641.1| hypothetical protein [Yarrowia lipo... 96 1e-18
gi|35250686|ref|NP_079366.2| ubiquitin specific protease 36 [Hom... 96 1e-18
gi|7023072|dbj|BAA91825.1| unnamed protein product [Homo sapiens] 96 1e-18
gi|34932905|ref|XP_214377.2| similar to Usp4 protein [Rattus nor... 96 1e-18
gi|3123303|sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydr... 96 1e-18
gi|10434580|dbj|BAB14306.1| unnamed protein product [Homo sapiens] 96 1e-18
gi|41148608|ref|XP_373239.1| similar to ubiquitin-specific prote... 96 1e-18
gi|5360127|gb|AAD42882.1| NY-REN-60 antigen [Homo sapiens] 96 1e-18
gi|34873258|ref|XP_220798.2| similar to ubiquitin specific prote... 96 1e-18
gi|22550104|ref|NP_115971.2| ubiquitin specific protease 32 [Hom... 96 1e-18
gi|39584111|emb|CAE61486.1| Hypothetical protein CBG05381 [Caeno... 96 1e-18
gi|50758374|ref|XP_415892.1| PREDICTED: similar to ubiquitin spe... 96 1e-18
gi|17532903|ref|NP_496482.1| ubiquitin 1 (2L901) [Caenorhabditis... 96 1e-18
gi|13560797|gb|AAK30207.1| ubiquitin specific protease [Homo sap... 96 1e-18
gi|38091533|ref|XP_110937.4| similar to ubiquitin specific prote... 96 1e-18
gi|25152734|ref|NP_510570.2| 1 -interacting deubiquitinating enz... 96 2e-18
gi|47224929|emb|CAG06499.1| unnamed protein product [Tetraodon n... 96 2e-18
gi|4689128|gb|AAD27773.1| SIH003 [Homo sapiens] 96 2e-18
gi|39597236|emb|CAE59464.1| Hypothetical protein CBG02847 [Caeno... 95 2e-18
gi|49098062|ref|XP_410491.1| hypothetical protein AN6354.2 [Aspe... 95 3e-18
gi|29612641|gb|AAH49870.1| Usp33 protein [Mus musculus] 95 3e-18
gi|46438922|gb|EAK98246.1| hypothetical protein CaO19.3815 [Cand... 95 3e-18
gi|50751420|ref|XP_422389.1| PREDICTED: similar to ubiquitin spe... 95 3e-18
gi|40795665|ref|NP_003354.2| ubiquitin specific protease, proto-... 94 4e-18
gi|42658819|ref|XP_376741.1| similar to ubiquitin-specific prote... 94 4e-18
gi|28564121|gb|AAO32439.1| UBP11 [Saccharomyces bayanus] 94 4e-18
gi|40795667|ref|NP_955475.1| USP4; Unph; ubiquitin specific prot... 94 4e-18
gi|46806341|dbj|BAD17530.1| putative ubiquitin-specific protease... 94 4e-18
gi|48094643|ref|XP_392160.1| similar to ENSANGP00000001119 [Apis... 94 4e-18
gi|19074463|ref|NP_585969.1| UBIQUITIN CARBOXYL TERMINAL HYDROLA... 94 5e-18
gi|31198649|ref|XP_308272.1| ENSANGP00000009352 [Anopheles gambi... 94 5e-18
gi|18424054|ref|NP_568873.1| ubiquitin-specific protease 23, put... 94 7e-18
gi|11993486|gb|AAG42761.1| ubiquitin-specific protease 23 [Arabi... 94 7e-18
gi|46440639|gb|EAK99943.1| hypothetical protein CaO19.6260 [Cand... 94 7e-18
gi|48475065|gb|AAT44134.1| 'unknown protein, contains ubiquitin ... 94 7e-18
gi|34871601|ref|XP_220582.2| similar to RIKEN cDNA 1700019F09 [R... 94 7e-18
gi|46440549|gb|EAK99854.1| hypothetical protein CaO19.13639 [Can... 94 7e-18
gi|42658831|ref|XP_378014.1| similar to ubiquitin-specific prote... 93 9e-18
gi|28829270|gb|AAO51812.1| similar to Homo sapiens (Human). Hypo... 93 9e-18
gi|26326383|dbj|BAC26935.1| unnamed protein product [Mus musculus] 93 9e-18
gi|34933471|ref|XP_228777.2| similar to Ubiquitin carboxyl-termi... 93 9e-18
gi|47219848|emb|CAF97118.1| unnamed protein product [Tetraodon n... 93 9e-18
gi|4115922|gb|AAD03433.1| contains similarity to ubiquitin carbo... 93 1e-17
gi|34899870|ref|NP_911281.1| putative ubiquitin C-terminal hydro... 93 1e-17
gi|46228703|gb|EAK89573.1| ubiquitin carboxyl-terminal hydrolase... 92 2e-17
gi|28564908|gb|AAO32538.1| UBP7 [Saccharomyces castellii] 92 2e-17
gi|19076030|ref|NP_588530.1| putative ubiquitin carboxyl-termina... 92 2e-17
gi|47086035|ref|NP_998392.1| zgc:77308 [Danio rerio] >gnl|BL_ORD... 92 2e-17
gi|25412232|pir||B84639 probable ubiquitin carboxyl terminal hyd... 92 2e-17
gi|7673618|gb|AAF66953.1| ubiquitin specific protease [Mus muscu... 92 2e-17
gi|18400597|ref|NP_565576.1| ubiquitin carboxyl-terminal hydrola... 92 2e-17
gi|40788175|emb|CAE47744.2| ubiquitin specific proteinase 43 [Ho... 92 2e-17
gi|42661097|ref|XP_371015.2| ubiquitin specific protease 43 [Hom... 92 2e-17
gi|49075516|ref|XP_401817.1| hypothetical protein UM04202.1 [Ust... 92 2e-17
gi|42662554|ref|XP_372213.2| similar to ubiquitin specific prote... 92 3e-17
gi|47220072|emb|CAG12220.1| unnamed protein product [Tetraodon n... 92 3e-17
gi|19075499|ref|NP_587999.1| putative ubiquitin carboxyl-termina... 92 3e-17
gi|15787712|emb|CAC88170.1| bA409K20.4 (ubiquitin specific prote... 91 5e-17
gi|34859105|ref|XP_219292.2| similar to KIAA1203 protein [Rattus... 91 5e-17
gi|40789018|dbj|BAA76847.2| KIAA1003 protein [Homo sapiens] 91 5e-17
gi|45199145|ref|NP_986174.1| AFR627Cp [Eremothecium gossypii] >g... 91 5e-17
gi|42415503|ref|NP_065769.2| ubiquitin specific protease 31; ubi... 91 5e-17
gi|12643376|sp|Q9Y2K6|UB20_HUMAN Ubiquitin carboxyl-terminal hyd... 91 5e-17
gi|38087494|ref|XP_357781.1| RIKEN cDNA 6330567E21 [Mus musculus] 91 5e-17
gi|31543912|ref|NP_006667.2| ubiquitin specific protease 20; pVH... 91 5e-17
gi|18204471|gb|AAH21474.1| Usp43 protein [Mus musculus] 91 6e-17
gi|50755583|ref|XP_414805.1| PREDICTED: similar to Ubiquitin car... 91 6e-17
gi|18399935|ref|NP_565532.1| ubiquitin-specific protease 4 (UBP4... 91 6e-17
gi|21593319|gb|AAM65268.1| ubiquitin-specific protease 4 (UBP4) ... 91 6e-17
gi|41152235|ref|NP_958443.1| ubiquitin specific protease 51 [Hom... 91 6e-17
gi|30424595|ref|NP_776115.1| ubiquitin specific protease 43 [Mus... 91 6e-17
gi|20140914|sp|Q9UPT9|UB22_HUMAN Ubiquitin carboxyl-terminal hyd... 90 8e-17
gi|47224895|emb|CAG06465.1| unnamed protein product [Tetraodon n... 90 8e-17
gi|5002571|emb|CAB44337.1| LSFR3 protein [Takifugu rubripes] 90 8e-17
gi|17541074|ref|NP_501035.1| ubiquitin specific protease 15 (102... 90 8e-17
gi|37544668|ref|XP_042698.3| ubiquitin specific protease 22 [Hom... 90 8e-17
gi|34853534|ref|XP_231148.2| similar to Ubiquitin carboxyl-termi... 90 8e-17
gi|23208620|gb|AAN15803.1| pVHL-interacting deubiquitinating enz... 90 8e-17
gi|30794162|ref|NP_083122.1| ubiquitin specific protease 20 [Mus... 90 8e-17
gi|50510751|dbj|BAD32361.1| mKIAA1003 protein [Mus musculus] 90 8e-17
gi|34533357|dbj|BAC86673.1| unnamed protein product [Homo sapiens] 90 8e-17
gi|15238468|ref|NP_201348.1| ubiquitin carboxyl-terminal hydrola... 90 1e-16
gi|6323879|ref|NP_013950.1| Ubiquitin-specific protease that is ... 90 1e-16
gi|15236036|ref|NP_194895.1| ubiquitin carboxyl-terminal hydrola... 90 1e-16
gi|18420557|ref|NP_568074.1| ubiquitin-specific protease 3 (UBP3... 89 1e-16
gi|29476902|gb|AAH48269.1| USP19 protein [Homo sapiens] 89 1e-16
gi|9279587|dbj|BAB01045.1| unnamed protein product [Arabidopsis ... 89 1e-16
gi|47213596|emb|CAG07262.1| unnamed protein product [Tetraodon n... 89 1e-16
gi|42406407|gb|AAH65909.1| USP19 protein [Homo sapiens] 89 1e-16
gi|50755437|ref|XP_414742.1| PREDICTED: similar to Ubiquitin car... 89 2e-16
gi|38344011|emb|CAE03179.2| OSJNBa0070O11.10 [Oryza sativa (japo... 89 2e-16
gi|6322951|ref|NP_013024.1| Ubiquitin-specific protease that cle... 89 2e-16
gi|50418363|gb|AAH78033.1| Unknown (protein for MGC:82756) [Xeno... 89 2e-16
gi|34365073|emb|CAE45893.1| hypothetical protein [Homo sapiens] 89 2e-16
gi|50745918|ref|XP_420298.1| PREDICTED: similar to ubiquitin spe... 89 2e-16
gi|27374272|gb|AAO01028.1| CG30421-PA [Drosophila pseudoobscura] 89 2e-16
gi|41053756|ref|NP_956551.1| hypothetical protein MGC55661 [Dani... 89 2e-16
gi|46125069|ref|XP_387088.1| hypothetical protein FG06912.1 [Gib... 89 2e-16
gi|10441889|gb|AAG17222.1| unknown [Homo sapiens] 89 2e-16
gi|49115779|gb|AAH73524.1| Unknown (protein for MGC:82781) [Xeno... 89 2e-16
gi|38099327|gb|EAA46686.1| hypothetical protein MG09907.4 [Magna... 88 3e-16
gi|50252264|dbj|BAD28270.1| putative ubiquitin-specific protease... 88 4e-16
gi|45199069|ref|NP_986098.1| AFR551Wp [Eremothecium gossypii] >g... 88 4e-16
gi|31235401|ref|XP_319238.1| ENSANGP00000018655 [Anopheles gambi... 88 4e-16
gi|50427217|ref|XP_462221.1| unnamed protein product [Debaryomyc... 88 4e-16
gi|42660452|ref|XP_375200.1| similar to ubiquitin specific prote... 87 5e-16
gi|47225944|emb|CAG04318.1| unnamed protein product [Tetraodon n... 87 5e-16
gi|17554556|ref|NP_499162.1| ubiquitin-specific protease, possib... 87 9e-16
gi|34902450|ref|NP_912571.1| Putative ubiquitin-specific proteas... 87 9e-16
gi|47211965|emb|CAF96184.1| unnamed protein product [Tetraodon n... 87 9e-16
gi|11993482|gb|AAG42759.1| ubiquitin-specific protease 21 [Arabi... 86 1e-15
gi|543824|sp|Q01988|UB11_CANFA Ubiquitin carboxyl-terminal hydro... 86 1e-15
gi|50257099|gb|EAL19814.1| hypothetical protein CNBG1070 [Crypto... 86 1e-15
gi|18422708|ref|NP_568667.1| ubiquitin-specific protease 21 (UBP... 86 1e-15
gi|27374327|gb|AAO01072.1| CG30421-PA [Drosophila virilis] 86 1e-15
gi|24762724|ref|NP_611959.2| CG30421-PA [Drosophila melanogaster... 86 1e-15
gi|34870818|ref|XP_220534.2| similar to Ubiquitin carboxyl-termi... 86 1e-15
gi|11993484|gb|AAG42760.1| ubiquitin-specific protease 22 [Arabi... 86 1e-15
gi|39590736|emb|CAE65108.1| Hypothetical protein CBG09971 [Caeno... 86 1e-15
gi|21740732|emb|CAD40853.1| OSJNBa0086B14.26 [Oryza sativa (japo... 86 1e-15
gi|33438289|dbj|BAC65724.2| mKIAA1097 protein [Mus musculus] 86 1e-15
gi|48125083|ref|XP_396574.1| hypothetical protein XP_396574 [Api... 86 1e-15
gi|47218339|emb|CAG04171.1| unnamed protein product [Tetraodon n... 86 2e-15
gi|47229603|emb|CAG06799.1| unnamed protein product [Tetraodon n... 86 2e-15
gi|18416377|ref|NP_568239.1| ubiquitin-specific protease 22 (UBP... 85 3e-15
gi|46435932|gb|EAK95304.1| hypothetical protein CaO19.9336 [Cand... 85 3e-15
gi|46108698|ref|XP_381407.1| hypothetical protein FG01231.1 [Gib... 85 3e-15
gi|47216364|emb|CAG02422.1| unnamed protein product [Tetraodon n... 84 4e-15
gi|15208127|dbj|BAB63088.1| hypothetical protein [Macaca fascicu... 84 6e-15
gi|47210494|emb|CAF91634.1| unnamed protein product [Tetraodon n... 84 6e-15
gi|40788035|emb|CAE51939.1| ubiquitin-specific proteinase 49 [Ho... 84 7e-15
gi|32698815|ref|NP_872294.1| ubiquitin-specific protease 12-like... 84 7e-15
gi|6707738|sp|O75317|UB12_HUMAN Ubiquitin carboxyl-terminal hydr... 84 7e-15
gi|46128333|ref|XP_388720.1| hypothetical protein FG08544.1 [Gib... 84 7e-15
gi|34870377|ref|XP_341034.1| similar to Ubiquitin carboxyl-termi... 83 1e-14
gi|34328057|ref|NP_035799.1| ubiquitin specific protease 12; ubi... 83 1e-14
gi|19338632|gb|AAL86740.1| deubiquitinating enzyme UBH1 [Mus mus... 83 1e-14
gi|50757323|ref|XP_415470.1| PREDICTED: similar to bA409K20.4 (u... 83 1e-14
gi|16768276|gb|AAL28357.1| GH27809p [Drosophila melanogaster] 83 1e-14
gi|34874725|ref|XP_236919.2| similar to hypothetical protein MGC... 83 1e-14
gi|50421827|ref|XP_459471.1| unnamed protein product [Debaryomyc... 83 1e-14
gi|50258099|gb|EAL20793.1| hypothetical protein CNBE1550 [Crypto... 83 1e-14
gi|47223359|emb|CAG04220.1| unnamed protein product [Tetraodon n... 82 2e-14
gi|50755743|ref|XP_414881.1| PREDICTED: similar to ubiquitin spe... 82 2e-14
gi|18394440|ref|NP_564014.1| ubiquitin-specific protease 15 (UBP... 82 2e-14
gi|542487|pir||S40715 hypothetical protein R10E11.3 - Caenorhabd... 82 2e-14
gi|50289315|ref|XP_447088.1| unnamed protein product [Candida gl... 82 2e-14
gi|25511641|pir||H86306 F20D23.20 protein - Arabidopsis thaliana... 82 2e-14
gi|4115923|gb|AAD03434.1| contains similarity to ubiquitin carbo... 82 3e-14
gi|50731231|ref|XP_425636.1| PREDICTED: similar to Ubiquitin car... 81 4e-14
gi|14149817|ref|NP_115523.1| ubiquitin specific protease 44 [Hom... 81 4e-14
gi|18417689|ref|NP_567860.1| ubiquitin-specific protease 24, put... 81 4e-14
gi|48102093|ref|XP_395284.1| similar to CG30421-PA [Apis mellifera] 81 5e-14
gi|47215260|emb|CAF96987.1| unnamed protein product [Tetraodon n... 81 5e-14
gi|48102576|ref|XP_395389.1| similar to Ubiquitin carboxyl-termi... 81 5e-14
gi|49092774|ref|XP_407848.1| hypothetical protein AN3711.2 [Aspe... 80 6e-14
gi|41148616|ref|XP_373243.1| similar to deubiquitinating enzyme ... 80 6e-14
gi|5852120|emb|CAB55365.1| putative ubiquitin carboxy-terminal h... 80 8e-14
gi|38259220|ref|NP_940813.1| hypothetical protein C330046L10 [Mu... 80 8e-14
gi|21749051|dbj|BAC03523.1| unnamed protein product [Homo sapiens] 80 8e-14
gi|46432904|gb|EAK92366.1| hypothetical protein CaO19.3370 [Cand... 79 1e-13
gi|19113904|ref|NP_592992.1| ubiquitin carboxyl-terminal hydrola... 79 1e-13
gi|47208155|emb|CAF94665.1| unnamed protein product [Tetraodon n... 79 1e-13
gi|24653045|ref|NP_610784.1| CG8830-PA [Drosophila melanogaster]... 79 1e-13
gi|50306927|ref|XP_453439.1| unnamed protein product [Kluyveromy... 79 2e-13
gi|47210314|emb|CAF91625.1| unnamed protein product [Tetraodon n... 79 2e-13
gi|29247377|gb|EAA38941.1| GLP_438_30160_28841 [Giardia lamblia ... 79 2e-13
gi|10434108|dbj|BAB14133.1| unnamed protein product [Homo sapiens] 79 2e-13
gi|28565014|gb|AAO32590.1| UBP7 [Saccharomyces kluyveri] 78 3e-13
gi|32417892|ref|XP_329424.1| hypothetical protein [Neurospora cr... 78 3e-13
gi|29243896|ref|NP_808229.1| RIKEN cDNA 2410018I08 [Mus musculus... 78 3e-13
gi|49067402|ref|XP_397991.1| hypothetical protein UM00376.1 [Ust... 78 4e-13
gi|11993475|gb|AAG42756.1| ubiquitin-specific protease 15 [Arabi... 78 4e-13
gi|48103467|ref|XP_395580.1| similar to CG8830-PA [Apis mellifera] 78 4e-13
gi|50764611|ref|XP_426827.1| PREDICTED: similar to ubiquitin spe... 78 4e-13
gi|50746997|ref|XP_420711.1| PREDICTED: similar to RIKEN cDNA 24... 78 4e-13
gi|50550847|ref|XP_502896.1| hypothetical protein [Yarrowia lipo... 78 4e-13
gi|18408899|ref|NP_566922.1| ubiquitin-specific protease 26 (UBP... 77 5e-13
gi|11993492|gb|AAG42764.1| ubiquitin-specific protease 26 [Arabi... 77 5e-13
gi|50423869|ref|XP_460519.1| unnamed protein product [Debaryomyc... 77 5e-13
gi|42657094|ref|XP_376305.1| similar to deubiquitinating enzyme ... 77 5e-13
gi|11358453|pir||T46237 hypothetical protein T9C5.190 - Arabidop... 77 5e-13
gi|50302163|ref|XP_451015.1| unnamed protein product [Kluyveromy... 77 7e-13
gi|38106578|gb|EAA52868.1| hypothetical protein MG05996.4 [Magna... 77 9e-13
gi|47219352|emb|CAG10981.1| unnamed protein product [Tetraodon n... 77 9e-13
gi|6978939|dbj|BAA90762.1| ubiquitin carboxyl-terminal hydrolase... 76 1e-12
gi|34395185|dbj|BAC83574.1| putative ubiquitin-specific protease... 76 2e-12
gi|50255043|gb|EAL17783.1| hypothetical protein CNBL2960 [Crypto... 76 2e-12
gi|38091650|ref|XP_109894.3| similar to Ubiquitin carboxyl-termi... 76 2e-12
gi|49092526|ref|XP_407724.1| hypothetical protein AN3587.2 [Aspe... 76 2e-12
gi|25148974|ref|NP_741517.1| deubiquitinating enzyme 1 (5E67) [C... 75 2e-12
gi|6322035|ref|NP_012110.1| Ubiquitin-specific protease that cle... 75 2e-12
gi|25148978|ref|NP_741518.1| protease ubiquitin-specific 2 like ... 75 2e-12
gi|34861078|ref|XP_227811.2| similar to Vdu1-pending protein [Ra... 75 3e-12
gi|23478499|gb|EAA15570.1| similar to ubiquitin specific proteas... 75 3e-12
gi|50799956|ref|XP_424101.1| PREDICTED: similar to mKIAA1453 pro... 75 3e-12
gi|34875569|ref|XP_221143.2| similar to KIAA1453 protein [Rattus... 74 4e-12
gi|46441425|gb|EAL00722.1| hypothetical protein CaO19.9575 [Cand... 74 6e-12
gi|50554945|ref|XP_504881.1| hypothetical protein [Yarrowia lipo... 74 6e-12
gi|19112999|ref|NP_596207.1| putative ubiquitin carboxyl-termina... 74 6e-12
gi|34880929|ref|XP_237905.2| similar to RIKEN cDNA 1110021H02; E... 74 6e-12
gi|4028549|gb|AAC97115.1| ubiquitin hydrolase B [Dictyostelium d... 74 8e-12
gi|50288091|ref|XP_446474.1| unnamed protein product [Candida gl... 74 8e-12
gi|28829810|gb|AAO52312.1| similar to Dictyostelium discoideum (... 74 8e-12
gi|46441294|gb|EAL00592.1| hypothetical protein CaO19.2026 [Cand... 74 8e-12
gi|32405440|ref|XP_323333.1| predicted protein [Neurospora crass... 73 1e-11
gi|34851817|ref|XP_226528.2| similar to Ubiquintin c-terminal hy... 73 1e-11
gi|47226065|emb|CAG04439.1| unnamed protein product [Tetraodon n... 73 1e-11
gi|50421501|ref|XP_459301.1| unnamed protein product [Debaryomyc... 73 1e-11
gi|49071930|ref|XP_400254.1| hypothetical protein UM02639.1 [Ust... 73 1e-11
gi|38108934|gb|EAA54875.1| hypothetical protein MG05666.4 [Magna... 73 1e-11
gi|17554558|ref|NP_499163.1| ubiquitin-specific protease, possib... 72 2e-11
gi|24649154|ref|NP_732801.1| CG7023-PA [Drosophila melanogaster]... 72 2e-11
gi|23613189|ref|NP_703511.1| ubiquitin carboxyl-terminal hydrola... 72 2e-11
gi|6678493|ref|NP_033488.1| ubiquitin specific protease 10; ubiq... 72 2e-11
gi|32700079|sp|P52479|UB10_MOUSE Ubiquitin carboxyl-terminal hyd... 72 2e-11
gi|39584914|emb|CAE64338.1| Hypothetical protein CBG09021 [Caeno... 72 2e-11
gi|37359830|dbj|BAC97893.1| mKIAA0190 protein [Mus musculus] 72 2e-11
gi|31220351|ref|XP_316911.1| ENSANGP00000006552 [Anopheles gambi... 72 2e-11
gi|47230410|emb|CAF99603.1| unnamed protein product [Tetraodon n... 72 2e-11
gi|29245902|gb|EAA37519.1| GLP_301_26166_23707 [Giardia lamblia ... 72 2e-11
gi|16950532|gb|AAL32263.1| Cytokinesis defect protein 3, isoform... 72 2e-11
gi|46249634|gb|AAH68889.1| MGC83063 protein [Xenopus laevis] 72 2e-11
gi|7511085|pir||T29010 hypothetical protein ZK328.1 - Caenorhabd... 72 2e-11
gi|25150771|ref|NP_498311.2| ubiquitin C-terminal Hydrolase homo... 72 2e-11
gi|50291547|ref|XP_448206.1| unnamed protein product [Candida gl... 71 4e-11
gi|47229640|emb|CAG06836.1| unnamed protein product [Tetraodon n... 71 4e-11
gi|7487780|pir||T05075 hypothetical protein T6K21.70 - Arabidops... 71 5e-11
gi|47220071|emb|CAG12219.1| unnamed protein product [Tetraodon n... 71 5e-11
gi|31239949|ref|XP_320388.1| ENSANGP00000013924 [Anopheles gambi... 71 5e-11
gi|18414985|ref|NP_567544.1| ubiquitin-specific protease 20, put... 71 5e-11
gi|45198814|ref|NP_985843.1| AFR296Cp [Eremothecium gossypii] >g... 70 6e-11
gi|50751656|ref|XP_422499.1| PREDICTED: similar to Ubiquitin car... 70 8e-11
gi|23613403|ref|NP_703247.1| ubiquitin carboxyl-terminal hydrola... 70 8e-11
gi|45501059|gb|AAH67261.1| USP48 protein [Homo sapiens] 70 1e-10
gi|29165728|gb|AAH49274.1| Usp12 protein [Mus musculus] 70 1e-10
gi|18860907|ref|NP_115612.3| ubiquitin specific protease 48; ubi... 70 1e-10
gi|15079488|gb|AAH11576.1| USP48 protein [Homo sapiens] 70 1e-10
gi|30315217|gb|AAP30832.1| ubiquitin-specific protease 31 [Homo ... 70 1e-10
gi|23485702|gb|EAA20533.1| Ubiquitin carboxyl-terminal hydrolase... 69 2e-10
gi|23397271|gb|AAN31917.1| unknown protein [Arabidopsis thaliana] 69 2e-10
gi|38454304|ref|NP_942080.1| ubiquitin specific protease 31; syn... 69 2e-10
gi|22328871|ref|NP_193966.2| ubiquitin carboxyl-terminal hydrola... 69 2e-10
gi|34869951|ref|XP_233260.2| similar to Ubiquitin carboxyl-termi... 68 4e-10
gi|18257332|gb|AAH21769.1| Usp31 protein [Mus musculus] 68 4e-10
gi|26350927|dbj|BAC39100.1| unnamed protein product [Mus musculus] 67 5e-10
gi|586433|sp|P38187|UBPD_YEAST UBIQUITIN CARBOXYL-TERMINAL HYDRO... 67 5e-10
gi|50593116|ref|NP_009486.2| Putative ubiquitin-specific proteas... 67 7e-10
gi|31218597|ref|XP_316682.1| ENSANGP00000011299 [Anopheles gambi... 67 9e-10
gi|27696466|gb|AAH44045.1| Usp46-prov protein [Xenopus laevis] 67 9e-10
gi|32406120|ref|XP_323673.1| hypothetical protein [Neurospora cr... 67 9e-10
gi|11360229|pir||T46902 hypothetical protein DKFZp761E10121.1 - ... 66 1e-09
gi|13926071|gb|AAK49524.1| U4/U6.U5 tri-snRNP-associated 65 kDa ... 66 1e-09
gi|42655774|ref|XP_371254.2| similar to Ubiquitin carboxyl-termi... 66 1e-09
gi|14423979|sp|Q9UPU5|UB24_HUMAN Ubiquitin carboxyl-terminal hyd... 66 1e-09
gi|46137553|ref|XP_390468.1| hypothetical protein FG10292.1 [Gib... 66 2e-09
gi|37231574|gb|AAH58419.1| Usp22 protein [Mus musculus] 66 2e-09
gi|38078626|ref|XP_131566.5| RIKEN cDNA 2810030C21 [Mus musculus] 66 2e-09
gi|50729034|ref|XP_416398.1| PREDICTED: similar to Ubl carboxyl-... 66 2e-09
gi|14495683|gb|AAH09452.1| Similar to non-stop [Homo sapiens] 65 2e-09
gi|11360086|pir||T47183 hypothetical protein DKFZp434K1822.1 - h... 65 2e-09
gi|21740183|emb|CAD39104.1| hypothetical protein [Homo sapiens] 65 2e-09
gi|38105945|gb|EAA52310.1| hypothetical protein MG05002.4 [Magna... 65 3e-09
gi|34881851|ref|XP_219843.2| similar to Ubiquitin carboxyl-termi... 65 3e-09
gi|48100286|ref|XP_394990.1| similar to ENSANGP00000005611 [Apis... 65 3e-09
gi|47225945|emb|CAG04319.1| unnamed protein product [Tetraodon n... 65 4e-09
gi|6330433|dbj|BAA86517.1| KIAA1203 protein [Homo sapiens] 65 4e-09
gi|26337039|dbj|BAC32203.1| unnamed protein product [Mus musculus] 64 5e-09
gi|20070404|ref|NP_613058.1| ubiquitin specific protease 39; SnR... 64 5e-09
gi|26328829|dbj|BAC28153.1| unnamed protein product [Mus musculus] 64 5e-09
gi|22022542|gb|AAM83229.1| AT4g30890/F6I18_200 [Arabidopsis thal... 64 5e-09
gi|50285067|ref|XP_444962.1| unnamed protein product [Candida gl... 64 5e-09
gi|45595659|gb|AAH67273.1| Unknown (protein for MGC:75069) [Homo... 64 6e-09
gi|46122169|ref|XP_385638.1| hypothetical protein FG05462.1 [Gib... 64 6e-09
gi|37231483|gb|AAH01384.2| USP39 protein [Homo sapiens] 64 6e-09
gi|37747599|gb|AAH58994.1| Usp32 protein [Mus musculus] 64 6e-09
gi|30802104|gb|AAH51399.1| Usp32 protein [Mus musculus] 64 6e-09
gi|34533821|dbj|BAC86814.1| unnamed protein product [Homo sapiens] 64 8e-09
gi|50290115|ref|XP_447489.1| unnamed protein product [Candida gl... 64 8e-09
gi|48137641|ref|XP_396802.1| similar to ENSANGP00000009352 [Apis... 63 1e-08
gi|31235452|ref|XP_319246.1| ENSANGP00000006100 [Anopheles gambi... 63 1e-08
gi|5002593|emb|CAB44350.1| LSFR3A protein [Homo sapiens] 63 1e-08
gi|47213873|emb|CAF94023.1| unnamed protein product [Tetraodon n... 63 1e-08
gi|49068458|ref|XP_398518.1| hypothetical protein UM00903.1 [Ust... 62 2e-08
>gi|17566062|ref|NP_507514.1| ubiquitin specific protease 8 (5S413)
[Caenorhabditis elegans]
gi|11065657|emb|CAC14405.1| Hypothetical protein Y59A8B.2
[Caenorhabditis elegans]
Length = 357
Score = 729 bits (1882), Expect = 0.0
Identities = 357/357 (100%), Positives = 357/357 (100%)
Frame = +1
Query: 1 MDMAIHRVVDDSTRNKGRGVPGAVGLFNMGNTCFMSATLQCLFQTPGLAEVFTKKVFVSK 180
MDMAIHRVVDDSTRNKGRGVPGAVGLFNMGNTCFMSATLQCLFQTPGLAEVFTKKVFVSK
Sbjct: 1 MDMAIHRVVDDSTRNKGRGVPGAVGLFNMGNTCFMSATLQCLFQTPGLAEVFTKKVFVSK 60
Query: 181 VNTQSRLGSKGVISAGFASLSDMIWNGTFTAIRPSRFLQLFSDTVYQPLSDGRQHDASEF 360
VNTQSRLGSKGVISAGFASLSDMIWNGTFTAIRPSRFLQLFSDTVYQPLSDGRQHDASEF
Sbjct: 61 VNTQSRLGSKGVISAGFASLSDMIWNGTFTAIRPSRFLQLFSDTVYQPLSDGRQHDASEF 120
Query: 361 QIFLLDALHEDTNQAQRISFEQNYHGGAGIAKEAADFLKKHYQFSLSPVNRLLGSITVSE 540
QIFLLDALHEDTNQAQRISFEQNYHGGAGIAKEAADFLKKHYQFSLSPVNRLLGSITVSE
Sbjct: 121 QIFLLDALHEDTNQAQRISFEQNYHGGAGIAKEAADFLKKHYQFSLSPVNRLLGSITVSE 180
Query: 541 IRCLTCGASSATFEENTIISVEIPSNSSCSLDMCLRSHFSQTKLDGDSRWNCPKCKEPRA 720
IRCLTCGASSATFEENTIISVEIPSNSSCSLDMCLRSHFSQTKLDGDSRWNCPKCKEPRA
Sbjct: 181 IRCLTCGASSATFEENTIISVEIPSNSSCSLDMCLRSHFSQTKLDGDSRWNCPKCKEPRA 240
Query: 721 STRTSKLWQPPPVMIIHLKRFALFNGDFEKNTAAVTFETARFDVRPYLHEMAPAEKPVYK 900
STRTSKLWQPPPVMIIHLKRFALFNGDFEKNTAAVTFETARFDVRPYLHEMAPAEKPVYK
Sbjct: 241 STRTSKLWQPPPVMIIHLKRFALFNGDFEKNTAAVTFETARFDVRPYLHEMAPAEKPVYK 300
Query: 901 LYAATLHNGRLNSGHYTAVASHLRSDKWLRFDDSVVTPCENFKVDPSLAYILFYKRC 1071
LYAATLHNGRLNSGHYTAVASHLRSDKWLRFDDSVVTPCENFKVDPSLAYILFYKRC
Sbjct: 301 LYAATLHNGRLNSGHYTAVASHLRSDKWLRFDDSVVTPCENFKVDPSLAYILFYKRC 357