Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y5H2B_4
         (1551 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17565220|ref|NP_503598.1| family 4 cytochrome p450 (5C678) [C...  1052   0.0
gi|39588643|emb|CAE58167.1| Hypothetical protein CBG01258 [Caeno...   771   0.0
gi|32566219|ref|NP_505009.3| cytochrome p450 family member (5I26...   471   e-131
gi|39581112|emb|CAE73190.1| Hypothetical protein CBG20589 [Caeno...   457   e-127
gi|7496558|pir||T15644 probable cytochrome P450 C26F1.2 [similar...   446   e-124
gi|34555874|emb|CAB04044.2| Hypothetical protein F01D5.9 [Caenor...   398   e-109
gi|39591336|emb|CAE73389.1| Hypothetical protein CBG20829 [Caeno...   397   e-109
gi|17532879|ref|NP_496939.1| cytochrome p450 CYP4 family member ...   390   e-107
gi|39580246|emb|CAE69638.1| Hypothetical protein CBG15879 [Caeno...   388   e-106
gi|17560320|ref|NP_507109.1| cytochrome family member (59.6 kD) ...   382   e-104
gi|34527774|dbj|BAC85487.1| unnamed protein product [Homo sapien...   365   2e-99
gi|41146769|ref|XP_209612.3| similar to family 4 cytochrome P450...   363   6e-99
gi|46409338|ref|NP_997235.1| cytochrome P450, family 4, subfamil...   362   1e-98
gi|37538493|gb|AAQ93010.1| cytochrome P450 CYP4C39 [Carcinus mae...   360   7e-98
gi|19527190|ref|NP_598730.1| family 4 cytochrome P450; cytochrom...   356   7e-97
gi|38603630|dbj|BAD02915.1| Cytochrome P450 [Xenopus laevis]          354   4e-96
gi|49257971|gb|AAH74131.1| Unknown (protein for MGC:81840) [Xeno...   353   5e-96
gi|50746921|ref|XP_420677.1| PREDICTED: similar to family 4 cyto...   353   8e-96
gi|50657412|ref|NP_001001879.1| cytochrome P450, family 4, subfa...   352   1e-95
gi|231885|sp|P29981|CP4C_BLADI Cytochrome P450 4C1 (CYPIVC1) >gn...   345   1e-93
gi|47216297|emb|CAF96593.1| unnamed protein product [Tetraodon n...   334   3e-90
gi|31239209|ref|XP_320018.1| ENSANGP00000010492 [Anopheles gambi...   329   1e-88
gi|17864130|ref|NP_524598.1| CG1438-PA [Drosophila melanogaster]...   323   7e-87
gi|7522612|pir||JC7120 cytochrome P450 enzyme CYP4C15 - spinyche...   321   3e-86
gi|5230695|gb|AAD40966.1| cytochrome P450 4W1 [Boophilus microplus]   320   4e-86
gi|3249041|gb|AAC69184.1| corpora allata cytochrome P450 [Diplop...   319   1e-85
gi|31239211|ref|XP_320019.1| ENSANGP00000010494 [Anopheles gambi...   317   5e-85
gi|31239217|ref|XP_320022.1| ENSANGP00000010558 [Anopheles gambi...   316   8e-85
gi|39587668|emb|CAE58606.1| Hypothetical protein CBG01773 [Caeno...   314   4e-84
gi|18032259|gb|AAL56662.1| cytochrome P450 CYP4 [Cherax quadrica...   313   5e-84
gi|31203985|ref|XP_310941.1| ENSANGP00000019380 [Anopheles gambi...   308   2e-82
gi|34878473|ref|XP_341441.1| similar to family 4 cytochrome P450...   308   2e-82
gi|39580225|emb|CAE72981.1| Hypothetical protein CBG20323 [Caeno...   308   3e-82
gi|31205171|ref|XP_311534.1| ENSANGP00000010286 [Anopheles gambi...   308   3e-82
gi|50470807|emb|CAB60436.2| Hypothetical protein Y80D3A.5 [Caeno...   304   4e-81
gi|31207131|ref|XP_312532.1| ENSANGP00000014254 [Anopheles gambi...   299   1e-79
gi|31203983|ref|XP_310940.1| ENSANGP00000019301 [Anopheles gambi...   298   3e-79
gi|17557326|ref|NP_505490.1| predicted CDS, cytochrome family me...   296   1e-78
gi|17542994|ref|NP_500637.1| cytochrome P450 family member (4F52...   295   2e-78
gi|48104817|ref|XP_392979.1| similar to ENSANGP00000016970 [Apis...   294   3e-78
gi|32565768|ref|NP_502152.2| cytochrome P450 family member (4M16...   293   6e-78
gi|2431964|gb|AAB71182.1| cytochrome P450 [Drosophila simulans]       293   8e-78
gi|39586669|emb|CAE69389.1| Hypothetical protein CBG15509 [Caeno...   293   8e-78
gi|39594643|emb|CAE72221.1| Hypothetical protein CBG19332 [Caeno...   292   1e-77
gi|33621027|gb|AAF60505.2| Hypothetical protein Y38C9B.1 [Caenor...   292   1e-77
gi|39594642|emb|CAE72220.1| Hypothetical protein CBG19331 [Caeno...   292   1e-77
gi|12644424|sp|Q27589|C4D2_DROME Cytochrome P450 4d2 (CYPIVD2)        291   4e-77
gi|21552585|gb|AAM54722.1| cytochrome P450 monooxygenase CYP4M6 ...   291   4e-77
gi|2431938|gb|AAB71169.1| cytochrome P450 [Drosophila melanogast...   290   5e-77
gi|31207123|ref|XP_312528.1| ENSANGP00000014871 [Anopheles gambi...   290   8e-77
gi|39591971|emb|CAE75191.1| Hypothetical protein CBG23137 [Caeno...   290   8e-77
gi|17564386|ref|NP_505847.1| cytochrome p450 family member (57.2...   290   8e-77
gi|47605530|sp|Q964T1|C4CU_BLAGE Cytochrome P450 4c21 (CYPIVC21)...   289   1e-76
gi|17933518|ref|NP_525043.1| CG3466-PA [Drosophila melanogaster]...   288   2e-76
gi|2431960|gb|AAB71180.1| cytochrome P450 [Drosophila melanogast...   288   2e-76
gi|2894114|emb|CAA15698.1| EG:152A3.4 [Drosophila melanogaster]       288   2e-76
gi|33518703|gb|AAQ20834.1| p450 enzyme precursor [Rhodnius proli...   285   2e-75
gi|542555|pir||S41192 cytochrome P450 4D2 - fruit fly (Drosophil...   284   4e-75
gi|312904|emb|CAA80549.1| cytochrome P-450 [Drosophila melanogas...   284   5e-75
gi|7504831|pir||T21236 hypothetical protein H02I12.8 - Caenorhab...   283   6e-75
gi|17565440|ref|NP_503130.1| cytochrome family member (5A539) [C...   281   2e-74
gi|39594641|emb|CAE72219.1| Hypothetical protein CBG19330 [Caeno...   278   3e-73
gi|21552587|gb|AAM54723.1| cytochrome P450 monooxygenase CYP4M7 ...   276   1e-72
gi|31208535|ref|XP_313234.1| ENSANGP00000016970 [Anopheles gambi...   276   1e-72
gi|17511262|gb|AAF67724.2| insecticide resistance-associated cyt...   276   1e-72
gi|31221825|ref|XP_317095.1| ENSANGP00000019660 [Anopheles gambi...   274   5e-72
gi|31221842|ref|XP_317098.1| ENSANGP00000019496 [Anopheles gambi...   273   1e-71
gi|2997737|gb|AAC08589.1| cytochrome P-450 [Homo sapiens]             272   2e-71
gi|31204233|ref|XP_311065.1| ENSANGP00000008167 [Anopheles gambi...   272   2e-71
gi|45767658|gb|AAH67438.1| CYP4F2 protein [Homo sapiens]              271   4e-71
gi|45768599|gb|AAH67437.1| Cytochrome P450, family 4, subfamily ...   271   4e-71
gi|13435391|ref|NP_001073.3| cytochrome P450, family 4, subfamil...   271   4e-71
gi|4519535|dbj|BAA75823.1| Leukotriene B4 omega-hydroxylase [Hom...   271   4e-71
gi|45767661|gb|AAH67440.1| Cytochrome P450, family 4, subfamily ...   270   5e-71
gi|17566288|ref|NP_507688.1| cytochrome 450, possibly N-myristoy...   270   5e-71
gi|9652058|gb|AAF91384.1| P450 CYP319A1 [Boophilus microplus]         268   2e-70
gi|5263306|gb|AAC03111.2| family 4 cytochrome P450 [Coptotermes ...   268   2e-70
gi|24642101|ref|NP_573003.2| CG9081-PA [Drosophila melanogaster]...   268   3e-70
gi|31219919|ref|XP_316852.1| ENSANGP00000001916 [Anopheles gambi...   267   4e-70
gi|9313018|gb|AAC50052.2| cytochrome P450 4F2 [Homo sapiens]          267   6e-70
gi|17946332|gb|AAL49205.1| RE63964p [Drosophila melanogaster]         267   6e-70
gi|31221832|ref|XP_317096.1| ENSANGP00000019705 [Anopheles gambi...   266   1e-69
gi|20532035|sp|Q9HBI6|CPFB_HUMAN Cytochrome P450 4F11 (CYPIVF11)...   266   1e-69
gi|10863993|ref|NP_067010.1| cytochrome P450, family 4, subfamil...   265   2e-69
gi|18204711|gb|AAH21377.1| Cyp4f15 protein [Mus musculus]             265   2e-69
gi|27763613|gb|AAO20251.1| cytochrome P450 monooxygenase CYP4G19...   265   3e-69
gi|38082219|ref|XP_139867.3| similar to Cyp4f15 protein [Mus mus...   263   6e-69
gi|33150238|gb|AAP97090.1| cytochrome P450 CYP4AB1 [Solenopsis i...   263   6e-69
gi|24660171|ref|NP_523961.1| CG4321-PA [Drosophila melanogaster]...   263   8e-69
gi|28893407|ref|NP_796281.1| RIKEN cDNA 4732474A20 gene [Mus mus...   262   1e-68
gi|24639287|ref|NP_726797.1| CG3656-PB [Drosophila melanogaster]...   262   1e-68
gi|5921182|sp|P33269|C4D1_DROME Cytochrome P450 4d1 (CYPIVD1) >g...   262   1e-68
gi|11967965|ref|NP_071879.1| cytochrome P450, family 4, subfamil...   262   2e-68
gi|4503241|ref|NP_000887.1| cytochrome P450, family 4, subfamily...   262   2e-68
gi|6005737|ref|NP_009184.1| cytochrome P450, family 4, subfamily...   262   2e-68
gi|24181418|gb|AAL48300.1| cytochrome P450 CYP4L4 [Mamestra bras...   262   2e-68
gi|9665225|ref|NP_062569.1| cytochrome P450 4F1 [Rattus norvegic...   261   2e-68
gi|7862143|gb|AAF70496.1| cytochrome P450 monooxigenase CYP4Q7 [...   261   2e-68
gi|2431922|gb|AAB71161.1| cytochrome P450 [Drosophila melanogast...   261   2e-68
gi|27465575|ref|NP_775146.1| cytochrome P450 4F4 [Rattus norvegi...   261   3e-68
gi|5915806|sp|O16805|C4D1_DROSI Cytochrome P450 4d1 (CYPIVD1) >g...   261   4e-68
gi|20373165|ref|NP_598888.1| cytochrome P450 CYP4F15; cytochrome...   261   4e-68
gi|21355669|ref|NP_652020.1| CG3540-PA [Drosophila melanogaster]...   261   4e-68
gi|24639289|ref|NP_476907.2| CG3656-PA [Drosophila melanogaster]...   260   5e-68
gi|46854404|gb|AAH69351.1| Hypothetical protein FLJ39501 [Homo s...   260   7e-68
gi|33113212|gb|AAP94192.1| cytochrome P450 monooxygenase [Tribol...   259   2e-67
gi|37287641|gb|AAQ90477.1| cytochrome P450 CYP4AB2 [Solenopsis i...   258   2e-67
gi|7427570|pir||JE0361 cytochromes P450, CYP4T2 - European sea b...   258   2e-67
gi|3012097|gb|AAC11543.1| F22329_1 [Homo sapiens]                     258   2e-67
gi|20532036|sp|Q9HCS2|CPFC_HUMAN Cytochrome P450 4F12 (CYPIVF12)...   258   3e-67
gi|13184046|ref|NP_076433.1| cytochrome P450, family 4, subfamil...   258   3e-67
gi|23243430|gb|AAH35350.1| Cytochrome P450, family 4, subfamily ...   258   3e-67
gi|27735073|ref|NP_775754.1| hypothetical protein FLJ39501 [Homo...   258   3e-67
gi|33113213|gb|AAP94193.1| cytochrome P450 monooxygenase [Tribol...   258   4e-67
gi|2133619|pir||S66374 cytochrome P450 4M2 - tobacco hornworm >g...   256   8e-67
gi|31241555|ref|XP_321208.1| ENSANGP00000020095 [Anopheles gambi...   256   8e-67
gi|31204231|ref|XP_311064.1| ENSANGP00000019843 [Anopheles gambi...   255   2e-66
gi|7804914|gb|AAF70178.1| cytochrome P450 monooxigenase CYP4Q4 [...   255   2e-66
gi|5915807|sp|O18596|C4DA_DROMT Cytochrome P450 4d10 (CYPIVD10) ...   255   2e-66
gi|38603628|dbj|BAD02914.1| Cytochrome P450 [Xenopus laevis]          255   2e-66
gi|20373155|ref|NP_570952.1| cytochrome P450, family 4, subfamil...   254   3e-66
gi|17864382|ref|NP_524771.1| CG2062-PA [Drosophila melanogaster]...   253   7e-66
gi|13278244|gb|AAH03954.1| Cytochrome P450, family 4, subfamily ...   253   7e-66
gi|23463319|ref|NP_695230.1| cytochrome P450 4F6 [Rattus norvegi...   253   7e-66
gi|17647303|ref|NP_523527.1| CG4105-PA [Drosophila melanogaster]...   252   2e-65
gi|18079270|ref|NP_525044.1| CG10755-PA [Drosophila melanogaster...   252   2e-65
gi|283641|pir||S25707 cytochrome P450 4D1 - fruit fly (Drosophil...   251   4e-65
gi|24656064|ref|NP_647723.2| CG16761-PA [Drosophila melanogaster...   251   4e-65
gi|24181416|gb|AAL48299.1| cytochrome P450 CYP4S4 [Mamestra bras...   251   4e-65
gi|17945380|gb|AAL48745.1| RE17141p [Drosophila melanogaster]         250   6e-65
gi|13277364|ref|NP_077764.1| cytochrome P450 CYP4F18; cytochrome...   248   3e-64
gi|31211385|ref|XP_314662.1| ENSANGP00000020821 [Anopheles gambi...   248   3e-64
gi|25246586|gb|AAN72309.1| pulmonary cytochrome P450 4B2 [Capra ...   247   6e-64
gi|19920744|ref|NP_608918.1| CG14031-PA [Drosophila melanogaster...   246   8e-64
gi|40363539|ref|NP_954686.1| cytochrome P450, family 4 [Danio re...   246   8e-64
gi|24586583|ref|NP_477117.2| CG2060-PA [Drosophila melanogaster]...   246   1e-63
gi|6681123|ref|NP_031849.1| cytochrome P450, family 4, subfamily...   245   2e-63
gi|9963964|gb|AAG09778.1| prostaglandin omega-hydroxylase CYP4F2...   245   2e-63
gi|23397411|ref|NP_058695.2| cytochrome P450, subfamily 4B, poly...   245   2e-63
gi|38082161|ref|XP_139863.3| similar to Cytochrome P450 4F6 (CYP...   245   2e-63
gi|21739509|emb|CAD38795.1| hypothetical protein [Homo sapiens]       245   2e-63
gi|12841692|dbj|BAB25315.1| unnamed protein product [Mus musculus]    244   4e-63
gi|19920740|ref|NP_608916.1| CG14032-PA [Drosophila melanogaster...   243   7e-63
gi|117172|sp|P15128|CP4B_RABIT Cytochrome P450 4B1 (CYPIVB1) (P4...   242   2e-62
gi|50603957|gb|AAH77479.1| Unknown (protein for MGC:82514) [Xeno...   241   4e-62
gi|5915808|sp|O44221|C4E5_DROMT Cytochrome P450 4e5, mitochondri...   238   2e-61
gi|2133647|pir||JC5236 cytochrome P450, Cyp4e2 - fruit fly (Dros...   238   3e-61
gi|13277362|ref|NP_077762.1| cytochrome P450, family 4, subfamil...   238   3e-61
gi|13811435|gb|AAK40120.1| cytochrome P450 CYP4G13v2 [Musca dome...   234   4e-60
gi|31203987|ref|XP_310942.1| ENSANGP00000019336 [Anopheles gambi...   233   9e-60
gi|27465577|ref|NP_775147.1| cytochrome P450 4F5 [Rattus norvegi...   233   9e-60
gi|17933498|ref|NP_525031.1| CG3972-PA [Drosophila melanogaster]...   233   1e-59
gi|6063485|dbj|BAA85387.1| cytochrome P450 XL-304 [Xenopus laevis]    233   1e-59
gi|4503237|ref|NP_000770.1| cytochrome P450, family 4, subfamily...   232   2e-59
gi|34862810|ref|XP_234837.2| similar to RIKEN cDNA 4732474A20 ge...   232   2e-59
gi|48429213|sp|P13584|CP4B_HUMAN Cytochrome P450 4B1 (CYPIVB1) (...   231   3e-59
gi|20067171|gb|AAM09532.1| cytochrome P450 [Homo sapiens]             231   3e-59
gi|18086502|gb|AAL57720.1| cytochrome P450 [Homo sapiens]             230   8e-59
gi|18086504|gb|AAL57721.1| cytochrome P450 [Homo sapiens]             230   8e-59
gi|17389424|gb|AAH17758.1| Cytochrome P450, family 4, subfamily ...   229   1e-58
gi|12044053|gb|AAG47670.1| cytochrome P450 4F5 [Rattus norvegicus]    228   3e-58
gi|31207133|ref|XP_312533.1| ENSANGP00000023100 [Anopheles gambi...   225   2e-57
gi|17864466|ref|NP_524828.1| CG10842-PA [Drosophila melanogaster...   224   4e-57
gi|19921894|ref|NP_610473.1| CG10843-PA [Drosophila melanogaster...   223   1e-56
gi|31215799|ref|XP_316099.1| ENSANGP00000012521 [Anopheles gambi...   222   2e-56
gi|31207139|ref|XP_312536.1| ENSANGP00000023930 [Anopheles gambi...   221   3e-56
gi|46318073|gb|AAS87604.1| cytochrome P450 CYP4AT1 [Capitella ca...   221   4e-56
gi|117164|sp|P20816|CP42_RAT Cytochrome P450 4A2 precursor (CYPI...   220   6e-56
gi|6063487|dbj|BAA85388.1| cytochrome P450 XL-301 [Xenopus laevis]    220   6e-56
gi|24582534|ref|NP_609129.2| CG6730-PA [Drosophila melanogaster]...   219   1e-55
gi|15291527|gb|AAK93032.1| GH25251p [Drosophila melanogaster]         219   1e-55
gi|25246673|gb|AAN72312.1| pulmonary cytochrome P450 4B1 variant...   218   3e-55
gi|25246608|gb|AAN72310.1| pulmonary cytochrome P450 4B2 variant...   218   4e-55
gi|31207137|ref|XP_312535.1| ENSANGP00000014806 [Anopheles gambi...   218   4e-55
gi|28461155|ref|NP_786936.1| cytochrome P450, family 4, subfamil...   217   5e-55
gi|19921892|ref|NP_610472.1| CG1944-PA [Drosophila melanogaster]...   216   2e-54
gi|28460698|ref|NP_787031.1| cytochrome P450, 4A1; lauric acid o...   216   2e-54
gi|27462772|gb|AAO15579.1| cytochrome P450 CYP4A15 protein [Phas...   215   2e-54
gi|46048525|ref|NP_695219.1| cytochrome P450, 4a10 [Rattus norve...   214   5e-54
gi|1362601|pir||S57646 cytochrome P450 - fruit fly (Drosophila m...   214   5e-54
gi|28912921|ref|NP_803125.1| similar to cytochrome P450, 4a10; s...   213   8e-54
gi|24653964|ref|NP_611067.1| CG8302-PA [Drosophila melanogaster]...   212   2e-53
gi|31207135|ref|XP_312534.1| ENSANGP00000014843 [Anopheles gambi...   211   3e-53
gi|4503235|ref|NP_000769.1| cytochrome P450, family 4, subfamily...   211   3e-53
gi|20338995|emb|CAC85662.1| cytochrome P450 [Sus scrofa]              211   5e-53
gi|27464419|gb|AAO16078.1| cytochrome P450, subfamily IVA, polyp...   210   7e-53
gi|2493371|sp|Q02928|CP4Y_HUMAN Cytochrome P450 4A11 precursor (...   210   7e-53
gi|47523902|ref|NP_999589.1| cytochrome P450 4A24; cytochrome P4...   210   9e-53
gi|6681121|ref|NP_031848.1| cytochrome P450, family 4, subfamily...   209   1e-52
gi|20338997|emb|CAC85663.1| cytochrome P450 [Sus scrofa]              208   2e-52
gi|50751560|ref|XP_422455.1| PREDICTED: similar to cytochrome P4...   208   3e-52
gi|2117372|pir||I65981 fatty acid omega-hydroxylase (EC 1.14.15....   207   4e-52
gi|31208803|ref|XP_313368.1| ENSANGP00000011391 [Anopheles gambi...   207   6e-52
gi|11527090|gb|AAG36879.1| cytochrome P450-4A15 [Phascolarctos c...   207   7e-52
gi|27819673|ref|NP_758510.1| cytochrome P450, family 4, subfamil...   207   7e-52
gi|2117369|pir||A29368 prostaglandin omega-hydroxylase (EC 1.14....   207   7e-52
gi|50403715|sp|P10611|CP44_RABIT Cytochrome P450 4A4 precursor (...   207   7e-52
gi|164981|gb|AAA31232.1| cytochrome P-450p-2                          207   7e-52
gi|535787|dbj|BAA02864.1| fatty acid omega-hydroxylase [Homo sap...   205   2e-51
gi|33521212|gb|AAQ21368.1| cytochrome P450 4A22 [Homo sapiens]        205   2e-51
gi|17538370|ref|NP_501586.1| cytochrome P450 (ccp-31A1) [Caenorh...   205   3e-51
gi|20841398|ref|XP_131557.1| similar to CYTOCHROME P450 4A8 (CYP...   205   3e-51
gi|117169|sp|P14581|CP47_RABIT Cytochrome P450 4A7 precursor (CY...   204   4e-51
gi|32329246|gb|AAP74753.1| cytochrome P450 [Culex pipiens pallens]    204   4e-51
gi|117168|sp|P14580|CP46_RABIT Cytochrome P450 4A6 precursor (CY...   204   6e-51
gi|24581898|ref|NP_608917.2| CG17970-PA [Drosophila melanogaster...   204   6e-51
gi|13928828|ref|NP_113793.1| cytochrome P450, 4a10 [Rattus norve...   203   8e-51
gi|89991|pir||A34160 laurate omega-hydroxylase (EC 1.14.15.3) cy...   203   8e-51
gi|41151107|ref|XP_371145.1| similar to Cytochrome P450 4F12 (CY...   203   8e-51
gi|89992|pir||B34160 cytochrome P450 4A7 - rabbit >gnl|BL_ORD_ID...   202   1e-50
gi|4894622|gb|AAD32564.1| cytochrome P450 [Dicentrarchus labrax]      202   2e-50
gi|28500134|ref|XP_289695.1| similar to cytochrome P450 4X1 [Mus...   202   2e-50
gi|26332621|dbj|BAC30028.1| unnamed protein product [Mus musculus]    202   2e-50
gi|38511987|gb|AAH60945.1| Cytochrome P450, family 4, subfamily ...   201   3e-50
gi|33521210|gb|AAQ21367.1| cytochrome P450 4A22K [Homo sapiens]       201   3e-50
gi|47523904|ref|NP_999590.1| cytochrome P450 4A21; taurochenodeo...   201   4e-50
gi|29837648|ref|NP_828847.1| cytochrome P450, family 4, subfamil...   201   5e-50
gi|40781678|emb|CAE52532.1| taurochenodeoxycholic acid 6 alpha-h...   201   5e-50
gi|1083277|pir||S47553 cytochrome P450 Cyp4a - mouse                  200   7e-50
gi|12832576|dbj|BAB22165.1| unnamed protein product [Mus musculus]    200   9e-50
gi|47059035|ref|NP_034141.2| cytochrome P450, family 4, subfamil...   200   9e-50
gi|30023836|ref|NP_835235.1| cytochrome P450 4Z1 [Homo sapiens] ...   199   1e-49
gi|21750264|dbj|BAC03751.1| unnamed protein product [Homo sapiens]    199   2e-49
gi|47077173|dbj|BAD18508.1| unnamed protein product [Homo sapiens]    199   2e-49
gi|1656|emb|CAA40493.1| omega-hydroxylase cytochrome P-450 [Oryc...   199   2e-49
gi|89989|pir||A34260 laurate omega-hydroxylase (EC 1.14.15.3) cy...   198   3e-49
gi|117167|sp|P14579|CP45_RABIT Cytochrome P450 4A5 precursor (CY...   197   4e-49
gi|31241545|ref|XP_321203.1| ENSANGP00000020233 [Anopheles gambi...   194   4e-48
gi|21358271|ref|NP_649030.1| CG5137-PA [Drosophila melanogaster]...   194   4e-48
gi|8571055|gb|AAF76722.1| fatty acid omega-hydroxylase CYP4A11 [...   193   8e-48
gi|41107433|ref|XP_208213.3| similar to fatty acid omega-hydroxy...   192   1e-47
gi|39587309|emb|CAE74963.1| Hypothetical protein CBG22854 [Caeno...   192   2e-47
gi|31198079|ref|XP_307987.1| ENSANGP00000013504 [Anopheles gambi...   191   3e-47
gi|21728402|ref|NP_663708.1| cytochrome P450 4X1 [Rattus norvegi...   191   5e-47
gi|25031786|ref|XP_204116.1| cytochrome P450, family 4, subfamil...   191   5e-47
gi|31198077|ref|XP_307986.1| ENSANGP00000013480 [Anopheles gambi...   187   5e-46
gi|19921820|ref|NP_610380.1| CG2110-PA [Drosophila melanogaster]...   187   6e-46
gi|18860031|ref|NP_572721.1| CG11715-PA [Drosophila melanogaster...   187   8e-46
gi|24641309|ref|NP_727531.1| CG11715-PB [Drosophila melanogaster...   187   8e-46
gi|31198081|ref|XP_307988.1| ENSANGP00000006300 [Anopheles gambi...   186   1e-45
gi|8570639|gb|AAF76522.1| cytochrome P450-4g15 [Drosophila melan...   186   2e-45
gi|27552845|gb|AAH41158.1| CYP4A11 protein [Homo sapiens]             183   9e-45
gi|40781680|emb|CAE52533.1| fatty acid hydroxylase [Sus scrofa]       182   2e-44
gi|31197337|ref|XP_307616.1| ENSANGP00000002214 [Anopheles gambi...   182   2e-44
gi|34870147|ref|XP_213039.2| hypothetical protein XP_213039 [Rat...   177   6e-43
gi|38078702|ref|XP_144013.4| similar to cytochrome P450, family ...   173   1e-41
gi|303603|dbj|BAA02145.1| cytochrome P-450LTBV [Homo sapiens]         172   2e-41
gi|47027882|gb|AAT08964.1| cytochrome P450 [Helicoverpa armigera]     168   3e-40
gi|47027880|gb|AAT08963.1| cytochrome P450 [Helicoverpa armigera]     168   4e-40
gi|31198217|ref|XP_308056.1| ENSANGP00000019398 [Anopheles gambi...   167   6e-40
gi|2323337|gb|AAB66556.1| cytochrome P450 30 [Mercenaria mercena...   167   8e-40
gi|28571357|ref|NP_572780.3| CG1488-PB [Drosophila melanogaster]...   166   1e-39
gi|31198057|ref|XP_307976.1| ENSANGP00000024695 [Anopheles gambi...   166   1e-39
gi|24646221|ref|NP_650170.2| CG10093-PA [Drosophila melanogaster...   163   1e-38
gi|24641483|ref|NP_727589.1| CG1488-PA [Drosophila melanogaster]...   162   2e-38
gi|28573027|ref|NP_650224.2| CG6802-PA [Drosophila melanogaster]...   162   2e-38
gi|31232755|ref|XP_318754.1| ENSANGP00000004678 [Anopheles gambi...   161   3e-38
gi|15219831|ref|NP_176882.1| cytochrome P450, putative [Arabidop...   160   6e-38
gi|31198049|ref|XP_307972.1| ENSANGP00000006206 [Anopheles gambi...   160   1e-37
gi|20151799|gb|AAM11259.1| RH12404p [Drosophila melanogaster]         160   1e-37
gi|45511529|gb|AAS67285.1| cytochrome P450 CYP4 [Helicoverpa arm...   160   1e-37
gi|31198053|ref|XP_307974.1| ENSANGP00000022821 [Anopheles gambi...   160   1e-37
gi|48106860|ref|XP_396171.1| similar to Probable cytochrome P450...   159   1e-37
gi|24646219|ref|NP_650169.2| CG10094-PA [Drosophila melanogaster...   159   2e-37
gi|16182562|gb|AAL13523.1| GH05567p [Drosophila melanogaster]         158   3e-37
gi|5921910|sp|Q64148|CP3A_MESAU Cytochrome P450 3A10 (CYPIIIA10)...   158   4e-37
gi|13810562|dbj|BAB43954.1| cytochrome P450 [Musca domestica]         157   5e-37
gi|31198051|ref|XP_307973.1| ENSANGP00000013470 [Anopheles gambi...   157   9e-37
gi|18139595|gb|AAL58564.1| cytochrome P450 CYP4C25 [Anopheles ga...   156   1e-36
gi|5231176|gb|AAD41104.1| cytochrome P450 [Culex pipiens pallens]     154   4e-36
gi|46559416|ref|NP_964002.1| similar to cytochrome P450 4A1 [Mus...   154   6e-36
gi|18139599|gb|AAL58566.1| cytochrome P450 CYP4C26 [Anopheles ga...   154   7e-36
gi|3452331|gb|AAC32831.1| cytochrome p450 CYP4C20 [Lytechinus an...   154   7e-36
gi|5921915|sp|Q64409|CP3H_CAVPO Cytochrome P450 3A17 (CYPIIIA17)...   154   7e-36
gi|23128957|ref|ZP_00110793.1| COG2124: Cytochrome P450 [Nostoc ...   153   9e-36
gi|6681115|ref|NP_031845.1| cytochrome P450, family 3, subfamily...   152   2e-35
gi|308944|gb|AAA29293.1| CYP6A1 protein >gnl|BL_ORD_ID|1194922 g...   151   4e-35
gi|47027884|gb|AAT08965.1| cytochrome P450 [Helicoverpa armigera]     151   4e-35
gi|602475|gb|AAA57305.1| cytochrome P450                              151   5e-35
gi|15240917|ref|NP_198661.1| cytochrome P450 family protein [Ara...   151   5e-35
gi|6166035|sp|Q64417|CP3E_CAVPO Cytochrome P450 3A14 (CYPIIIA14)...   150   6e-35
gi|47027894|gb|AAT08970.1| cytochrome P450 [Helicoverpa armigera]     150   8e-35
gi|47027888|gb|AAT08967.1| cytochrome P450 [Helicoverpa armigera]     149   1e-34
gi|2493370|sp|Q29496|CP3O_SHEEP Cytochrome P450 3A24 (CYPIIIA24)...   149   2e-34
gi|21805645|gb|AAL66770.1| cytochrome P450 monooxygenase CYP72A5...   149   2e-34
gi|25901060|gb|AAN75700.1| cytochrome P450 [Bactrocera papayae]       149   2e-34
gi|47027886|gb|AAT08966.1| cytochrome P450 [Helicoverpa armigera]     149   2e-34
gi|34912894|ref|NP_917794.1| putative cytochrome P450 [Oryza sat...   149   2e-34
gi|6681113|ref|NP_031844.1| cytochrome P450, family 3, subfamily...   149   2e-34
gi|38051863|gb|AAH60496.1| MGC68821 protein [Xenopus laevis]          149   2e-34
gi|19909879|dbj|BAB87118.1| cytochrome P450 [Oryza sativa]            149   2e-34
gi|117162|sp|P24463|CP3C_CANFA Cytochrome P450 3A12 (CYPIIIA12) ...   149   2e-34
gi|303570|dbj|BAA03865.1| cytochrome P450 [Cavia porcellus]           149   2e-34
gi|45387645|ref|NP_991172.1| thromboxane A synthase 1 [Danio rer...   148   3e-34
gi|47027896|gb|AAT08971.1| cytochrome P450 [Helicoverpa armigera]     148   4e-34
gi|12082809|gb|AAG48618.1| cytochrome P450 variant 3A7 [Homo sap...   148   4e-34
gi|4503233|ref|NP_000756.1| cytochrome P450, family 3, subfamily...   148   4e-34
gi|3372841|gb|AAC28351.1| cytochrome P450 [Homarus americanus]        147   7e-34
gi|34912380|ref|NP_917537.1| putative cytochrome P450 [Oryza sat...   147   7e-34
gi|33469131|ref|NP_062766.1| cytochrome P450, family 3, subfamil...   147   7e-34
gi|6466837|gb|AAF13053.1| cytochrome P450 [Helicoverpa armigera]      147   7e-34
gi|15231906|ref|NP_188086.1| cytochrome P450, putative [Arabidop...   147   7e-34
gi|34912896|ref|NP_917795.1| putative cytochrome P450 [Oryza sat...   147   7e-34
gi|5921918|sp|O09158|CP3P_MOUSE Cytochrome P450 3A25 (CYPIIIA25)...   147   9e-34
gi|5921913|sp|Q64406|CP3F_CAVPO Cytochrome P450 3A15 (CYPIIIA15)...   147   9e-34
gi|5921922|sp|O70537|CP3V_MESAU Cytochrome P450 3A31 (CYPIIIA31)...   147   9e-34
gi|4927317|gb|AAD33080.1| cytochrome p450 [Helicoverpa armigera]      147   9e-34
gi|9739175|gb|AAF97937.1| cytochrome P450 CYP6N3v2 [Aedes albopi...   146   1e-33
gi|117184|sp|P13527|C6A1_MUSDO Cytochrome P450 6A1 (CYPVIA1) >gn...   146   1e-33
gi|6166034|sp|P11707|CP36_RABIT Cytochrome P450 3A6 (CYPIIIA6) (...   146   2e-33
gi|47606856|gb|AAT36349.1| cytochrome P450 CYP4 [Helicoverpa arm...   146   2e-33
gi|9294386|dbj|BAB02396.1| cytochrome P450 [Arabidopsis thaliana]     145   2e-33
gi|13661766|gb|AAK38090.1| putative cytochrome P450 [Lolium rigi...   145   2e-33
gi|510086|gb|AAA35747.1| cytochrome P450 nifedipine oxidase           145   2e-33
gi|21805634|gb|AAL60592.1| cytochrome P450 monooxygenase CYP72A2...   145   3e-33
gi|31043863|emb|CAD91645.1| cytochrome P450 [Homo sapiens]            145   3e-33
gi|5921919|sp|O42563|CP3R_ONCMY Cytochrome P450 3A27 (CYPIIIA27)...   145   3e-33
gi|3913302|sp|O18993|CP3L_CALJA Cytochrome P450 3A21 (CYPIIIA21)...   145   3e-33
gi|30840237|emb|CAD91343.1| cytochrome P450 [Homo sapiens]            145   3e-33
gi|13435386|ref|NP_059488.2| cytochrome P450, subfamily IIIA, po...   145   3e-33
gi|49900541|gb|AAH76033.1| Unknown (protein for IMAGE:7046264) [...   145   3e-33
gi|38079189|ref|XP_289715.2| similar to cytochrome P450, family ...   145   3e-33
gi|47606854|gb|AAT36348.1| cytochrome P450 CYP4 [Helicoverpa arm...   145   3e-33
gi|13661772|gb|AAK38093.1| putative cytochrome P450 [Lolium rigi...   145   3e-33
gi|13661774|gb|AAK38094.1| putative cytochrome P450 [Lolium rigi...   145   3e-33
gi|9739173|gb|AAF97936.1| cytochrome P450 CYP6N3v1 [Aedes albopi...   144   4e-33
gi|46394978|gb|AAS91645.1| cytochrome P450 3A64 variant 1; CYP3A...   144   4e-33
gi|21355711|ref|NP_651082.1| CG12800-PA [Drosophila melanogaster...   144   4e-33
gi|3452343|gb|AAC32833.1| cytochrome p450 CYP4C17 [Haliotis rufe...   144   4e-33
gi|49066337|gb|AAT49270.1| cytochrome P450 CYP3A66 [Macaca mulatta]   144   6e-33
gi|15231899|ref|NP_188082.1| cytochrome P450, putative [Arabidop...   144   7e-33
gi|3452333|gb|AAC32832.1| cytochrome p450 CYP4C18 [Homarus ameri...   144   7e-33
gi|4927311|gb|AAD33077.1| cytochrome p450 [Helicoverpa armigera]      143   1e-32
gi|50755533|ref|XP_414783.1| PREDICTED: cytochrome P450 A 37 [Ga...   143   1e-32
gi|48976101|ref|NP_001001751.1| cytochrome P450 A 37 [Gallus gal...   143   1e-32
gi|18139597|gb|AAL58565.1| cytochrome P450 CYP4C28 [Anopheles ga...   143   1e-32
gi|9739177|gb|AAF97938.1| cytochrome P450 CYP6N3v3 [Aedes albopi...   143   1e-32
gi|181372|gb|AAA35744.1| cytochrome P-450 nifedipine oxidase          143   1e-32
gi|40316434|dbj|BAD06180.1| cytochrome P450 [Sus scrofa domestica]    143   1e-32
gi|6470135|gb|AAF13598.1| cytochrome P450-3A4 [Homo sapiens]          143   1e-32
gi|47027892|gb|AAT08969.1| cytochrome P450 [Helicoverpa armigera]     143   1e-32
gi|34912880|ref|NP_917787.1| putative cytochrome P450 [Oryza sat...   143   1e-32
gi|117156|sp|P08684|CP34_HUMAN Cytochrome P450 3A4 (Quinine 3-mo...   143   1e-32
gi|34222534|sp|Q8AXY5|C356_FUNHE Cytochrome P450 3A56 (CYPIIIA56...   142   2e-32
gi|34223741|sp|Q9PVE8|C330_FUNHE Cytochrome P450 3A30 (CYPIIIA30...   142   2e-32
gi|461808|sp|P33268|CP38_MACFA Cytochrome P450 3A8 (CYPIIIA8) (P...   142   2e-32
gi|24898925|dbj|BAC23085.1| cytochrome P450 3A [Rattus norvegicus]    142   2e-32
gi|41053473|ref|NP_956773.1| hypothetical protein MGC63667 [Dani...   142   2e-32
gi|31223022|ref|XP_317253.1| ENSANGP00000023573 [Anopheles gambi...   142   2e-32
gi|18139567|gb|AAL58550.1| cytochrome P450 CYP4G16 [Anopheles ga...   142   2e-32
gi|50755531|ref|XP_414782.1| PREDICTED: similar to MGC68821 prot...   142   2e-32
gi|18139571|gb|AAL58552.1| cytochrome P450 CYP4H16 [Anopheles ga...   142   3e-32
gi|1699021|gb|AAB37340.1| cytochrome P450 monooxygenase [Ceratit...   142   3e-32
gi|50748684|ref|XP_421360.1| PREDICTED: similar to MGC64404 prot...   142   3e-32
gi|47027898|gb|AAT08972.1| cytochrome P450 [Helicoverpa armigera]     142   3e-32
gi|41055070|ref|NP_956755.1| hypothetical protein MGC63602 [Dani...   141   4e-32
gi|34912382|ref|NP_917538.1| putative cytochrome P450 [Oryza sat...   141   4e-32
gi|11464499|gb|AAG35209.1| cytochrome P450 3A [Oryzias latipes]       141   5e-32
gi|32450178|gb|AAH54222.1| MGC64404 protein [Xenopus laevis]          141   5e-32
gi|22219436|ref|NP_671739.1| cytochrome P450 3A9; olfactory cyto...   141   5e-32
gi|2506240|sp|P51538|CP39_RAT Cytochrome P450 3A9 (CYPIIIA9) (P4...   141   5e-32
gi|4927313|gb|AAD33078.1| cytochrome p450 [Helicoverpa armigera]      141   5e-32
gi|21842133|gb|AAM77716.1| cytochrome P450 monooxygenase CYP72A1...   141   5e-32
gi|13661768|gb|AAK38091.1| putative cytochrome P450 [Lolium rigi...   141   5e-32
gi|15789667|ref|NP_279491.1| cytochrome P450; Cyc [Halobacterium...   141   5e-32
gi|8393235|ref|NP_059092.1| cytochrome P450, family 3, subfamily...   140   6e-32
gi|18139577|gb|AAL58553.1| cytochrome P450 CYP4H17 [Anopheles ga...   140   6e-32
gi|13661770|gb|AAK38092.1| putative cytochrome P450 [Lolium rigi...   140   6e-32
gi|21263444|sp|Q98T91|C340_ORYLA Cytochrome P450 3A40 >gnl|BL_OR...   140   6e-32
gi|47523898|ref|NP_999587.1| cytochrome P450 3A39 [Sus scrofa] >...   140   1e-31
gi|3452329|gb|AAC32830.1| cytochrome p450 CYP4C19 [Lytechinus an...   139   1e-31
gi|31198055|ref|XP_307975.1| ENSANGP00000025098 [Anopheles gambi...   139   1e-31
gi|21355301|ref|NP_649807.1| CG9716-PA [Drosophila melanogaster]...   139   2e-31
gi|89987|pir||A29487 cytochrome P450 3A6 (version 1) - rabbit >g...   139   2e-31
gi|34895168|ref|NP_908909.1| putative cytochrome P450 [Oryza sat...   139   2e-31
gi|49256691|gb|AAH72702.1| Unknown (protein for IMAGE:7036636) [...   139   2e-31
gi|21842136|gb|AAM77717.1| cytochrome P450 monooxygenase CYP72A2...   139   2e-31
gi|6978749|ref|NP_037237.1| cytochrome P450, subfamily 3A, polyp...   139   2e-31
gi|6166033|sp|P05183|CP32_RAT Cytochrome P450 3A2 (CYPIIIA2) (P4...   139   2e-31
gi|515799|emb|CAA55887.1| unnamed protein product [Rattus norveg...   139   2e-31
gi|18139587|gb|AAL58560.1| cytochrome P450 CYP4H19 [Anopheles ga...   139   2e-31
gi|4503231|ref|NP_000768.1| cytochrome P450, family 3, subfamily...   138   3e-31
gi|27465619|ref|NP_775167.1| cytochrome P-450PCN (PNCN inducible...   138   3e-31
gi|56039|emb|CAA45743.1| cytochrome P450 PCN1 [Rattus norvegicus]     138   3e-31
gi|6681117|ref|NP_031846.1| cytochrome P450, family 3, subfamily...   138   3e-31
gi|34912916|ref|NP_917805.1| putative cytochrome P450 [Oryza sat...   138   3e-31
gi|4927315|gb|AAD33079.1| cytochrome p450 [Helicoverpa armigera]      138   4e-31
gi|5921920|sp|P79102|CP3S_BOVIN Cytochrome P450 3A28 (CYPIIIA28)...   138   4e-31
gi|24181973|gb|AAN47145.1| cytochrome P450 3A26 [Canis familiaris]    138   4e-31
gi|47207730|emb|CAF91666.1| unnamed protein product [Tetraodon n...   138   4e-31
gi|29027552|gb|AAO62002.1| cytochrome P450 CYPm3r9 [Anopheles ga...   137   5e-31
gi|21955148|ref|NP_665725.1| cytochrome P450, 3a18; P450(6)beta-...   137   5e-31
gi|15231907|ref|NP_188087.1| cytochrome P450, putative [Arabidop...   137   7e-31
gi|5911280|gb|AAD55732.1| cytochrome P450 [Musca domestica]           137   7e-31
gi|31196561|ref|XP_307228.1| ENSANGP00000024672 [Anopheles gambi...   137   7e-31
gi|18139605|gb|AAL58569.1| cytochrome P450 CYP6M1 [Anopheles gam...   137   7e-31
gi|15613142|ref|NP_241445.1| cytochrome P450 hydroxylase [Bacill...   137   9e-31
gi|47523900|ref|NP_999588.1| cytochrome P450 3A29 [Sus scrofa] >...   137   9e-31
gi|15231889|ref|NP_188079.1| cytochrome P450, putative [Arabidop...   137   9e-31
gi|117155|sp|P05184|CP33_HUMAN Cytochrome P450 3A3 (CYPIIIA3) (H...   136   1e-30
gi|3452346|gb|AAC32834.1| cytochrome p450 CYP4C16 [Litopenaeus s...   136   1e-30
gi|31223075|ref|XP_317260.1| ENSANGP00000023997 [Anopheles gambi...   136   2e-30
gi|28893549|ref|NP_796354.1| cytochrome P450, family 3, subfamil...   136   2e-30
gi|18139591|gb|AAL58562.1| cytochrome P450 CYP4H20 [Anopheles ga...   136   2e-30
gi|31207119|ref|XP_312526.1| ENSANGP00000023022 [Anopheles gambi...   136   2e-30
gi|15231903|ref|NP_188084.1| cytochrome P450, putative [Arabidop...   136   2e-30
gi|37528849|gb|AAQ92352.1| cytochrome P450 CYP3A43.3 [Homo sapiens]   135   2e-30
gi|220836|dbj|BAA03008.1| cytochrome P-450 [Rattus norvegicus] >...   135   2e-30
gi|31223067|ref|XP_317259.1| ENSANGP00000023972 [Anopheles gambi...   135   3e-30
gi|47605529|sp|Q964R1|C6J1_BLAGE Cytochrome P450 6j1 (CYPVIJ1) >...   135   3e-30
gi|31542329|ref|NP_695224.2| testosterone 6-beta-hydroxylase [Ra...   135   3e-30
gi|34898082|ref|NP_910387.1| ESTs AU056036(S20239),C72753(E2173)...   135   3e-30
gi|16033755|gb|AAL13316.1| cytochrome P450 3A [Sus scrofa]            135   3e-30
gi|31207127|ref|XP_312530.1| ENSANGP00000024957 [Anopheles gambi...   135   3e-30
gi|18139593|gb|AAL58563.1| cytochrome P450 CYP4H14 [Anopheles ga...   135   3e-30
gi|6705973|dbj|BAA89459.1| pBS4A5 [Mus musculus]                      135   3e-30
gi|21842139|gb|AAM77718.1| cytochrome P450 monooxygenase CYP72A2...   135   3e-30
gi|5729796|ref|NP_006659.1| cytochrome P450, family 46; cytochro...   135   3e-30
gi|16933533|ref|NP_476436.1| cytochrome P450, family 3, subfamil...   135   3e-30
gi|33563183|emb|CAD88280.1| cytochrome P450 4A18 [Mesocricetus a...   134   5e-30
gi|49328133|gb|AAT58831.1| putative cytochrome P450 [Oryza sativ...   134   5e-30
gi|31242513|ref|XP_321687.1| ENSANGP00000009680 [Anopheles gambi...   134   5e-30
gi|18139583|gb|AAL58558.1| cytochrome P450 CYP4C27 [Anopheles ga...   134   6e-30
gi|17550998|ref|NP_509959.1| cytochrome 450 family member (XM328...   134   6e-30
gi|18139589|gb|AAL58561.1| cytochrome P450 CYP4G17 [Anopheles ga...   134   8e-30
gi|34912888|ref|NP_917791.1| putative cytochrome P450 [Oryza sat...   134   8e-30
gi|5353758|gb|AAD42232.1| cytochrome P450 [Culex pipiens pallens]     134   8e-30
gi|47605531|sp|Q964T2|C9E2_BLAGE Cytochrome P450 9e2 (CYPIXE2) >...   133   1e-29
gi|21430756|gb|AAM51056.1| SD12535p [Drosophila melanogaster]         133   1e-29
gi|15225777|ref|NP_180239.1| cytochrome P450, putative [Arabidop...   133   1e-29
gi|31223044|ref|XP_317256.1| ENSANGP00000021816 [Anopheles gambi...   132   2e-29
gi|29027554|gb|AAO62003.1| cytochrome P450 CYPm3r10 [Anopheles g...   132   2e-29
gi|30683137|ref|NP_193247.2| cytochrome P450 97B3, putative (CYP...   132   2e-29
gi|7427576|pir||H71414 probable cytochrome P450 - Arabidopsis th...   132   2e-29
gi|21357003|ref|NP_650168.1| CG15807-PA [Drosophila melanogaster...   132   2e-29
gi|494997|gb|AAA82161.1| cytochrome P450                              132   3e-29
gi|15888887|ref|NP_354568.1| AGR_C_2890p [Agrobacterium tumefaci...   132   3e-29
gi|14279354|gb|AAK58569.1| cytochrome P450 3A45 [Oncorhynchus my...   132   3e-29
gi|19921824|ref|NP_610390.1| CG2397-PA [Drosophila melanogaster]...   131   5e-29
gi|47218190|emb|CAF97054.1| unnamed protein product [Tetraodon n...   131   5e-29
gi|31223014|ref|XP_317252.1| ENSANGP00000006812 [Anopheles gambi...   130   7e-29
gi|12644426|sp|Q27594|C6A9_DROME Cytochrome P450 6a9 (CYPVIA9)        130   7e-29
gi|15231895|ref|NP_188080.1| cytochrome P450, putative [Arabidop...   130   7e-29
gi|17386114|gb|AAL38603.1| AT3g14620/MIE1_12 [Arabidopsis thaliana]   130   7e-29
gi|24653741|ref|NP_523748.1| CG10246-PA [Drosophila melanogaster...   130   7e-29
gi|40949987|gb|AAR97606.1| cytochrome P450 9E1 [Diploptera punct...   130   7e-29
gi|18139569|gb|AAL58551.1| cytochrome P450 CYP4H15 [Anopheles ga...   130   9e-29
gi|12383060|ref|NP_073731.1| cytochrome P450, family 3, subfamil...   130   9e-29
gi|17944521|gb|AAL48149.1| RH16046p [Drosophila melanogaster]         130   9e-29
gi|24653745|ref|NP_611003.2| CG10247-PA [Drosophila melanogaster...   130   9e-29
gi|47225806|emb|CAF98286.1| unnamed protein product [Tetraodon n...   130   1e-28
gi|6753590|ref|NP_034140.1| cytochrome P450, family 46, subfamil...   130   1e-28
gi|34912882|ref|NP_917788.1| putative cytochrome P450 [Oryza sat...   129   1e-28
gi|19744809|gb|AAL96667.1| cytochrome P450 CYP6Z2 protein [Anoph...   129   2e-28
gi|31201489|ref|XP_309692.1| ENSANGP00000012682 [Anopheles gambi...   129   2e-28
gi|31201491|ref|XP_309693.1| ENSANGP00000012679 [Anopheles gambi...   129   2e-28
gi|1049015|gb|AAC46931.1| pyrethroid resistance cytochrome P450 ...   129   2e-28
gi|47605405|sp|Q27698|C6D1_MUSDO Cytochrome P450 6d1 (CYPVID1) (...   129   2e-28
gi|31223089|ref|XP_317262.1| ENSANGP00000024998 [Anopheles gambi...   129   2e-28
gi|47218191|emb|CAF97055.1| unnamed protein product [Tetraodon n...   128   3e-28
gi|46440448|gb|EAK99754.1| hypothetical protein CaO19.7512 [Cand...   128   3e-28
gi|34910814|ref|NP_916754.1| putative cytochrome P450 [Oryza sat...   128   3e-28
gi|34912892|ref|NP_917793.1| putative cytochrome P450 [Oryza sat...   128   3e-28
gi|48103912|ref|XP_395671.1| similar to ENSANGP00000023972 [Apis...   128   3e-28
gi|19702552|gb|AAL93296.1| cytochrome P450 CYP6Z1 [Anopheles gam...   128   4e-28
gi|15234248|ref|NP_194501.1| cytochrome P450 family protein [Ara...   128   4e-28
gi|687263|gb|AAA81513.1| cytochrome P450 [Musca domestica] >gnl|...   128   4e-28
gi|31196581|ref|XP_307238.1| ENSANGP00000022815 [Anopheles gambi...   128   4e-28
gi|7430705|pir||T16980 probable cytochrome P-450 - curled-leaved...   128   4e-28
gi|4808849|gb|AAD29968.1| cytochrome P450 [Blattella germanica]       128   4e-28
gi|160766|gb|AAA29790.1| CYP6B1 >gnl|BL_ORD_ID|1740253 gi|742798...   128   4e-28
gi|1079013|pir||S48058 cytochrome P450 CYP6B1 - black swallowtai...   128   4e-28
gi|31223081|ref|XP_317261.1| ENSANGP00000022010 [Anopheles gambi...   127   6e-28
gi|29027550|gb|AAO62001.1| cytochrome P450 CYPm3r5 [Anopheles ga...   127   6e-28
gi|47605549|sp|Q9GQM9|C6L1_BLAGE Cytochrome P450 6l1 (CYPVIL1) >...   127   6e-28
gi|18139575|gb|AAL58555.1| cytochrome P450 CYP4D16 [Anopheles ga...   127   7e-28
gi|18139585|gb|AAL58559.1| cytochrome P450 CYP4J5 [Anopheles gam...   127   7e-28
gi|416831|sp|Q04552|C6B1_PAPPO Cytochrome P450 6B1 (CYPVIB1) (CY...   127   7e-28
gi|29831654|ref|NP_826288.1| putative cytochrome P450 [Streptomy...   127   9e-28
gi|4894424|gb|AAD32478.1| cytochrome P450 [Musca domestica]           127   9e-28
gi|50261642|gb|AAT72405.1| cytochrome P450 [Culex pipiens pallens]    127   9e-28
gi|7024447|dbj|BAA92152.1| cytochrome P450 [Culex pipiens quinqu...   127   9e-28
gi|40646732|gb|AAR88242.1| CYP4-2 [Nereis virens]                     126   1e-27
gi|48098075|ref|XP_392001.1| similar to cytochrome P450 [Apis me...   126   1e-27
gi|17543882|ref|NP_502584.1| cytochrome P450 family member (4O16...   126   1e-27
gi|7430700|pir||PC4428 cytochrome P450 4C8 - termite (Mastoterme...   126   2e-27
gi|31196563|ref|XP_307229.1| ENSANGP00000025224 [Anopheles gambi...   126   2e-27
gi|1049013|gb|AAC46930.1| pyrethroid resistance cytochrome P450 ...   126   2e-27
gi|31196577|ref|XP_307236.1| ENSANGP00000015257 [Anopheles gambi...   126   2e-27
gi|30840241|emb|CAD91345.1| cytochrome P450 [Homo sapiens]            126   2e-27
gi|17946368|gb|AAL49218.1| RE65105p [Drosophila melanogaster]         125   2e-27
gi|9801565|gb|AAF97941.2| cytochrome P450 CYP6N3v4 [Aedes albopi...   125   2e-27
gi|1513174|gb|AAB06741.1| furnocoumarin-inducible cytochrome P45...   125   2e-27
gi|34867770|ref|XP_343109.1| similar to cholesterol 24-hydroxyla...   125   3e-27
gi|7488960|pir||T10000 cytochrome P450 (CYP72C) - Madagascar per...   125   3e-27
gi|6063109|gb|AAF03137.1| cytochrome P450 [Helicoverpa armigera]      125   3e-27
gi|41407442|ref|NP_960278.1| hypothetical protein MAP1344 [Mycob...   125   3e-27
gi|31207129|ref|XP_312531.1| ENSANGP00000024630 [Anopheles gambi...   125   4e-27
gi|33563185|emb|CAD88281.1| cytochrome P450 4A19 [Mesocricetus a...   125   4e-27
gi|40646730|gb|AAR88241.1| CYP4-1 [Nereis virens]                     125   4e-27


>gi|17565220|ref|NP_503598.1| family 4 cytochrome p450 (5C678)
            [Caenorhabditis elegans]
 gi|15145484|gb|AAF59629.2| Hypothetical protein Y5H2B.5
            [Caenorhabditis elegans]
          Length = 516

 Score = 1052 bits (2721), Expect = 0.0
 Identities = 516/516 (100%), Positives = 516/516 (100%)
 Frame = -1

Query: 1551 MLAAALVLLLTYFAYLIFRQKDDILQFLHVRKICTREFKKLRGPPAVLIFGTLWYFKKDP 1372
            MLAAALVLLLTYFAYLIFRQKDDILQFLHVRKICTREFKKLRGPPAVLIFGTLWYFKKDP
Sbjct: 1    MLAAALVLLLTYFAYLIFRQKDDILQFLHVRKICTREFKKLRGPPAVLIFGTLWYFKKDP 60

Query: 1371 VEMVYQAQAWFSEYTLAPDNCGVLKLWLGPIPAVNIARGEIAKIVLDSSVNISKSSQYNK 1192
            VEMVYQAQAWFSEYTLAPDNCGVLKLWLGPIPAVNIARGEIAKIVLDSSVNISKSSQYNK
Sbjct: 61   VEMVYQAQAWFSEYTLAPDNCGVLKLWLGPIPAVNIARGEIAKIVLDSSVNISKSSQYNK 120

Query: 1191 LKEWIGDGLLISTGDKWRSRRKMLTQTFHFAVLKEYQKIFGAQGKILVEVLQLRANNKFS 1012
            LKEWIGDGLLISTGDKWRSRRKMLTQTFHFAVLKEYQKIFGAQGKILVEVLQLRANNKFS
Sbjct: 121  LKEWIGDGLLISTGDKWRSRRKMLTQTFHFAVLKEYQKIFGAQGKILVEVLQLRANNKFS 180

Query: 1011 FDIMPYIKRCALDIICETAMGCSISSQRGANDEYVNSVRRLSEIVWNYEKAPQFWLKPIW 832
            FDIMPYIKRCALDIICETAMGCSISSQRGANDEYVNSVRRLSEIVWNYEKAPQFWLKPIW
Sbjct: 181  FDIMPYIKRCALDIICETAMGCSISSQRGANDEYVNSVRRLSEIVWNYEKAPQFWLKPIW 240

Query: 831  YLFGDGFEFNRHVKLTTDFTRDVIENRKKELKTHNSEQNETKKLAFLDYLLKSQEEHPDI 652
            YLFGDGFEFNRHVKLTTDFTRDVIENRKKELKTHNSEQNETKKLAFLDYLLKSQEEHPDI
Sbjct: 241  YLFGDGFEFNRHVKLTTDFTRDVIENRKKELKTHNSEQNETKKLAFLDYLLKSQEEHPDI 300

Query: 651  LTDEGIREEVDTFMFEGHDTTSSGITFAVWFLGQFPEYQQRVHDELDEIFGEDFERIPNS 472
            LTDEGIREEVDTFMFEGHDTTSSGITFAVWFLGQFPEYQQRVHDELDEIFGEDFERIPNS
Sbjct: 301  LTDEGIREEVDTFMFEGHDTTSSGITFAVWFLGQFPEYQQRVHDELDEIFGEDFERIPNS 360

Query: 471  EDIQKMVYLEQCIKETLRMTPPVPFVSRKLTEDVKIPHATKPDLLLPAGINCMINIITIM 292
            EDIQKMVYLEQCIKETLRMTPPVPFVSRKLTEDVKIPHATKPDLLLPAGINCMINIITIM
Sbjct: 361  EDIQKMVYLEQCIKETLRMTPPVPFVSRKLTEDVKIPHATKPDLLLPAGINCMINIITIM 420

Query: 291  KDARYFERPYEFFPEHFSPERVAAREPFAFVPFSAGPRNCIGQKFALLEEKVLLSWIFRN 112
            KDARYFERPYEFFPEHFSPERVAAREPFAFVPFSAGPRNCIGQKFALLEEKVLLSWIFRN
Sbjct: 421  KDARYFERPYEFFPEHFSPERVAAREPFAFVPFSAGPRNCIGQKFALLEEKVLLSWIFRN 480

Query: 111  FTVTSMTKFPEEMPIPELILKPQFGTQVLLRNRRKL 4
            FTVTSMTKFPEEMPIPELILKPQFGTQVLLRNRRKL
Sbjct: 481  FTVTSMTKFPEEMPIPELILKPQFGTQVLLRNRRKL 516


>gi|39588643|emb|CAE58167.1| Hypothetical protein CBG01258
            [Caenorhabditis briggsae]
          Length = 458

 Score =  771 bits (1991), Expect = 0.0
 Identities = 368/458 (80%), Positives = 414/458 (90%), Gaps = 5/458 (1%)
 Frame = -1

Query: 1365 MVYQAQAWFSEYTLAPDNCGVLK-----LWLGPIPAVNIARGEIAKIVLDSSVNISKSSQ 1201
            M+ QAQ WF EYTLAPD+ G+LK      W+GP+P V+I RGE+AK + DSS NI KSSQ
Sbjct: 1    MIKQAQKWFVEYTLAPDSNGLLKRKAFQFWMGPVPVVSICRGEVAKTIFDSSTNIPKSSQ 60

Query: 1200 YNKLKEWIGDGLLISTGDKWRSRRKMLTQTFHFAVLKEYQKIFGAQGKILVEVLQLRANN 1021
            Y KLKEWIGDGLLISTG KWRSRRKMLTQTFHFAVLKEY K+F +QGKILV+VL+LRANN
Sbjct: 61   YRKLKEWIGDGLLISTGPKWRSRRKMLTQTFHFAVLKEYHKVFASQGKILVDVLRLRANN 120

Query: 1020 KFSFDIMPYIKRCALDIICETAMGCSISSQRGANDEYVNSVRRLSEIVWNYEKAPQFWLK 841
             + FDIMPYIKRC LDIICETAMGCSISSQ G+ND+YV SV+RLSE+VWNYEKAP +WLK
Sbjct: 121  TYPFDIMPYIKRCTLDIICETAMGCSISSQMGSNDKYVESVKRLSELVWNYEKAPLYWLK 180

Query: 840  PIWYLFGDGFEFNRHVKLTTDFTRDVIENRKKELKTHNSEQNETKKLAFLDYLLKSQEEH 661
            PIWYLFG+GFEF+R VKLTTDFTRDVI+ RK+ELK H SE ++ KKLAFLDYLLKSQ +H
Sbjct: 181  PIWYLFGNGFEFDRLVKLTTDFTRDVIDKRKEELKLHESEPSD-KKLAFLDYLLKSQTDH 239

Query: 660  PDILTDEGIREEVDTFMFEGHDTTSSGITFAVWFLGQFPEYQQRVHDELDEIFGEDFERI 481
            P+ILTDEGIREEVDTFMFEGHDTTSSGI FA+WFLGQ+PEYQQ+V DE+DEIFG+D+ER
Sbjct: 240  PEILTDEGIREEVDTFMFEGHDTTSSGIKFAIWFLGQYPEYQQQVQDEMDEIFGDDYERY 299

Query: 480  PNSEDIQKMVYLEQCIKETLRMTPPVPFVSRKLTEDVKIPHATKPDLLLPAGINCMINII 301
            PNSEDIQ+M+YLEQCIKETLR+TPPVPF+SR+L EDV IPHATKP +LLPAG+N MINII
Sbjct: 300  PNSEDIQRMIYLEQCIKETLRLTPPVPFISRQLEEDVLIPHATKPPVLLPAGMNIMINII 359

Query: 300  TIMKDARYFERPYEFFPEHFSPERVAAREPFAFVPFSAGPRNCIGQKFALLEEKVLLSWI 121
            TIMKDARYFE+PYEFFPEHF PERV +RE FA+VPFSAGPRNCIGQKFALLEEKV+LSWI
Sbjct: 360  TIMKDARYFEKPYEFFPEHFEPERVNSREAFAYVPFSAGPRNCIGQKFALLEEKVVLSWI 419

Query: 120  FRNFTVTSMTKFPEEMPIPELILKPQFGTQVLLRNRRK 7
            FRNFTVTSM+K+PEE PIPELILKPQFGTQVLL+NRRK
Sbjct: 420  FRNFTVTSMSKYPEEHPIPELILKPQFGTQVLLKNRRK 457




[DB home][top]