Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y62E10A_6
(1377 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17543860|ref|NP_502573.1| ferredoxin NADP+ reductase (51.1 kD... 887 0.0
gi|39587676|emb|CAE58614.1| Hypothetical protein CBG01781 [Caeno... 569 e-161
gi|47207051|emb|CAG13365.1| unnamed protein product [Tetraodon n... 262 2e-68
gi|18202431|sp|P82861|ADRO_SALFO NADPH:adrenodoxin oxidoreductas... 260 6e-68
gi|31212965|ref|XP_315426.1| ENSANGP00000014217 [Anopheles gambi... 259 1e-67
gi|13435350|ref|NP_077728.1| ferredoxin reductase isoform 1 prec... 254 3e-66
gi|178209|gb|AAA51669.1| adrenodoxin reductase >gnl|BL_ORD_ID|39... 254 3e-66
gi|30585241|gb|AAP36893.1| Homo sapiens ferredoxin reductase [sy... 254 3e-66
gi|178208|gb|AAA51668.1| adrenodoxin reductase 251 2e-65
gi|4758354|ref|NP_004101.1| ferredoxin reductase isoform 2 precu... 251 2e-65
gi|3041655|sp|P08165|ADRO_BOVIN NADPH:adrenodoxin oxidoreductase... 245 2e-63
gi|4930018|pdb|1CJC|A Chain A, Structure Of Adrenodoxin Reductas... 245 2e-63
gi|47937436|gb|AAH71268.1| Ferredoxin reductase [Mus musculus] 243 6e-63
gi|17137178|ref|NP_477150.1| CG12390-PA [Drosophila melanogaster... 243 1e-62
gi|625391|pir||JT0751 ferredoxin-NADP reductase (EC 1.18.1.2), l... 243 1e-62
gi|13162347|ref|NP_077067.1| adrenodoxin reductase [Rattus norve... 242 1e-62
gi|34980970|gb|AAH57146.1| Fdxr protein [Mus musculus] 242 1e-62
gi|25012428|gb|AAN71321.1| RE17125p [Drosophila melanogaster] 242 2e-62
gi|50546865|ref|XP_500902.1| hypothetical protein [Yarrowia lipo... 240 5e-62
gi|22074178|gb|AAK98796.1| ferredoxin NADP+ reductase [Schistoso... 240 7e-62
gi|6679767|ref|NP_032023.1| ferredoxin reductase [Mus musculus] ... 239 9e-62
gi|15805523|ref|NP_294219.1| ferredoxin/ferredoxin--NADP reducta... 234 4e-60
gi|50252503|dbj|BAD28680.1| putative NADPH:adrenodoxin oxidoredu... 233 1e-59
gi|25029201|ref|NP_739255.1| putative ferredoxin/ferredoxin--NAD... 230 7e-59
gi|19113205|ref|NP_596413.1| putative nadph:adrenodoxin oxidored... 229 1e-58
gi|22329089|ref|NP_194962.2| NADP adrenodoxin-like ferredoxin re... 225 2e-57
gi|50745493|ref|XP_426241.1| PREDICTED: similar to Fdxr protein ... 224 5e-57
gi|25029148|ref|NP_739202.1| putative ferredoxin/adrenodoxin red... 223 1e-56
gi|19554007|ref|NP_602009.1| putative ferredoxin/ferredoxin-NADP... 219 9e-56
gi|46110090|ref|XP_382103.1| hypothetical protein FG01927.1 [Gib... 219 9e-56
gi|28493022|ref|NP_787183.1| ferredoxin--NADP+ reductase [Trophe... 218 2e-55
gi|15827277|ref|NP_301540.1| putative NADPH-ferredoxin reductase... 215 2e-54
gi|19553947|ref|NP_601949.1| putative ferredoxin/ferredoxin-NADP... 214 5e-54
gi|41409274|ref|NP_962110.1| FprA [Mycobacterium avium subsp. pa... 212 1e-53
gi|23336193|ref|ZP_00121419.1| COG0493: NADPH-dependent glutamat... 204 4e-51
gi|27807249|ref|NP_777116.1| ferredoxin reductase; adrenodoxin r... 203 7e-51
gi|23465137|ref|NP_695740.1| probable ferredoxin/ferredoxin-NADP... 203 9e-51
gi|16769118|gb|AAL28778.1| LD17269p [Drosophila melanogaster] 202 2e-50
gi|38234613|ref|NP_940380.1| Putative ferredoxin/ferredoxin-NADP... 201 3e-50
gi|22973051|ref|ZP_00019896.1| hypothetical protein [Chloroflexu... 200 8e-50
gi|31794285|ref|NP_856778.1| PROBABLE NADPH:ADRENODOXIN OXIDORED... 199 2e-49
gi|15610243|ref|NP_217622.1| fprA [Mycobacterium tuberculosis H3... 198 2e-49
gi|50421455|ref|XP_459278.1| unnamed protein product [Debaryomyc... 197 5e-49
gi|50284939|ref|XP_444897.1| unnamed protein product [Candida gl... 196 1e-48
gi|46364638|ref|ZP_00227231.1| COG0493: NADPH-dependent glutamat... 196 1e-48
gi|48849790|ref|ZP_00304033.1| COG0493: NADPH-dependent glutamat... 195 2e-48
gi|6320584|ref|NP_010664.1| Oxidoreductase of the mitochondrial ... 192 1e-47
gi|1055300|gb|AAC49500.1| adrenodoxin oxidoreductase homolog 192 2e-47
gi|48837148|ref|ZP_00294143.1| COG0493: NADPH-dependent glutamat... 192 2e-47
gi|881497|gb|AAA69523.1| Arh1p 190 6e-47
gi|15828144|ref|NP_302407.1| ferredoxin, ferredoxin-NADP reducta... 189 2e-46
gi|21219210|ref|NP_624989.1| putative ferredoxin/ferredoxin-NADP... 187 7e-46
gi|46433242|gb|EAK92690.1| hypothetical protein CaO19.410 [Candi... 186 1e-45
gi|41406923|ref|NP_959759.1| FprB [Mycobacterium avium subsp. pa... 185 2e-45
gi|49097898|ref|XP_410409.1| hypothetical protein AN6272.2 [Aspe... 181 3e-44
gi|7433382|pir||T05346 ferredoxin-NADP+ reductase homolog F10M6.... 178 2e-43
gi|15608026|ref|NP_215401.1| fprB [Mycobacterium tuberculosis H3... 178 3e-43
gi|23508597|ref|NP_701266.1| adrenodoxin reductase, putative [Pl... 177 7e-43
gi|50308121|ref|XP_454061.1| unnamed protein product [Kluyveromy... 175 3e-42
gi|29828048|ref|NP_822682.1| putative NADPH-ferredoxin reductase... 170 6e-41
gi|37782789|gb|AAP41909.1| ferredoxin-NADP+ reductase [Trypanoso... 167 5e-40
gi|23489126|gb|EAA21492.1| MFDR, putative [Plasmodium yoelii yoe... 160 5e-38
gi|50121001|ref|YP_050168.1| probable oxidoreductase [Erwinia ca... 159 1e-37
gi|15667237|gb|AAL02421.1| adrenodoxin reductase [Frankia sp. Eu... 156 1e-36
gi|38110331|gb|EAA56067.1| hypothetical protein MG01718.4 [Magna... 150 5e-35
gi|50256113|gb|EAL18840.1| hypothetical protein CNBI1010 [Crypto... 144 5e-33
gi|32416466|ref|XP_328711.1| hypothetical protein [Neurospora cr... 140 7e-32
gi|23334564|gb|AAN27918.1| adrenodoxin reductase-like [Rhodococc... 139 2e-31
gi|833776|emb|CAA32002.1| adrenodoxin reductase (338 AA) [Bos ta... 138 4e-31
gi|46436479|gb|EAK95840.1| hypothetical protein CaO19.3521 [Cand... 136 1e-30
gi|48141349|ref|XP_397214.1| similar to hypothetical protein FLJ... 135 2e-30
gi|49068730|ref|XP_398654.1| hypothetical protein UM01039.1 [Ust... 135 3e-30
gi|15982765|gb|AAL09723.1| AT4g32360/F8B4_60 [Arabidopsis thalia... 115 2e-24
gi|18034652|gb|AAL57615.1| cindoxin reductase [Citrobacter braakii] 113 9e-24
gi|45185888|ref|NP_983604.1| ACR202Wp [Eremothecium gossypii] >g... 100 8e-20
gi|11061659|emb|CAC14535.1| probable adrenodoxin reductase [Leis... 92 4e-17
gi|37675860|ref|NP_936256.1| anaerobic dehydrogenase [Vibrio vul... 91 6e-17
gi|27367730|ref|NP_763257.1| NADPH-dependent glutamate synthase ... 91 6e-17
gi|48832720|ref|ZP_00289749.1| COG0493: NADPH-dependent glutamat... 91 6e-17
gi|26249299|ref|NP_755339.1| Hypothetical protein ygfT [Escheric... 89 2e-16
gi|41406271|ref|NP_959107.1| GltD [Mycobacterium avium subsp. pa... 88 4e-16
gi|42527670|ref|NP_972768.1| pyridine nucleotide-disulphide oxid... 88 5e-16
gi|6136710|sp|Q46820|YGFT_ECOLI Hypothetical protein ygfT 88 5e-16
gi|16130789|ref|NP_417363.1| putative oxidoreductase, Fe-S subun... 88 5e-16
gi|15803423|ref|NP_289456.1| putative oxidoreductase, Fe-S subun... 87 7e-16
gi|31217213|ref|XP_316385.1| ENSANGP00000013025 [Anopheles gambi... 87 1e-15
gi|46228829|gb|EAK89699.1| NADPH:ferredoxin--NADP+ reductase wit... 87 1e-15
gi|29832732|ref|NP_827366.1| putative glutamate synthase small c... 86 2e-15
gi|23213140|gb|AAN05788.1| putative NADPH:ferredoxin oxidoreduct... 86 2e-15
gi|15826908|ref|NP_301171.1| NADH-dependent glutamate synthase s... 86 2e-15
gi|45916149|ref|ZP_00195008.2| COG0493: NADPH-dependent glutamat... 86 3e-15
gi|31795032|ref|NP_857525.1| PUTATIVE NADH-DEPENDENT GLUTAMATE S... 85 4e-15
gi|15610994|ref|NP_218375.1| gltD [Mycobacterium tuberculosis H3... 85 4e-15
gi|24372902|ref|NP_716944.1| glutamate synthase, small subunit [... 85 4e-15
gi|21220506|ref|NP_626285.1| putative glutamate synthase small s... 84 6e-15
gi|34557570|ref|NP_907385.1| GLUTAMATE SYNTHASE SMALL CHAIN [Wol... 84 6e-15
gi|18977699|ref|NP_579056.1| glutamate synthase [NADPH] small ch... 84 8e-15
gi|28900340|ref|NP_799995.1| putative formate dehydrogenase, alp... 84 8e-15
gi|39998148|ref|NP_954099.1| glutamate synthase (NADPH), homotet... 84 1e-14
gi|48859400|ref|ZP_00313335.1| COG0493: NADPH-dependent glutamat... 84 1e-14
gi|16765799|ref|NP_461414.1| putative oxidoreductase [Salmonella... 83 1e-14
gi|23499822|ref|NP_699262.1| glutamate synthase, small subunit [... 83 2e-14
gi|20807067|ref|NP_622238.1| NADPH-dependent glutamate synthase ... 83 2e-14
gi|17988383|ref|NP_541016.1| GLUTAMATE SYNTHASE (NADPH) SMALL CH... 83 2e-14
gi|14521152|ref|NP_126627.1| glutamate synthase small chain [Pyr... 83 2e-14
gi|2244618|dbj|BAA21091.1| glutamate synthase [Pyrococcus sp.] 83 2e-14
gi|45548492|ref|ZP_00188524.1| COG0493: NADPH-dependent glutamat... 82 2e-14
gi|1339951|dbj|BAA12742.1| small subunit of NADH-dependent gluta... 82 2e-14
gi|14521926|ref|NP_127403.1| glutamate synthase small chain. [Py... 82 2e-14
gi|45548495|ref|ZP_00188527.1| COG0493: NADPH-dependent glutamat... 82 2e-14
gi|45548490|ref|ZP_00188522.1| COG0493: NADPH-dependent glutamat... 82 2e-14
gi|45548488|ref|ZP_00188520.1| COG0493: NADPH-dependent glutamat... 82 2e-14
gi|45548486|ref|ZP_00188518.1| COG0493: NADPH-dependent glutamat... 82 2e-14
gi|45548494|ref|ZP_00188526.1| COG0493: NADPH-dependent glutamat... 82 2e-14
gi|23014045|ref|ZP_00053884.1| COG0493: NADPH-dependent glutamat... 82 3e-14
gi|21675056|ref|NP_663121.1| iron-sulfur cluster-binding protein... 82 4e-14
gi|15644388|ref|NP_229440.1| glutamate synthase, beta subunit [T... 82 4e-14
gi|47095659|ref|ZP_00233266.1| glutamate synthase, small subunit... 82 4e-14
gi|46205270|ref|ZP_00048771.2| COG0493: NADPH-dependent glutamat... 82 4e-14
gi|29377047|ref|NP_816201.1| glutamate synthase (NADPH), homotet... 82 4e-14
gi|14590734|ref|NP_142804.1| glutamate synthase small chain [Pyr... 81 5e-14
gi|16803773|ref|NP_465258.1| similar to glutamate synthase (smal... 81 5e-14
gi|16800911|ref|NP_471179.1| similar to glutamate synthase (smal... 81 5e-14
gi|14591620|ref|NP_143702.1| glutamate synthase small chain [Pyr... 81 5e-14
gi|20807180|ref|NP_622351.1| NADPH-dependent glutamate synthase ... 81 5e-14
gi|23509556|ref|NP_702223.1| NAD(P)H-dependent glutamate synthas... 81 7e-14
gi|7494171|pir||T28635 glutamate synthase (NADH2) (EC 1.4.1.14) ... 81 7e-14
gi|28897973|ref|NP_797578.1| putative glutamate synthase, small ... 81 7e-14
gi|21673683|ref|NP_661748.1| iron-sulfur cluster-binding protein... 80 9e-14
gi|22995183|ref|ZP_00039664.1| COG0493: NADPH-dependent glutamat... 80 9e-14
gi|46907963|ref|YP_014352.1| glutamate synthase, small subunit [... 80 9e-14
gi|47092887|ref|ZP_00230669.1| glutamate synthase, small subunit... 80 9e-14
gi|28210532|ref|NP_781476.1| putative NADPH-dependent glutamate ... 80 1e-13
gi|15839298|ref|NP_299986.1| glutamate synthase, beta subunit [X... 80 1e-13
gi|46364341|ref|ZP_00226967.1| COG0493: NADPH-dependent glutamat... 80 1e-13
gi|13541988|ref|NP_111676.1| NADPH-dependent glutamate synthase ... 79 2e-13
gi|29832800|ref|NP_827434.1| putative glutamate synthase small s... 79 3e-13
gi|46915864|emb|CAG22635.1| putative formate dehydrogenase, alph... 79 3e-13
gi|28199923|ref|NP_780237.1| glutamate synthase, beta subunit [X... 79 3e-13
gi|39933755|ref|NP_946031.1| possible pyridine nucleotide-linked... 79 3e-13
gi|48858082|ref|ZP_00312049.1| COG0493: NADPH-dependent glutamat... 79 3e-13
gi|21240806|ref|NP_640388.1| glutamate synthase beta subunit [Xa... 79 3e-13
gi|48834530|ref|ZP_00291539.1| COG0493: NADPH-dependent glutamat... 79 3e-13
gi|22998021|ref|ZP_00042214.1| COG0493: NADPH-dependent glutamat... 79 3e-13
gi|42527102|ref|NP_972200.1| pyridine nucleotide-disulphide oxid... 79 3e-13
gi|1799891|dbj|BAA16342.1| similar to [SwissProt Accession Numbe... 79 3e-13
gi|505330|gb|AAB46944.1| Fe-S center and glutamate synthase (Glt... 79 3e-13
gi|16130393|ref|NP_416963.1| putative oxidoreductase, Fe-S subun... 79 3e-13
gi|15802990|ref|NP_289020.1| putative oxidoreductase, Fe-S subun... 78 4e-13
gi|18978282|ref|NP_579639.1| glutamate synthase [Pyrococcus furi... 78 4e-13
gi|23478370|gb|EAA15477.1| NAD(P)H-dependent glutamate synthase-... 78 4e-13
gi|46142078|ref|ZP_00204149.1| COG0493: NADPH-dependent glutamat... 78 6e-13
gi|24113797|ref|NP_708307.1| putative oxidoreductase, Fe-S subun... 78 6e-13
gi|23121105|ref|ZP_00103511.1| COG0493: NADPH-dependent glutamat... 78 6e-13
gi|23113494|ref|ZP_00098864.1| COG0493: NADPH-dependent glutamat... 78 6e-13
gi|16081537|ref|NP_393892.1| GLUTAMATE SYNTHASE [NADPH] SMALL CH... 78 6e-13
gi|2126452|pir||JC5184 glutamate synthase (GOGAT) (EC 1.4.1.-) s... 77 7e-13
gi|13472661|ref|NP_104228.1| glutamate synthase, small subunit [... 77 7e-13
gi|46191180|ref|ZP_00120276.2| COG0493: NADPH-dependent glutamat... 77 7e-13
gi|46440546|gb|EAK99851.1| hypothetical protein CaO19.13636 [Can... 77 7e-13
gi|15607032|ref|NP_214414.1| glutamate synthase small subunit gl... 77 7e-13
gi|46440636|gb|EAK99940.1| hypothetical protein CaO19.6257 [Cand... 77 7e-13
gi|49236121|ref|ZP_00330183.1| COG0493: NADPH-dependent glutamat... 77 1e-12
gi|24378863|ref|NP_720818.1| NADPH-dependent glutamate synthase ... 77 1e-12
gi|19115045|ref|NP_594133.1| putative Glutamate synthase (NADPH,... 77 1e-12
gi|26248837|ref|NP_754877.1| AegA protein [Escherichia coli CFT0... 77 1e-12
gi|28212005|ref|NP_782949.1| glutamate synthase (NADPH) small ch... 77 1e-12
gi|48850593|ref|ZP_00304835.1| COG0493: NADPH-dependent glutamat... 77 1e-12
gi|23465408|ref|NP_696011.1| glutamate synthase [NADPH] small su... 76 2e-12
gi|23469742|ref|ZP_00125076.1| COG0493: NADPH-dependent glutamat... 76 2e-12
gi|27364018|ref|NP_759546.1| Glutamate synthase, small subunit [... 76 2e-12
gi|50292777|ref|XP_448821.1| unnamed protein product [Candida gl... 76 2e-12
gi|46912167|emb|CAG18962.1| putative glutamate synthase, small s... 76 2e-12
gi|23112750|ref|ZP_00098195.1| COG0493: NADPH-dependent glutamat... 76 2e-12
gi|15966563|ref|NP_386916.1| PROBABLE GLUTAMATE SYNTHASE SMALL C... 75 3e-12
gi|14601084|ref|NP_147610.1| glutamate synthase small chain [Aer... 75 3e-12
gi|15642374|ref|NP_232007.1| glutamate synthase, small subunit [... 75 3e-12
gi|26991751|ref|NP_747176.1| glutamate synthase, small subunit [... 75 3e-12
gi|50086329|ref|YP_047839.1| glutamate synthase small chain [Aci... 75 4e-12
gi|21226766|ref|NP_632688.1| glutamate synthase [NADPH] [Methano... 75 4e-12
gi|37678822|ref|NP_933431.1| NADPH-dependent glutamate synthase,... 75 4e-12
gi|24665543|ref|NP_730201.1| CG9674-PB [Drosophila melanogaster]... 75 5e-12
gi|1945289|emb|CAA73084.1| glutamine--pyruvate aminotransferase ... 75 5e-12
gi|7448189|pir||JE0142 glutamate synthase (EC 1.4.1.-) small cha... 75 5e-12
gi|15642371|ref|NP_232004.1| glutamate synthase, small subunit [... 75 5e-12
gi|27819862|gb|AAO24979.1| LP11387p [Drosophila melanogaster] 75 5e-12
gi|15600228|ref|NP_253722.1| glutamate synthase small chain [Pse... 75 5e-12
gi|30696340|ref|NP_200158.2| glutamate synthase [NADH], chloropl... 75 5e-12
gi|8843775|dbj|BAA97323.1| NADH-dependent glutamate synthase [Ar... 75 5e-12
gi|24665539|ref|NP_648922.1| CG9674-PA [Drosophila melanogaster]... 75 5e-12
gi|49236603|ref|ZP_00330661.1| COG0493: NADPH-dependent glutamat... 75 5e-12
gi|16329369|ref|NP_440097.1| NADH-glutamate synthase small subun... 74 6e-12
gi|46191801|ref|ZP_00207000.1| COG0493: NADPH-dependent glutamat... 74 6e-12
gi|48839994|ref|ZP_00296922.1| COG0493: NADPH-dependent glutamat... 74 8e-12
gi|49658944|emb|CAF28571.1| putative oxidoreductase [Yersinia ps... 74 8e-12
gi|16120677|ref|NP_403990.1| putative oxidoreductase [Yersinia p... 74 8e-12
gi|22124513|ref|NP_667936.1| putative oxidoreductase, Fe-S subun... 74 8e-12
gi|37527865|ref|NP_931210.1| glutamate synthase [NADPH] small ch... 74 8e-12
gi|23104867|ref|ZP_00091327.1| COG0493: NADPH-dependent glutamat... 74 8e-12
gi|15375028|gb|AAK94788.1| glutamate synthase small subunit [Kle... 74 1e-11
gi|16766626|ref|NP_462241.1| glutamate synthase small subunit [S... 74 1e-11
gi|16762093|ref|NP_457710.1| glutamate synthase (NADPH) small ch... 74 1e-11
gi|48766495|ref|ZP_00271045.1| COG0493: NADPH-dependent glutamat... 74 1e-11
gi|46204787|ref|ZP_00049479.2| COG0493: NADPH-dependent glutamat... 74 1e-11
gi|46580024|ref|YP_010832.1| pyridine nucleotide-disulfide oxido... 74 1e-11
gi|16127836|ref|NP_422400.1| glutamate synthase, small subunit [... 74 1e-11
gi|28872234|ref|NP_794853.1| glutamate synthase, small subunit [... 73 1e-11
gi|20092583|ref|NP_618658.1| glutamate synthase (NADPH) [Methano... 73 1e-11
gi|16078905|ref|NP_389726.1| glutamate synthase (small subunit) ... 73 1e-11
gi|50842614|ref|YP_055841.1| glutamate synthase small subunit [P... 73 1e-11
gi|48832021|ref|ZP_00289066.1| COG0493: NADPH-dependent glutamat... 73 1e-11
gi|48833132|ref|ZP_00290155.1| COG0493: NADPH-dependent glutamat... 73 2e-11
gi|4337009|gb|AAD18034.1| glutamate synthase small subunit [Pseu... 73 2e-11
gi|50875521|emb|CAG35361.1| probable glutamate synthase, beta su... 73 2e-11
gi|24114501|ref|NP_709011.1| glutamate synthase, small subunit [... 73 2e-11
gi|16123702|ref|NP_407015.1| glutamate synthase [NADPH] small ch... 73 2e-11
gi|16131103|ref|NP_417680.1| glutamate synthase, small subunit; ... 73 2e-11
gi|48854263|ref|ZP_00308426.1| COG0493: NADPH-dependent glutamat... 73 2e-11
gi|15891168|ref|NP_356840.1| AGR_L_2104p [Agrobacterium tumefaci... 73 2e-11
gi|17987921|ref|NP_540555.1| GLUTAMATE SYNTHASE (NADPH) SMALL CH... 72 2e-11
gi|23474671|ref|ZP_00129964.1| COG0493: NADPH-dependent glutamat... 72 2e-11
gi|18310236|ref|NP_562170.1| glutamate synthase beta subunit [Cl... 72 2e-11
gi|21229509|ref|NP_635426.1| glutamate synthase, beta subunit [X... 72 2e-11
gi|23501190|ref|NP_697317.1| pyridine nucleotide-disulphide oxid... 72 2e-11
gi|23100553|ref|NP_694020.1| glutamate synthase [NADPH] small su... 72 2e-11
gi|26249800|ref|NP_755840.1| Glutamate synthase [NADPH] small ch... 72 2e-11
gi|15803753|ref|NP_289787.1| glutamate synthase, small subunit [... 72 2e-11
gi|48732058|ref|ZP_00265801.1| COG0493: NADPH-dependent glutamat... 72 2e-11
gi|32473827|ref|NP_866821.1| NADH-glutamate synthase small chain... 72 3e-11
gi|28897257|ref|NP_796862.1| glutamate synthase, small subunit [... 72 3e-11
gi|29247477|gb|EAA39037.1| GLP_21_4388_1656 [Giardia lamblia ATC... 72 3e-11
gi|50403765|sp|Q05756|GLTD_AZOBR Glutamate synthase [NADPH] smal... 72 3e-11
gi|420793|pir||A46602 glutamate synthase (NADPH) (EC 1.4.1.13) b... 72 3e-11
gi|23014811|ref|ZP_00054610.1| COG0493: NADPH-dependent glutamat... 72 4e-11
gi|28897255|ref|NP_796860.1| glutamate synthase, small subunit [... 72 4e-11
gi|48861786|ref|ZP_00315685.1| COG0493: NADPH-dependent glutamat... 72 4e-11
gi|50123378|ref|YP_052545.1| anaerobically expressed oxidoreduct... 71 5e-11
gi|15673267|ref|NP_267441.1| glutamate synthase small subunit [L... 71 5e-11
gi|15639722|ref|NP_219172.1| glutamate synthase (gltA) [Treponem... 71 5e-11
gi|22124049|ref|NP_667472.1| glutamate synthase, small subunit [... 71 7e-11
gi|10120476|gb|AAG13082.1| DsrL [Allochromatium vinosum] 71 7e-11
gi|46580182|ref|YP_010990.1| pyridine nucleotide-disulfide oxido... 71 7e-11
gi|46580880|ref|YP_011688.1| glutamate synthase, small subunit [... 71 7e-11
gi|31195293|ref|XP_306594.1| ENSANGP00000014644 [Anopheles gambi... 70 9e-11
gi|21673121|ref|NP_661186.1| glutamate synthase, small subunit, ... 70 9e-11
gi|18311443|ref|NP_563377.1| probable glutamate synthase small c... 70 9e-11
gi|48845015|ref|ZP_00299306.1| COG0493: NADPH-dependent glutamat... 70 9e-11
gi|49235930|ref|ZP_00329994.1| COG0493: NADPH-dependent glutamat... 70 9e-11
gi|15894951|ref|NP_348300.1| Small subunit of NADPH-dependent gl... 70 1e-10
gi|16588675|gb|AAL26865.1| NADH glutamate synthase isoform 2 [Ph... 70 1e-10
gi|21220460|ref|NP_626239.1| putative glutamate synthase small s... 70 1e-10
gi|39933212|ref|NP_945488.1| possible oxidoreductase [Rhodopseud... 70 1e-10
gi|19074931|ref|NP_586437.1| NADPH ADRENODOXIN OXIDOREDUCTASE [E... 70 1e-10
gi|27469229|ref|NP_765866.1| NADH-glutamate synthase small subun... 70 2e-10
gi|34541621|ref|NP_906100.1| glutamate synthase, small subunit [... 70 2e-10
gi|21673308|ref|NP_661373.1| glutamate synthase, small subunit [... 69 2e-10
gi|27364016|ref|NP_759544.1| Glutamate synthase, small subunit [... 69 2e-10
gi|16588672|gb|AAL26864.1| NADH glutamate synthase isoform 1 [Ph... 69 3e-10
gi|46912169|emb|CAG18964.1| putative glutamate synthase, small s... 69 3e-10
gi|23112567|ref|ZP_00098034.1| COG0493: NADPH-dependent glutamat... 69 3e-10
gi|46141340|ref|ZP_00146572.2| COG0493: NADPH-dependent glutamat... 69 3e-10
gi|15791408|ref|NP_281231.1| glutamate synthase (NADPH) small su... 69 3e-10
gi|29170608|gb|AAO66290.1| glutamate synthase small subunit prot... 69 3e-10
gi|27382855|ref|NP_774384.1| glutamate synthase small subunit [B... 69 3e-10
gi|39995617|ref|NP_951568.1| Fe(III) reductase, beta subunit [Ge... 69 3e-10
gi|45188163|ref|NP_984386.1| ADR290Wp [Eremothecium gossypii] >g... 69 3e-10
gi|17570289|ref|NP_509693.1| glutamate synthase (XK721) [Caenorh... 68 4e-10
gi|50119271|ref|YP_048438.1| glutamate synthase [NADPH] small ch... 68 4e-10
gi|46320344|ref|ZP_00220734.1| COG0493: NADPH-dependent glutamat... 68 4e-10
gi|34911200|ref|NP_916947.1| NADH-dependent glutamate synthase [... 68 4e-10
gi|4008156|dbj|BAA35120.1| NADH dependent Glutamate Synthase [Or... 68 4e-10
gi|34499492|ref|NP_903707.1| glutamate synthase, small subunit [... 68 4e-10
gi|49328001|gb|AAT58702.1| putative glutamate synthase [Oryza sa... 68 4e-10
gi|24372575|ref|NP_716617.1| formate dehydrogenase, alpha subuni... 68 4e-10
gi|48844884|ref|ZP_00299178.1| COG0493: NADPH-dependent glutamat... 68 4e-10
gi|15614292|ref|NP_242595.1| glutamate synthase (small subunit) ... 68 4e-10
gi|417073|sp|Q03460|GLSN_MEDSA Glutamate synthase [NADH], chloro... 68 4e-10
gi|1066499|gb|AAB41904.1| NADH-dependent glutamate synthase [Med... 68 4e-10
gi|18476144|gb|AAK62675.1| putative glutamate synthase [Enteroco... 68 4e-10
gi|30027171|gb|AAP06761.1| oxidoreductase [Clostridium saccharob... 68 6e-10
gi|5305491|gb|AAD41676.1| glutamate synthase small subunit [Clos... 68 6e-10
gi|18978224|ref|NP_579581.1| glutamate synthase small subunit [P... 68 6e-10
gi|41726215|ref|ZP_00152973.1| COG0493: NADPH-dependent glutamat... 67 1e-09
gi|146209|gb|AAA23905.1| glutamate synthase small subunit 67 1e-09
gi|23014648|ref|ZP_00054453.1| COG0493: NADPH-dependent glutamat... 66 2e-09
gi|39590998|emb|CAE58778.1| Hypothetical protein CBG01975 [Caeno... 66 2e-09
gi|15643973|ref|NP_229022.1| glutamate synthase, beta subunit [T... 66 2e-09
gi|42525923|ref|NP_971021.1| glutamate synthase (NADPH), homotet... 66 2e-09
gi|33598740|ref|NP_886383.1| glutamate synthase [NADPH] small ch... 65 3e-09
gi|23025064|ref|ZP_00064242.1| COG0493: NADPH-dependent glutamat... 65 3e-09
gi|48781597|ref|ZP_00278188.1| COG0493: NADPH-dependent glutamat... 65 3e-09
gi|33594613|ref|NP_882257.1| glutamate synthase [NADPH] small ch... 65 4e-09
gi|33603814|ref|NP_891374.1| glutamate synthase [NADPH] small ch... 65 4e-09
gi|50309655|ref|XP_454839.1| unnamed protein product [Kluyveromy... 65 4e-09
gi|21673241|ref|NP_661306.1| glutamate synthase, small subunit [... 65 5e-09
gi|15894051|ref|NP_347400.1| NADPH-dependent glutamate synthase ... 65 5e-09
gi|29349718|ref|NP_813221.1| NADPH-dependent glutamate synthase ... 64 6e-09
gi|46319617|ref|ZP_00220020.1| COG0493: NADPH-dependent glutamat... 64 8e-09
gi|21282156|ref|NP_645244.1| NADH-glutamate synthase small subun... 64 8e-09
gi|15923463|ref|NP_370997.1| NADH-glutamate synthase small subun... 64 8e-09
gi|23475506|ref|ZP_00130792.1| COG0493: NADPH-dependent glutamat... 64 1e-08
gi|49482697|ref|YP_039921.1| glutamate synthase, small subunit [... 64 1e-08
gi|48787932|ref|ZP_00283911.1| COG0493: NADPH-dependent glutamat... 64 1e-08
gi|6320030|ref|NP_010110.1| NAD(+)-dependent glutamate synthase ... 63 1e-08
gi|46311216|ref|ZP_00211826.1| COG0493: NADPH-dependent glutamat... 63 1e-08
gi|2494791|sp|Q12680|GLT1_YEAST Glutamate synthase [NADPH] precu... 63 1e-08
gi|45532830|ref|ZP_00183828.1| COG0493: NADPH-dependent glutamat... 63 1e-08
gi|46313576|ref|ZP_00214165.1| COG0493: NADPH-dependent glutamat... 63 1e-08
gi|39933969|ref|NP_946245.1| glutamate synthase (NADPH) small ch... 63 2e-08
gi|27366398|ref|NP_761926.1| Uncharacterized NAD(FAD)-dependent ... 62 2e-08
gi|25026715|ref|NP_736769.1| glutamate synthase small subunit [C... 62 2e-08
gi|49095620|ref|XP_409271.1| hypothetical protein AN5134.2 [Aspe... 62 3e-08
gi|45917330|ref|ZP_00196528.2| COG0493: NADPH-dependent glutamat... 62 3e-08
gi|29345962|ref|NP_809465.1| glutamate synthase, small subunit [... 62 3e-08
gi|19551435|ref|NP_599437.1| Glutamine 2-oxoglutarate aminotrans... 62 4e-08
gi|4521157|dbj|BAA75930.1| glutamine 2-oxoglutarate aminotransfe... 62 4e-08
gi|23473314|ref|ZP_00128610.1| COG0493: NADPH-dependent glutamat... 62 4e-08
gi|13471619|ref|NP_103185.1| glutamate synthase beta subunit [Me... 61 5e-08
gi|18369662|emb|CAD21635.1| putative dehydrogenase subunit [Azoa... 61 5e-08
gi|37679337|ref|NP_933946.1| 2,4-dienoyl-CoA reductase [Vibrio v... 61 5e-08
gi|16761396|ref|NP_457013.1| putative oxidoreductase [Salmonella... 61 7e-08
gi|20530911|gb|AAM27281.1| sulfide dehydrogenase [Spironucleus b... 61 7e-08
gi|39937780|ref|NP_950056.1| possible glutamate synthase, small ... 60 9e-08
gi|18313922|ref|NP_560589.1| glutamate synthase small subunit gl... 60 1e-07
gi|15805218|ref|NP_293906.1| glutamate synthase, small subunit [... 60 2e-07
gi|17547683|ref|NP_521085.1| PROBABLE GLUTAMATE SYNTHASE (SMALL ... 60 2e-07
gi|50841651|ref|YP_054878.1| dehydrogenase, GltD family [Propion... 60 2e-07
gi|26990739|ref|NP_746164.1| glutamate synthase, small subunit, ... 59 2e-07
gi|48733648|ref|ZP_00267391.1| COG0493: NADPH-dependent glutamat... 59 2e-07
gi|46913606|emb|CAG20392.1| hypothetical NADPH-dependent glutama... 59 2e-07
gi|50547297|ref|XP_501118.1| hypothetical protein [Yarrowia lipo... 59 2e-07
gi|48767794|ref|ZP_00272147.1| COG0493: NADPH-dependent glutamat... 59 4e-07
gi|32415407|ref|XP_328183.1| probable glutamate synthase [MIPS] ... 58 5e-07
gi|49074698|ref|XP_401465.1| hypothetical protein UM03850.1 [Ust... 58 5e-07
gi|47571956|ref|ZP_00242003.1| COG0493: NADPH-dependent glutamat... 58 6e-07
gi|46316862|ref|ZP_00217440.1| COG1902: NADH:flavin oxidoreducta... 58 6e-07
gi|22959143|ref|ZP_00006800.1| COG0493: NADPH-dependent glutamat... 57 8e-07
gi|23116212|ref|ZP_00100886.1| COG0493: NADPH-dependent glutamat... 57 8e-07
gi|38111222|gb|EAA56832.1| hypothetical protein MG07187.4 [Magna... 57 8e-07
gi|20466658|gb|AAM20646.1| NADH-dependent glutamate synthase [Ar... 57 1e-06
gi|45124781|emb|CAF32239.1| putative NADPH-ferredoxin reductase ... 56 2e-06
gi|50877513|emb|CAG37353.1| related to glutamate synthase, beta ... 55 3e-06
gi|27381853|ref|NP_773382.1| blr6742 [Bradyrhizobium japonicum U... 55 4e-06
gi|24113536|ref|NP_708046.1| putative oxidoreductase [Shigella f... 54 9e-06
gi|30063590|ref|NP_837761.1| putative oxidoreductase [Shigella f... 54 9e-06
gi|28898925|ref|NP_798530.1| 2,4-dienoyl-CoA reductase [Vibrio p... 54 9e-06
gi|46914193|emb|CAG20973.1| putative 2,4-dienoyl-CoA reductase [... 54 1e-05
gi|34556902|ref|NP_906717.1| FORMATE DEHYDROGENASE, BETA SUBUNIT... 53 2e-05
gi|258017|gb|AAC09006.1| orf upstream of BCS1 [Saccharomyces cer... 53 2e-05
gi|16761128|ref|NP_456745.1| putative oxidoreductase [Salmonella... 52 3e-05
gi|49236752|ref|ZP_00330809.1| COG0493: NADPH-dependent glutamat... 52 3e-05
gi|50255906|gb|EAL18637.1| hypothetical protein CNBJ0620 [Crypto... 52 3e-05
gi|15966200|ref|NP_386553.1| PROBABLE GLUTAMATE SYNTHASE SMALL C... 52 3e-05
gi|46323396|ref|ZP_00223760.1| COG1902: NADH:flavin oxidoreducta... 52 4e-05
gi|16765516|ref|NP_461131.1| putative NADPH-dependent glutamate ... 51 6e-05
gi|15802702|ref|NP_288729.1| putative oxidoreductase [Escherichi... 51 6e-05
gi|16130084|ref|NP_416651.1| putative oxidoreductase; bifunction... 51 6e-05
gi|16130780|ref|NP_417354.1| putative oxidoreductase, Fe-S subun... 51 6e-05
gi|12055751|emb|CAC20787.1| glutamate synthase small subunit [Pe... 51 7e-05
gi|5932362|gb|AAD56915.1| glutamate synthase small subunit gltS ... 51 7e-05
gi|26248527|ref|NP_754567.1| Hypothetical oxidoreductase yeiT [E... 51 7e-05
gi|26249291|ref|NP_755331.1| Hypothetical protein ygfK [Escheric... 51 7e-05
gi|15641995|ref|NP_231627.1| 2,4-dienoyl-CoA reductase [Vibrio c... 50 1e-04
gi|15803415|ref|NP_289448.1| putative oxidoreductase, Fe-S subun... 50 1e-04
gi|20385118|gb|AAM21173.1| adrenodoxin reductase [Sus scrofa] 50 2e-04
gi|3169863|gb|AAC17982.1| NADPH dependent glutamate synthase sma... 50 2e-04
gi|17939918|emb|CAD19517.1| glutamate synthase small subunit [Rh... 49 2e-04
gi|33863824|ref|NP_895384.1| putative oxidoreductase [Prochloroc... 49 2e-04
gi|15595637|ref|NP_249131.1| probable oxidoreductase [Pseudomona... 49 3e-04
gi|46581693|ref|YP_012501.1| pyridine nucleotide-disulfide oxido... 49 3e-04
gi|46913561|emb|CAG20347.1| putative oxidoreductase, Fe-S subuni... 49 3e-04
gi|29377068|ref|NP_816222.1| oxidoreductase, pyridine nucleotide... 48 5e-04
gi|34495624|ref|NP_899839.1| 2,4-dienoyl-CoA reductase FadH1 [Ch... 48 6e-04
gi|20807468|ref|NP_622639.1| NADH:flavin oxidoreductases, Old Ye... 48 6e-04
gi|46200856|ref|ZP_00056229.2| COG0493: NADPH-dependent glutamat... 47 8e-04
gi|42527707|ref|NP_972805.1| enoate reductase, putative [Trepone... 47 0.001
gi|15840618|ref|NP_335655.1| 2,4-dienoyl-coA reductase [Mycobact... 46 0.002
gi|31792369|ref|NP_854862.1| PROBABLE NADPH DEPENDENT 2,4-DIENOY... 46 0.002
gi|15608315|ref|NP_215691.1| fadH [Mycobacterium tuberculosis H3... 46 0.002
gi|48845683|ref|ZP_00299958.1| COG1902: NADH:flavin oxidoreducta... 46 0.002
gi|21230402|ref|NP_636319.1| 2,4-dienoyl-CoA reductase [Xanthomo... 46 0.002
gi|46109102|ref|XP_381609.1| hypothetical protein FG01433.1 [Gib... 45 0.005
gi|21225349|ref|NP_631128.1| 2,4-dienoyl-CoA reductase [NADPH] [... 45 0.005
gi|50084346|ref|YP_045856.1| 2,4-dienoyl-CoA reductase [NADPH] (... 45 0.005
gi|46202075|ref|ZP_00053819.2| COG1902: NADH:flavin oxidoreducta... 44 0.009
gi|15600007|ref|NP_253501.1| 2,4-dienoyl-CoA reductase FadH2 [Ps... 44 0.012
gi|32044166|ref|ZP_00141267.1| COG1902: NADH:flavin oxidoreducta... 44 0.012
gi|46131946|ref|ZP_00170313.2| COG1902: NADH:flavin oxidoreducta... 44 0.012
gi|21241775|ref|NP_641357.1| 2,4-dienoyl-CoA reductase [Xanthomo... 43 0.020
gi|45190895|ref|NP_985149.1| AER292Cp [Eremothecium gossypii] >g... 43 0.020
gi|15803622|ref|NP_289655.1| putative NADPH dehydrogenase [Esche... 43 0.020
gi|16130976|ref|NP_417552.1| 2,4-dieonyl-CoA reductase, FMN-link... 42 0.026
gi|37927614|pdb|1PS9|A Chain A, The Crystal Structure And Reacti... 42 0.026
gi|50084811|ref|YP_046321.1| 2,4-dienoyl-CoA reductase [Acinetob... 42 0.034
gi|34980231|gb|AAQ84026.1| NOXase [Enterococcus faecium] 42 0.034
gi|24373966|ref|NP_718009.1| 2,4-dienoyl-CoA reductase, putative... 42 0.034
gi|27468896|ref|NP_765533.1| nitrite reductase [Staphylococcus e... 42 0.034
gi|29827833|ref|NP_822467.1| putative 2,4-dienoyl-CoA reductase ... 42 0.045
gi|23114534|ref|ZP_00099831.1| COG1902: NADH:flavin oxidoreducta... 41 0.058
gi|28870958|ref|NP_793577.1| 2,4-dienoyl-CoA reductase [Pseudomo... 41 0.058
gi|30248862|ref|NP_840932.1| conserved hypothetical protein [Nit... 41 0.058
gi|114818|sp|P19410|BAIC_EUBSP Bile acid-inducible operon protei... 41 0.076
gi|26249670|ref|NP_755710.1| 2,4-dienoyl-CoA reductase [NADPH] [... 41 0.076
gi|24114376|ref|NP_708886.1| putative NADPH dehydrogenase [Shige... 40 0.100
gi|46164028|ref|ZP_00136455.2| COG1902: NADH:flavin oxidoreducta... 40 0.13
gi|15896649|ref|NP_349998.1| NADH oxidase (two distinct flavin o... 40 0.13
gi|21227398|ref|NP_633320.1| NADH oxidase [Methanosarcina mazei ... 40 0.13
gi|15598288|ref|NP_251782.1| 2,4-dienoyl-CoA reductase FadH1 [Ps... 40 0.13
gi|48787908|ref|ZP_00283887.1| COG1902: NADH:flavin oxidoreducta... 40 0.13
gi|50875782|emb|CAG35622.1| probable glutamate synthase, small c... 40 0.13
gi|49484616|ref|YP_041840.1| nitrite reductase large subunit [St... 40 0.13
gi|48835946|ref|ZP_00292944.1| COG1902: NADH:flavin oxidoreducta... 40 0.13
gi|19553902|ref|NP_601904.1| uncharacterized NAD(FAD)-dependent ... 39 0.29
gi|21225399|ref|NP_631178.1| putative ferredoxin reductase [Stre... 39 0.29
gi|21231455|ref|NP_637372.1| nitrite reductase [NAD(P)H] [Xantho... 39 0.29
gi|557073|gb|AAC43635.1| chlorobenzene dioxygenase, NADH-ferredo... 39 0.29
gi|42453172|ref|ZP_00153079.1| hypothetical protein Rick000501 [... 39 0.38
gi|34581035|ref|ZP_00142515.1| hypothetical protein [Rickettsia ... 39 0.38
gi|15891928|ref|NP_359642.1| unknown [Rickettsia conorii str. Ma... 39 0.38
gi|11497870|ref|NP_069092.1| NADH oxidase (noxA-1) [Archaeoglobu... 39 0.38
gi|28379083|ref|NP_785975.1| NADH peroxidase [Lactobacillus plan... 38 0.50
gi|29655122|ref|NP_820814.1| amine oxidase, flavin containing [C... 38 0.50
gi|48097108|ref|XP_393690.1| similar to ENSANGP00000016011 [Apis... 38 0.50
gi|48729858|ref|ZP_00263607.1| COG1902: NADH:flavin oxidoreducta... 38 0.65
gi|15668817|ref|NP_247620.1| dihydrolipoamide dehydrogenase [Met... 38 0.65
gi|15927978|ref|NP_375511.1| nitrite reductase [Staphylococcus a... 38 0.65
gi|15925390|ref|NP_372924.1| nitrite reductase [Staphylococcus a... 38 0.65
gi|45659213|ref|YP_003299.1| monooxygenase [Leptospira interroga... 37 0.84
gi|50119604|ref|YP_048771.1| putative 2,4-dienoyl-coA reductase ... 37 0.84
gi|13591940|ref|NP_112289.1| dihydropyrimidine dehydrogenase [Ra... 37 0.84
gi|46315149|ref|ZP_00215732.1| COG0446: Uncharacterized NAD(FAD)... 37 0.84
gi|20808970|ref|NP_624141.1| NADH:flavin oxidoreductases, Old Ye... 37 1.1
gi|24214897|ref|NP_712378.1| 2,4-dienoyl-CoA reductase [NADPH] [... 37 1.1
gi|45657595|ref|YP_001681.1| 2,4-dienoyl-coa reductase [Leptospi... 37 1.1
gi|24216944|ref|NP_714425.1| putative flavin-containing monooxyg... 37 1.1
gi|32140182|ref|NP_859016.1| keratin associated protein 10-10 [H... 37 1.1
gi|21225661|ref|NP_631440.1| putative dehydrogenase. [Streptomyc... 37 1.1
gi|26988733|ref|NP_744158.1| 2,4-dienoyl-CoA reductase FadH [Pse... 37 1.4
gi|48839769|ref|ZP_00296699.1| COG0446: Uncharacterized NAD(FAD)... 37 1.4
gi|46107978|ref|XP_381047.1| hypothetical protein FG00871.1 [Gib... 37 1.4
gi|3123310|sp|Q10499|YDGE_SCHPO Putative flavoprotein C26F1.14C ... 37 1.4
gi|35186986|gb|AAQ84161.1| PlmM [Streptomyces sp. HK803] 36 1.9
gi|29827542|ref|NP_822176.1| putative dehydrogenase [Streptomyce... 36 1.9
gi|34854301|ref|XP_342634.1| similar to A-kinase anchor protein ... 36 2.5
gi|20093415|ref|NP_619490.1| NADH dehydrogenase [Methanosarcina ... 36 2.5
gi|42527933|ref|NP_973031.1| treponemal membrane protein, putati... 36 2.5
gi|38234681|ref|NP_940448.1| Putative oxidoreductase [Corynebact... 36 2.5
gi|34859534|ref|XP_347224.1| similar to A-kinase anchor protein ... 36 2.5
gi|47522904|ref|NP_999209.1| dihydropyrimidine dehydrogenase [Su... 36 2.5
gi|13399651|pdb|1H7X|A Chain A, Dihydropyrimidine Dehydrogenase ... 36 2.5
gi|13399647|pdb|1H7W|A Chain A, Dihydropyrimidine Dehydrogenase ... 36 2.5
gi|5822775|dbj|BAA83927.1| GLTB [Bacillus halodurans] 36 2.5
gi|28829015|gb|AAO51590.1| similar to Yarrowia lipolytica (Candi... 36 2.5
gi|50423163|ref|XP_460162.1| unnamed protein product [Debaryomyc... 36 2.5
gi|50422223|ref|XP_459674.1| unnamed protein product [Debaryomyc... 36 2.5
gi|48871176|ref|ZP_00323892.1| COG3442: Predicted glutamine amid... 35 3.2
gi|31200533|ref|XP_309214.1| ENSANGP00000016011 [Anopheles gambi... 35 3.2
gi|27768991|gb|AAH42543.1| Dpyd protein [Mus musculus] 35 3.2
gi|23485985|gb|EAA20682.1| rhoptry protein [Plasmodium yoelii yo... 35 3.2
gi|28212131|ref|NP_783075.1| thioredoxin reductase [Clostridium ... 35 3.2
gi|25140985|ref|NP_740748.1| dihydropyrimidine dehydrogenase [Mu... 35 3.2
gi|46141499|ref|ZP_00146773.2| COG1902: NADH:flavin oxidoreducta... 35 3.2
gi|20808112|ref|NP_623283.1| Collagenase and related proteases [... 35 3.2
gi|39598064|emb|CAE68756.1| Hypothetical protein CBG14689 [Caeno... 35 3.2
gi|16120918|ref|NP_404231.1| 2,4-dienoyl-CoA reductase [Yersinia... 35 4.2
gi|1076557|pir||S54157 extensin-like protein - cowpea (fragment) 35 4.2
gi|22127463|ref|NP_670886.1| putative NADPH dehydrogenase [Yersi... 35 4.2
gi|730151|sp|P38681|NIR_NEUCR Nitrite reductase [NAD(P)H] >gnl|B... 35 4.2
gi|19551726|ref|NP_599728.1| hypothetical protein NCgl0466 [Cory... 35 4.2
gi|32406938|ref|XP_324077.1| NITRITE REDUCTASE [NAD(P)H] [Neuros... 35 4.2
gi|35210148|emb|CAB02962.2| Hypothetical protein F16B12.1 [Caeno... 35 5.5
gi|18858217|ref|NP_572538.1| CG2194-PB [Drosophila melanogaster]... 35 5.5
gi|47223622|emb|CAF99231.1| unnamed protein product [Tetraodon n... 35 5.5
gi|46308470|ref|ZP_00210663.1| COG0493: NADPH-dependent glutamat... 35 5.5
gi|16182390|gb|AAL13488.1| GH01650p [Drosophila melanogaster] 35 5.5
gi|42520888|ref|NP_966803.1| conserved hypothetical protein [Wol... 35 5.5
gi|45358895|ref|NP_988452.1| NAD binding site:FAD-dependent pyri... 35 5.5
gi|16766518|ref|NP_462133.1| 2,4-dieonyl-CoA reductase [Salmonel... 35 5.5
gi|17567039|ref|NP_510345.1| deleted in malignant brain tumors 1... 35 5.5
gi|46250735|ref|NP_941966.1| keratin associated protein 10-2; ke... 35 5.5
gi|33592993|ref|NP_880637.1| putative monooxygenase [Bordetella ... 34 7.1
gi|28865867|emb|CAD54411.1| secreted gel-forming mucin [Mus musc... 34 7.1
gi|39930557|ref|NP_919444.1| A kinase (PRKA) anchor protein (yot... 34 7.1
gi|27806651|ref|NP_776466.1| dihydropyrimidine dehydrogenase [Bo... 34 7.1
gi|1942624|pdb|1JOA| Nadh Peroxidase With Cysteine-Sulfenic Acid 34 7.1
gi|999857|pdb|1NHP| Nadh Peroxidase (Npx) (E.C.1.11.1.1) Mutant... 34 7.1
gi|999860|pdb|1NHS| Nadh Peroxidase (Npx) (E.C.1.11.1.1) Mutant... 34 7.1
gi|29375784|ref|NP_814938.1| NADH peroxidase [Enterococcus faeca... 34 7.1
gi|999858|pdb|1NHQ| Nadh Peroxidase (Npx) (E.C.1.11.1.1) Mutant... 34 7.1
gi|999859|pdb|1NHR| Nadh Peroxidase (Npx) (E.C.1.11.1.1) Mutant... 34 7.1
gi|21466151|pdb|1F8W|A Chain A, Crystal Structure Of Nadh Peroxi... 34 7.1
gi|97914|pir||S18332 NADH2 peroxidase (EC 1.11.1.1) [validated] ... 34 7.1
gi|2264420|gb|AAC46393.1| TecA4 [Burkholderia sp. PS12] 34 7.1
gi|2326352|emb|CAA72043.1| hypothetical protein [Arabidopsis tha... 34 7.1
gi|21230738|ref|NP_636655.1| conserved hypothetical protein [Xan... 34 7.1
gi|32171192|ref|NP_859418.1| mucin 6, gastric; gastric mucin-lik... 34 7.1
gi|37536666|ref|NP_922635.1| unknown protein [Oryza sativa (japo... 34 7.1
gi|46319436|ref|ZP_00219842.1| COG1231: Monoamine oxidase [Burkh... 34 7.1
gi|15234769|ref|NP_194785.1| cyclic nucleotide-regulated ion cha... 34 7.1
gi|25395668|pir||D88395 protein F53A3.6 [imported] - Caenorhabdi... 34 9.3
>gi|17543860|ref|NP_502573.1| ferredoxin NADP+ reductase (51.1 kD)
(4O141) [Caenorhabditis elegans]
gi|6425502|emb|CAB60604.1| Hypothetical protein Y62E10A.6
[Caenorhabditis elegans]
Length = 458
Score = 887 bits (2292), Expect = 0.0
Identities = 443/458 (96%), Positives = 443/458 (96%)
Frame = +1
Query: 1 MFGKTLLRRIACSNLNLKSRKLSGKPRLAIVGSGPAGMFACNGLLRKSNFSVDVFENSPV 180
MFGKTLLRRIACSNLNLKSRKLSGKPRLAIVGSGPAGMFACNGLLRKSNFSVDVFENSPV
Sbjct: 1 MFGKTLLRRIACSNLNLKSRKLSGKPRLAIVGSGPAGMFACNGLLRKSNFSVDVFENSPV 60
Query: 181 PFGLVRYGVAPDHQEVKNVINTFDAMFEKNRERLKLFCNVNIGRDITFDELTRGYDAVLL 360
PFGLVRYGVAPDHQEVKNVINTFDAMFEKNRERLKLFCNVNIGRDITFDELTRGYDAVLL
Sbjct: 61 PFGLVRYGVAPDHQEVKNVINTFDAMFEKNRERLKLFCNVNIGRDITFDELTRGYDAVLL 120
Query: 361 AYGSYKTRTLDIPGSDASNVISGSEFVGWYNGVPNASTPDLTTSNVVIVGNGNVALDCAR 540
AYGSYKTRTLDIPGSDASNVISGSEFVGWYNGVPNASTPDLTTSNVVIVGNGNVALDCAR
Sbjct: 121 AYGSYKTRTLDIPGSDASNVISGSEFVGWYNGVPNASTPDLTTSNVVIVGNGNVALDCAR 180
Query: 541 VLSTASSGLLRISDIPGDRLNVLEGANVKDIKILGRRGPEHVSFTIKELREQFKIKDWDS 720
VLSTASSGLLRISDIPGDRLNVLEGANVKDIKILGRRGPEHVSFTIKELREQFKIKDWDS
Sbjct: 181 VLSTASSGLLRISDIPGDRLNVLEGANVKDIKILGRRGPEHVSFTIKELREQFKIKDWDS 240
Query: 721 KLEISEIDAKNLTESLPKLERKKKRLTEVLVKNIGIANGLRQCHFIFHRIPEKIIADSNG 900
KLEISEIDAKNLTESLPKLERKKKRLTEVLVKNIGIANGLRQCHFIFHRIPEKIIADSNG
Sbjct: 241 KLEISEIDAKNLTESLPKLERKKKRLTEVLVKNIGIANGLRQCHFIFHRIPEKIIADSNG 300
Query: 901 KVQEIIVKNNETGQEETYPCGLLIYSIGYQTLVLDGVPQNDKKMIDMKDHCRVNMVAACS 1080
KVQEIIVKNNETGQEETYPCGLLIYSIGYQTLVLDGVPQNDKKMIDMKDHCRVNMVAACS
Sbjct: 301 KVQEIIVKNNETGQEETYPCGLLIYSIGYQTLVLDGVPQNDKKMIDMKDHCRVNMVAACS 360
Query: 1081 SQVYATGWCAHGPHGIIVDTQQQSIFVADQIAADFAQFKDSTSNGVEELLEDRKVPFISW 1260
SQVYATGWCAHGPHGIIVDTQQQSIFVADQIAADFAQFKDSTSNGVEELLEDRKVPFISW
Sbjct: 361 SQVYATGWCAHGPHGIIVDTQQQSIFVADQIAADFAQFKDSTSNGVEELLEDRKVPFISW 420
Query: 1261 DEWKQIDRQEQDTGKLSGKIRXXXXXXXXXXXXXXXCN 1374
DEWKQIDRQEQDTGKLSGKIR CN
Sbjct: 421 DEWKQIDRQEQDTGKLSGKIREKFTTFEKFLTKLKKCN 458