Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y67D2_6
(1812 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|32564647|ref|NP_497422.2| ubiquitin thiolesterase, family 2 (... 745 0.0
gi|39586108|emb|CAE69184.1| Hypothetical protein CBG15218 [Caeno... 378 e-103
gi|39586109|emb|CAE69185.1| Hypothetical protein CBG15219 [Caeno... 200 8e-50
gi|24047300|gb|AAH38606.1| Usp30 protein [Mus musculus] 136 1e-30
gi|38081867|ref|XP_149655.3| RIKEN cDNA 6330590F17 [Mus musculus] 136 1e-30
gi|34872822|ref|XP_222274.2| similar to 6330590F17Rik protein [R... 135 4e-30
gi|14042781|dbj|BAB55392.1| unnamed protein product [Homo sapiens] 135 4e-30
gi|40788029|emb|CAE51936.1| ubiquitin-specific proteinase 30 [Ho... 135 4e-30
gi|14249222|ref|NP_116052.1| ubiquitin specific protease 30 [Hom... 135 4e-30
gi|630704|pir||S44858 hypothetical protein PAR2.2 - Caenorhabdit... 119 2e-25
gi|50756498|ref|XP_415187.1| PREDICTED: similar to ubiquitin spe... 96 2e-18
gi|38197236|gb|AAH22094.2| USP30 protein [Homo sapiens] 92 5e-17
gi|17560272|ref|NP_504333.1| predicted CDS, putative protein fam... 87 1e-15
gi|17562164|ref|NP_504664.1| predicted CDS, reverse transcriptas... 84 9e-15
gi|17543318|ref|NP_500114.1| nuclear factor 4 family member (4C4... 80 1e-13
gi|26347011|dbj|BAC37154.1| unnamed protein product [Mus musculus] 78 8e-13
gi|31203803|ref|XP_310850.1| ENSANGP00000012389 [Anopheles gambi... 72 3e-11
gi|17556132|ref|NP_497688.1| putative nuclear protein, with 2 co... 71 8e-11
gi|18858101|ref|NP_572274.1| CG3016-PA [Drosophila melanogaster]... 70 1e-10
gi|24658569|ref|NP_729087.1| CG5486-PA [Drosophila melanogaster]... 63 2e-08
gi|48104103|ref|XP_392918.1| similar to CG3016-PA [Apis mellifera] 63 3e-08
gi|25511610|pir||D88538 hypothetical protein PAR2.2 homolog - Ca... 60 2e-07
gi|3334400|sp|Q24574|UBPE_DROME UBIQUITIN CARBOXYL-TERMINAL HYDR... 59 5e-07
gi|46228703|gb|EAK89573.1| ubiquitin carboxyl-terminal hydrolase... 59 5e-07
gi|17556388|ref|NP_497421.1| transcriptional regulator protein (... 58 7e-07
gi|17556382|ref|NP_497417.1| conserved ATP-GTP binding protein l... 57 1e-06
gi|39587751|emb|CAE67769.1| Hypothetical protein CBG13344 [Caeno... 57 2e-06
gi|32563999|ref|NP_495686.2| ubiquitin thiolesterase, family 2 (... 56 2e-06
gi|17540966|ref|NP_500878.1| predicted CDS, serpentine Receptor,... 55 7e-06
gi|29367503|gb|AAO72607.1| putative ubiquitin-specific protease ... 54 1e-05
gi|17551896|ref|NP_497476.1| putative protein, with 5 coiled coi... 51 1e-04
gi|50751656|ref|XP_422499.1| PREDICTED: similar to Ubiquitin car... 51 1e-04
gi|50750133|ref|XP_421884.1| PREDICTED: similar to ubiquitin spe... 50 1e-04
gi|46128333|ref|XP_388720.1| hypothetical protein FG08544.1 [Gib... 50 1e-04
gi|14423979|sp|Q9UPU5|UB24_HUMAN Ubiquitin carboxyl-terminal hyd... 50 2e-04
gi|42655774|ref|XP_371254.2| similar to Ubiquitin carboxyl-termi... 50 2e-04
gi|17510437|ref|NP_493434.1| ubiquitin specific protease (1O528)... 49 3e-04
gi|38078626|ref|XP_131566.5| RIKEN cDNA 2810030C21 [Mus musculus] 49 4e-04
gi|47226494|emb|CAG08510.1| unnamed protein product [Tetraodon n... 49 4e-04
gi|46229636|gb|EAK90454.1| ubiqutin C-terminal hydrolase of the ... 49 5e-04
gi|47497222|dbj|BAD19267.1| putative hematopoietic-specific IL-2... 48 9e-04
gi|28892803|ref|NP_795946.1| ubiquitin specific protease 37 [Mus... 48 9e-04
gi|34869951|ref|XP_233260.2| similar to Ubiquitin carboxyl-termi... 48 9e-04
gi|50423869|ref|XP_460519.1| unnamed protein product [Debaryomyc... 48 9e-04
gi|31199407|ref|XP_308651.1| ENSANGP00000011178 [Anopheles gambi... 47 0.001
gi|38174591|gb|AAH61020.1| RIKEN cDNA 4930511O11 [Mus musculus] 47 0.001
gi|21312902|ref|NP_083439.1| RIKEN cDNA 4930511O11 [Mus musculus... 47 0.002
gi|34533821|dbj|BAC86814.1| unnamed protein product [Homo sapiens] 47 0.002
gi|19173018|ref|NP_597569.1| UBIQUITIN CARBOXY-TERMINAL HYDROLAS... 47 0.002
gi|27707416|ref|XP_228680.1| similar to ubiquitin specific prote... 47 0.002
gi|31198819|ref|XP_308357.1| ENSANGP00000019067 [Anopheles gambi... 46 0.003
gi|31235401|ref|XP_319238.1| ENSANGP00000018655 [Anopheles gambi... 46 0.003
gi|6707738|sp|O75317|UB12_HUMAN Ubiquitin carboxyl-terminal hydr... 46 0.003
gi|21483568|gb|AAM52759.1| SD04548p [Drosophila melanogaster] 46 0.003
gi|28571791|ref|NP_650948.2| CG5798-PA [Drosophila melanogaster]... 46 0.003
gi|50753009|ref|XP_413830.1| PREDICTED: similar to Ubiquitin car... 46 0.003
gi|32698815|ref|NP_872294.1| ubiquitin-specific protease 12-like... 46 0.003
gi|17561910|ref|NP_505826.1| ubiquitin carboxyl-terminal hydrola... 46 0.003
gi|42573235|ref|NP_974714.1| ubiquitin-specific protease 27, put... 46 0.003
gi|41054621|ref|NP_955873.1| ubiquitin specific protease 1; wu:f... 46 0.003
gi|38422351|emb|CAE54910.1| Hypothetical protein H19N07.2c [Caen... 46 0.003
gi|18420436|ref|NP_568058.1| ubiquitin-specific protease 27, put... 46 0.003
gi|25407807|pir||B85466 hypothetical protein AT4g39370 [imported... 46 0.003
gi|17561912|ref|NP_505825.1| ubiquitin carboxyl-terminal hydrola... 46 0.003
gi|20071587|gb|AAH27052.1| Usp8 protein [Mus musculus] 45 0.006
gi|41704985|sp|Q9NVE5|UB40_HUMAN Ubiquitin carboxyl-terminal hyd... 45 0.006
gi|34395185|dbj|BAC83574.1| putative ubiquitin-specific protease... 45 0.006
gi|41055953|ref|NP_060688.1| ubiquitin specific protease 40 [Hom... 45 0.006
gi|40789062|dbj|BAA06225.2| KIAA0055 [Homo sapiens] 45 0.006
gi|731046|sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydro... 45 0.006
gi|48098856|ref|XP_394836.1| similar to ENSANGP00000018711 [Apis... 45 0.006
gi|31981044|ref|NP_062703.2| ubiquitin specific protease 8; puta... 45 0.006
gi|5058999|gb|AAD38869.1| putative deubiquitinating enzyme UBPY ... 45 0.006
gi|31206105|ref|XP_312004.1| ENSANGP00000018711 [Anopheles gambi... 45 0.006
gi|34899126|ref|NP_910909.1| putative ubiquitin-specific protein... 45 0.006
gi|28972047|dbj|BAC65477.1| mKIAA0055 protein [Mus musculus] 45 0.006
gi|45501083|gb|AAH67300.1| Unknown (protein for IMAGE:30389677) ... 45 0.006
gi|34858657|ref|XP_215821.2| similar to mKIAA0055 protein [Rattu... 44 0.010
gi|41281376|ref|NP_005145.2| ubiquitin specific protease 8 [Homo... 44 0.010
gi|19338632|gb|AAL86740.1| deubiquitinating enzyme UBH1 [Mus mus... 44 0.010
gi|34328057|ref|NP_035799.1| ubiquitin specific protease 12; ubi... 44 0.010
gi|24658645|ref|NP_729095.1| CG5505-PB [Drosophila melanogaster]... 44 0.013
gi|24658617|ref|NP_729092.1| CG5505-PD [Drosophila melanogaster]... 44 0.013
gi|28416398|gb|AAO42671.1| AT31021p [Drosophila melanogaster] 44 0.013
gi|33589646|gb|AAQ22589.1| AT24152p [Drosophila melanogaster] 44 0.013
gi|24658632|ref|NP_729094.1| CG5505-PC [Drosophila melanogaster]... 44 0.013
gi|24658624|ref|NP_729093.1| CG5505-PF [Drosophila melanogaster]... 44 0.013
gi|24658638|ref|NP_647986.2| CG5505-PE [Drosophila melanogaster]... 44 0.013
gi|24658609|ref|NP_729091.1| CG5505-PA [Drosophila melanogaster]... 44 0.013
gi|50260872|gb|EAL23522.1| hypothetical protein CNBA1690 [Crypto... 44 0.013
gi|49097682|ref|XP_410301.1| hypothetical protein AN6164.2 [Aspe... 44 0.013
gi|28829270|gb|AAO51812.1| similar to Homo sapiens (Human). Hypo... 44 0.013
gi|18858145|ref|NP_572220.1| CG4165-PA [Drosophila melanogaster]... 44 0.013
gi|38014646|gb|AAH60390.1| LOC398902 protein [Xenopus laevis] 44 0.017
gi|39596712|emb|CAE63331.1| Hypothetical protein CBG07731 [Caeno... 44 0.017
gi|49102299|ref|XP_411050.1| hypothetical protein AN6913.2 [Aspe... 44 0.017
gi|50752807|ref|XP_413755.1| PREDICTED: similar to ubiquitin spe... 44 0.017
gi|34870377|ref|XP_341034.1| similar to Ubiquitin carboxyl-termi... 44 0.017
gi|47210494|emb|CAF91634.1| unnamed protein product [Tetraodon n... 43 0.022
gi|38345453|emb|CAE01619.2| OSJNBa0042L16.8 [Oryza sativa (japon... 43 0.022
gi|5730110|ref|NP_006528.1| ubiquitin specific protease 3 [Homo ... 43 0.022
gi|48474435|sp|Q8BWR4|UB40_MOUSE Ubiquitin carboxyl-terminal hyd... 43 0.029
gi|23595060|ref|XP_129956.2| similar to ubiquitin thiolesterase,... 43 0.029
gi|46806341|dbj|BAD17530.1| putative ubiquitin-specific protease... 43 0.029
gi|11414862|dbj|BAB18534.1| deubiquitinating enzyme UBPY [Mus mu... 43 0.029
gi|19075711|ref|NP_588211.1| putative ubiquitin carboxyl-termina... 43 0.029
gi|50745918|ref|XP_420298.1| PREDICTED: similar to ubiquitin spe... 43 0.029
gi|19112524|ref|NP_595732.1| ubiquitin carboxyl-terminal hydrola... 43 0.029
gi|50746997|ref|XP_420711.1| PREDICTED: similar to RIKEN cDNA 24... 42 0.037
gi|50731231|ref|XP_425636.1| PREDICTED: similar to Ubiquitin car... 42 0.037
gi|39581466|emb|CAE67996.1| Hypothetical protein CBG13606 [Caeno... 42 0.037
gi|46435940|gb|EAK95312.1| hypothetical protein CaO19.9344 [Cand... 42 0.037
gi|50550847|ref|XP_502896.1| hypothetical protein [Yarrowia lipo... 42 0.037
gi|21450103|ref|NP_659186.1| ubiquitin specific protease 3 [Mus ... 42 0.049
gi|30583377|gb|AAP35933.1| ubiquitin specific protease 3 [Homo s... 42 0.049
gi|28829810|gb|AAO52312.1| similar to Dictyostelium discoideum (... 42 0.049
gi|18417689|ref|NP_567860.1| ubiquitin-specific protease 24, put... 42 0.049
gi|31202139|ref|XP_310017.1| ENSANGP00000024243 [Anopheles gambi... 42 0.049
gi|31202133|ref|XP_310014.1| ENSANGP00000015158 [Anopheles gambi... 42 0.049
gi|47681481|gb|AAT37507.1| UBP protein [Homo sapiens] 42 0.049
gi|4028549|gb|AAC97115.1| ubiquitin hydrolase B [Dictyostelium d... 42 0.049
gi|34909932|ref|NP_916313.1| putative ubiquitin carboxyl-termina... 42 0.049
gi|19112481|ref|NP_595689.1| putative ubiquitin carboxyl-termina... 42 0.049
gi|25407694|pir||F85361 hypothetical protein AT4g30890 [imported... 42 0.049
gi|50255043|gb|EAL17783.1| hypothetical protein CNBL2960 [Crypto... 42 0.064
gi|26330810|dbj|BAC29135.1| unnamed protein product [Mus musculus] 42 0.064
gi|18875422|ref|NP_573510.1| ubiquitin specific protease 33; pVH... 42 0.064
gi|31204487|ref|XP_311192.1| ENSANGP00000001529 [Anopheles gambi... 42 0.064
gi|33438289|dbj|BAC65724.2| mKIAA1097 protein [Mus musculus] 42 0.064
gi|13994268|ref|NP_114113.1| ubiquitin-specific protease 26 [Hom... 42 0.064
gi|50511005|dbj|BAD32488.1| mKIAA1594 protein [Mus musculus] 42 0.064
gi|10190742|ref|NP_065954.1| ubiquitin-specific processing prote... 42 0.064
gi|13529590|gb|AAH05506.1| Usp33 protein [Mus musculus] 42 0.064
gi|50751420|ref|XP_422389.1| PREDICTED: similar to ubiquitin spe... 42 0.064
gi|34861078|ref|XP_227811.2| similar to Vdu1-pending protein [Ra... 42 0.064
gi|42516561|ref|NP_963920.1| ubiquitin specific protease 33 isof... 41 0.083
gi|10434504|dbj|BAB14279.1| unnamed protein product [Homo sapiens] 41 0.083
gi|47086035|ref|NP_998392.1| zgc:77308 [Danio rerio] >gnl|BL_ORD... 41 0.083
gi|41704671|sp|Q8TEY7|UB33_HUMAN Ubiquitin carboxyl-terminal hyd... 41 0.083
gi|42516567|ref|NP_055832.3| ubiquitin specific protease 33 isof... 41 0.083
gi|42516565|ref|NP_963918.1| ubiquitin specific protease 33 isof... 41 0.083
gi|18698435|gb|AAL78315.1| pVHL-interacting deubiquitinating enz... 41 0.083
gi|5689531|dbj|BAA83049.1| KIAA1097 protein [Homo sapiens] 41 0.083
gi|34864281|ref|XP_343416.1| similar to ubiquitin specific prote... 41 0.11
gi|34883277|ref|XP_347258.1| similar to Sorbitol dehydrogenase (... 41 0.11
gi|11993471|gb|AAG42754.1| ubiquitin-specific protease 12 [Arabi... 41 0.11
gi|47223359|emb|CAG04220.1| unnamed protein product [Tetraodon n... 41 0.11
gi|18415260|ref|NP_568171.1| ubiquitin-specific protease 12 (UBP... 41 0.11
gi|34877607|ref|XP_237371.2| similar to Sorbitol dehydrogenase (... 41 0.11
gi|6671947|gb|AAF23207.1| putative ubiquitin carboxyl-terminal h... 41 0.11
gi|13374862|emb|CAC34496.1| ubiquitin-specific protease-like pro... 41 0.11
gi|18420426|ref|NP_568411.1| ubiquitin-specific protease 8, puta... 41 0.11
gi|30681531|ref|NP_850783.1| ubiquitin-specific protease 12 (UBP... 41 0.11
gi|30681938|ref|NP_187797.3| ubiquitin-specific protease, putati... 41 0.11
gi|10998129|dbj|BAB17021.1| ubiquitin carboxyl-terminal hydrolas... 41 0.11
gi|10178116|dbj|BAB11409.1| ubiquitin carboxyl-terminal hydrolas... 41 0.11
gi|17554556|ref|NP_499162.1| ubiquitin-specific protease, possib... 41 0.11
gi|31220351|ref|XP_316911.1| ENSANGP00000006552 [Anopheles gambi... 41 0.11
gi|10946630|ref|NP_067298.1| ubiquitin specific protease 29; oss... 40 0.14
gi|29245968|gb|EAA37583.1| GLP_503_22898_18957 [Giardia lamblia ... 40 0.14
gi|39591948|emb|CAE75168.1| Hypothetical protein CBG23105 [Caeno... 40 0.14
gi|39590736|emb|CAE65108.1| Hypothetical protein CBG09971 [Caeno... 40 0.14
gi|47219296|emb|CAG10925.1| unnamed protein product [Tetraodon n... 40 0.14
gi|13878221|ref|NP_113565.1| ubiquitin specific protease 26 [Mus... 40 0.14
gi|24654914|ref|NP_728554.1| CG32479-PA [Drosophila melanogaster... 40 0.19
gi|50731301|ref|XP_417222.1| PREDICTED: similar to Ubiquitin car... 40 0.19
gi|50419423|ref|XP_458238.1| unnamed protein product [Debaryomyc... 40 0.19
gi|49523089|gb|AAH75590.1| Unknown (protein for MGC:89592) [Xeno... 40 0.19
gi|48100286|ref|XP_394990.1| similar to ENSANGP00000005611 [Apis... 40 0.19
gi|17533797|ref|NP_495929.1| drosophila fat facets related -link... 40 0.19
gi|27696471|gb|AAH44050.1| LOC398530 protein [Xenopus laevis] 40 0.19
gi|47219848|emb|CAF97118.1| unnamed protein product [Tetraodon n... 40 0.19
gi|50755437|ref|XP_414742.1| PREDICTED: similar to Ubiquitin car... 40 0.24
gi|47225852|emb|CAF98332.1| unnamed protein product [Tetraodon n... 40 0.24
gi|31218597|ref|XP_316682.1| ENSANGP00000011299 [Anopheles gambi... 40 0.24
gi|46444545|gb|EAL03819.1| hypothetical protein CaO19.1516 [Cand... 40 0.24
gi|48474402|sp|Q86T82|UB37_HUMAN Ubiquitin carboxyl-terminal hyd... 40 0.24
gi|41053915|ref|NP_956267.1| ubiquitin specific protease 14; wu:... 40 0.24
gi|46431699|gb|EAK91232.1| hypothetical protein CaO19.6319 [Cand... 40 0.24
gi|50406959|ref|XP_456675.1| unnamed protein product [Debaryomyc... 40 0.24
gi|18394440|ref|NP_564014.1| ubiquitin-specific protease 15 (UBP... 40 0.24
gi|25511641|pir||H86306 F20D23.20 protein - Arabidopsis thaliana... 40 0.24
gi|32766667|gb|AAH55192.1| Zgc:63661 protein [Danio rerio] 40 0.24
gi|10434108|dbj|BAB14133.1| unnamed protein product [Homo sapiens] 39 0.32
gi|47230410|emb|CAF99603.1| unnamed protein product [Tetraodon n... 39 0.32
gi|34854476|ref|XP_341775.1| similar to ubiquitin-specific proce... 39 0.32
gi|46123459|ref|XP_386283.1| hypothetical protein FG06107.1 [Gib... 39 0.32
gi|39587259|emb|CAE57727.1| Hypothetical protein CBG00738 [Caeno... 39 0.32
gi|124738|sp|P24711|INVO_TARBA Involucrin >gnl|BL_ORD_ID|1371644... 39 0.32
gi|11993475|gb|AAG42756.1| ubiquitin-specific protease 15 [Arabi... 39 0.32
gi|10047263|dbj|BAB13420.1| KIAA1594 protein [Homo sapiens] 39 0.32
gi|29243896|ref|NP_808229.1| RIKEN cDNA 2410018I08 [Mus musculus... 39 0.41
gi|34869873|ref|XP_233217.2| similar to Ubiquitin carboxyl-termi... 39 0.41
gi|49522494|gb|AAH75544.1| Unknown (protein for MGC:89480) [Xeno... 39 0.41
gi|28277342|gb|AAH44285.1| Usp10-prov protein [Xenopus laevis] 39 0.41
gi|6325184|ref|NP_015253.1| Putative ubiquitin-specific protease... 39 0.41
gi|34859143|ref|XP_230564.2| similar to RIKEN cDNA 4930511O11 [R... 39 0.41
gi|6323879|ref|NP_013950.1| Ubiquitin-specific protease that is ... 39 0.41
gi|50753920|ref|XP_414179.1| PREDICTED: similar to hypothetical ... 39 0.41
gi|39597561|emb|CAE59791.1| Hypothetical protein CBG03251 [Caeno... 39 0.41
gi|50729895|ref|XP_416693.1| PREDICTED: similar to Ubiquitin spe... 39 0.41
gi|31543910|ref|NP_003359.3| ubiquitin specific protease 1; ubiq... 39 0.41
gi|4206175|gb|AAD11441.1| ubiquitin-specific protease [Homo sapi... 39 0.41
gi|50757323|ref|XP_415470.1| PREDICTED: similar to bA409K20.4 (u... 39 0.54
gi|50408270|ref|XP_456767.1| unnamed protein product [Debaryomyc... 39 0.54
gi|23208620|gb|AAN15803.1| pVHL-interacting deubiquitinating enz... 39 0.54
gi|30794162|ref|NP_083122.1| ubiquitin specific protease 20 [Mus... 39 0.54
gi|18043171|gb|AAH20007.1| Usp1 protein [Mus musculus] 39 0.54
gi|12643376|sp|Q9Y2K6|UB20_HUMAN Ubiquitin carboxyl-terminal hyd... 39 0.54
gi|31543912|ref|NP_006667.2| ubiquitin specific protease 20; pVH... 39 0.54
gi|15787712|emb|CAC88170.1| bA409K20.4 (ubiquitin specific prote... 39 0.54
gi|28514900|ref|XP_126772.2| RIKEN cDNA 2700002L06 [Mus musculus] 39 0.54
gi|27374327|gb|AAO01072.1| CG30421-PA [Drosophila virilis] 39 0.54
gi|49071930|ref|XP_400254.1| hypothetical protein UM02639.1 [Ust... 39 0.54
gi|40789018|dbj|BAA76847.2| KIAA1003 protein [Homo sapiens] 39 0.54
gi|24583343|ref|NP_609377.1| CG5384-PA [Drosophila melanogaster]... 39 0.54
gi|26335205|dbj|BAC31303.1| unnamed protein product [Mus musculus] 39 0.54
gi|50729034|ref|XP_416398.1| PREDICTED: similar to Ubl carboxyl-... 39 0.54
gi|50510751|dbj|BAD32361.1| mKIAA1003 protein [Mus musculus] 39 0.54
gi|34853534|ref|XP_231148.2| similar to Ubiquitin carboxyl-termi... 39 0.54
gi|37360390|dbj|BAC98173.1| mKIAA1453 protein [Mus musculus] 39 0.54
gi|34859340|ref|XP_232259.2| similar to ubiquitin specific prote... 39 0.54
gi|47219080|emb|CAG00219.1| unnamed protein product [Tetraodon n... 38 0.70
gi|31981898|ref|NP_666256.2| ubiquitin specific protease 1 [Mus ... 38 0.70
gi|17390390|gb|AAH18179.1| Ubiquitin specific protease 1 [Mus mu... 38 0.70
gi|50549747|ref|XP_502344.1| hypothetical protein [Yarrowia lipo... 38 0.70
gi|34881851|ref|XP_219843.2| similar to Ubiquitin carboxyl-termi... 38 0.70
gi|46227659|gb|EAK88594.1| Ub6p like ubiquitin at N-terminus and... 38 0.70
gi|45190578|ref|NP_984832.1| AEL029Wp [Eremothecium gossypii] >g... 38 0.70
gi|46444397|gb|EAL03672.1| hypothetical protein CaO19.9091 [Cand... 38 0.70
gi|24762724|ref|NP_611959.2| CG30421-PA [Drosophila melanogaster... 38 0.70
gi|13195676|ref|NP_077220.1| ubiquitin specific protease 16 [Mus... 38 0.70
gi|32766401|gb|AAH54934.1| LOC402834 protein [Danio rerio] 38 0.70
gi|25152734|ref|NP_510570.2| 1 -interacting deubiquitinating enz... 38 0.92
gi|25403162|pir||C86453 CDS protein F9L11.5 [imported] - Arabido... 38 0.92
gi|19113320|ref|NP_596528.1| possible ubiquitin carboxyl-termina... 38 0.92
gi|18257332|gb|AAH21769.1| Usp31 protein [Mus musculus] 38 0.92
gi|34867519|ref|XP_213676.2| similar to ubiquitin specific prote... 38 0.92
gi|42562472|ref|NP_174562.2| ubiquitin carboxyl-terminal hydrola... 38 0.92
gi|7505617|pir||T23531 hypothetical protein K09A9.4 - Caenorhabd... 38 0.92
gi|34902450|ref|NP_912571.1| Putative ubiquitin-specific proteas... 37 1.2
gi|38106953|gb|EAA53191.1| hypothetical protein MG07468.4 [Magna... 37 1.2
gi|32399031|emb|CAD98271.1| ubiquitin-specific protease, probabl... 37 1.2
gi|18403083|ref|NP_565753.1| ubiquitin-specific protease 1, puta... 37 1.2
gi|37747736|gb|AAH60022.1| MGC68701 protein [Xenopus laevis] 37 1.2
gi|30585387|gb|AAP36966.1| Homo sapiens ubiquitin specific prote... 37 1.2
gi|19112133|ref|NP_595341.1| ubiquitin carboxyl-terminal hydrola... 37 1.2
gi|49128199|ref|XP_412836.1| hypothetical protein AN8699.2 [Aspe... 37 1.2
gi|6014652|gb|AAF01440.1| ubiquitin carboxyl-terminal hydrolase ... 37 1.2
gi|19075305|ref|NP_587805.1| ubiquitin carboxyl-terminal hydrola... 37 1.2
gi|23509540|ref|NP_702207.1| hypothetical protein [Plasmodium fa... 37 1.2
gi|40788035|emb|CAE51939.1| ubiquitin-specific proteinase 49 [Ho... 37 1.2
gi|47169482|tpe|CAE48378.1| TPA: ubiquitin specific protease 52 ... 37 1.2
gi|21361749|ref|NP_061031.2| ubiquitin specific protease 49 [Hom... 37 1.2
gi|15451368|dbj|BAB64488.1| hypothetical protein [Macaca fascicu... 37 1.2
gi|15208127|dbj|BAB63088.1| hypothetical protein [Macaca fascicu... 37 1.2
gi|23485702|gb|EAA20533.1| Ubiquitin carboxyl-terminal hydrolase... 37 1.2
gi|18405549|ref|NP_565944.1| ubiquitin-specific protease 5, puta... 37 1.2
gi|4827050|ref|NP_005142.1| ubiquitin specific protease 14 [Homo... 37 1.2
gi|18390446|ref|NP_563719.1| ubiquitin-specific protease 2 (UBP2... 37 1.2
gi|29789349|ref|NP_598753.1| ubiquitin specific protease 52 [Mus... 37 1.2
gi|38503277|sp|P60051|UB14_PANTR Ubiquitin carboxyl-terminal hyd... 37 1.2
gi|730934|sp|P40826|UB14_RABIT Ubiquitin carboxyl-terminal hydro... 37 1.2
gi|38105945|gb|EAA52310.1| hypothetical protein MG05002.4 [Magna... 37 1.2
gi|47222151|emb|CAG11577.1| unnamed protein product [Tetraodon n... 37 1.6
gi|50257163|gb|EAL19876.1| hypothetical protein CNBG0190 [Crypto... 37 1.6
gi|50425649|ref|XP_461421.1| unnamed protein product [Debaryomyc... 37 1.6
gi|46227980|gb|EAK88900.1| ubiquitin C-terminal hydrolase of the... 37 1.6
gi|50289653|ref|XP_447258.1| unnamed protein product [Candida gl... 37 1.6
gi|23613403|ref|NP_703247.1| ubiquitin carboxyl-terminal hydrola... 37 1.6
gi|49522029|gb|AAH74641.1| Unknown (protein for MGC:69343) [Xeno... 37 1.6
gi|47220322|emb|CAF98421.1| unnamed protein product [Tetraodon n... 37 1.6
gi|47226066|emb|CAG04440.1| unnamed protein product [Tetraodon n... 37 1.6
gi|32698744|ref|NP_065986.1| ubiquitin specific protease 37 [Hom... 37 1.6
gi|50750618|ref|XP_422065.1| PREDICTED: similar to KIAA1594 prot... 37 1.6
gi|31211893|ref|XP_314931.1| ENSANGP00000001119 [Anopheles gambi... 37 1.6
gi|50305727|ref|XP_452824.1| unnamed protein product [Kluyveromy... 37 1.6
gi|27374272|gb|AAO01028.1| CG30421-PA [Drosophila pseudoobscura] 37 1.6
gi|39580778|emb|CAE58947.1| Hypothetical protein CBG02215 [Caeno... 37 1.6
gi|50737088|ref|XP_419150.1| PREDICTED: similar to Ubiquitin car... 37 2.0
gi|34851817|ref|XP_226528.2| similar to Ubiquintin c-terminal hy... 37 2.0
gi|37359830|dbj|BAC97893.1| mKIAA0190 protein [Mus musculus] 37 2.0
gi|18413358|ref|NP_567363.1| ubiquitin carboxyl-terminal hydrola... 37 2.0
gi|34541984|gb|AAQ74886.1| UBP [Gallus gallus] 37 2.0
gi|7487641|pir||T04194 hypothetical protein T4F9.50 - Arabidopsi... 37 2.0
gi|31873306|emb|CAD97644.1| hypothetical protein [Homo sapiens] 37 2.0
gi|26350047|dbj|BAC38663.1| unnamed protein product [Mus musculus] 37 2.0
gi|10434580|dbj|BAB14306.1| unnamed protein product [Homo sapiens] 37 2.0
gi|50747728|ref|XP_420965.1| PREDICTED: similar to ubiquitin spe... 37 2.0
gi|32417262|ref|XP_329109.1| hypothetical protein [Neurospora cr... 37 2.0
gi|50405221|ref|YP_054313.1| Ubiquitin-specific protease, putati... 37 2.0
gi|24659445|gb|AAH38983.1| Unknown (protein for IMAGE:5756922) [... 37 2.0
gi|2501458|sp|Q14694|UB10_HUMAN Ubiquitin carboxyl-terminal hydr... 37 2.0
gi|45383223|ref|NP_989802.1| UBP [Gallus gallus] >gnl|BL_ORD_ID|... 37 2.0
gi|24307889|ref|NP_005144.1| ubiquitin specific protease 10 [Hom... 37 2.0
gi|34541986|gb|AAQ74887.1| UBP [Gallus gallus] 37 2.0
gi|46123415|ref|XP_386261.1| hypothetical protein FG06085.1 [Gib... 37 2.0
gi|7959165|dbj|BAA95977.1| KIAA1453 protein [Homo sapiens] 37 2.0
gi|6678493|ref|NP_033488.1| ubiquitin specific protease 10; ubiq... 37 2.0
gi|47940448|gb|AAH71582.1| USP36 protein [Homo sapiens] 37 2.0
gi|32700079|sp|P52479|UB10_MOUSE Ubiquitin carboxyl-terminal hyd... 37 2.0
gi|7023072|dbj|BAA91825.1| unnamed protein product [Homo sapiens] 37 2.0
gi|1136438|dbj|BAA11507.1| KIAA0190 [Homo sapiens] 37 2.0
gi|17510895|ref|NP_492736.1| ubiquitin 2 (1L42) [Caenorhabditis ... 37 2.0
gi|11360280|pir||T47164 hypothetical protein DKFZp762E1712.1 - h... 37 2.0
gi|38259220|ref|NP_940813.1| hypothetical protein C330046L10 [Mu... 37 2.0
gi|35250686|ref|NP_079366.2| ubiquitin specific protease 36 [Hom... 37 2.0
gi|34877263|ref|XP_214034.2| similar to CG7023-PA [Rattus norveg... 36 2.7
gi|48928014|ref|NP_598519.2| ubiquitin specific protease 47 [Mus... 36 2.7
gi|26334557|dbj|BAC30979.1| unnamed protein product [Mus musculus] 36 2.7
gi|48094643|ref|XP_392160.1| similar to ENSANGP00000001119 [Apis... 36 2.7
gi|45199145|ref|NP_986174.1| AFR627Cp [Eremothecium gossypii] >g... 36 2.7
gi|34913872|ref|NP_918283.1| putative ubiquitin-specific protein... 36 2.7
gi|49095724|ref|XP_409323.1| hypothetical protein AN5186.2 [Aspe... 36 2.7
gi|48125083|ref|XP_396574.1| hypothetical protein XP_396574 [Api... 36 2.7
gi|46122169|ref|XP_385638.1| hypothetical protein FG05462.1 [Gib... 36 2.7
gi|4115922|gb|AAD03433.1| contains similarity to ubiquitin carbo... 36 2.7
gi|17554250|ref|NP_497413.1| putative protein, with a coiled coi... 36 2.7
gi|50302163|ref|XP_451015.1| unnamed protein product [Kluyveromy... 36 2.7
gi|25349746|pir||A96556 probable tRNA-guaninine transglycosylase... 36 2.7
gi|11993465|gb|AAG42751.1| ubiquitin-specific protease 6 [Arabid... 36 2.7
gi|18403643|ref|NP_564596.1| ubiquitin-specific protease 6, puta... 36 2.7
gi|45501059|gb|AAH67261.1| USP48 protein [Homo sapiens] 36 2.7
gi|5454156|ref|NP_006438.1| ubiquitin specific protease 16 isofo... 36 2.7
gi|47219352|emb|CAG10981.1| unnamed protein product [Tetraodon n... 36 2.7
gi|15079488|gb|AAH11576.1| USP48 protein [Homo sapiens] 36 2.7
gi|42566404|ref|NP_192795.3| ubiquitin carboxyl-terminal hydrola... 36 2.7
gi|50312664|ref|NP_001001992.1| ubiquitin specific protease 16 i... 36 2.7
gi|21314967|gb|AAH30777.1| Ubiquitin specific protease 16, isofo... 36 2.7
gi|10439903|dbj|BAB15591.1| unnamed protein product [Homo sapiens] 36 2.7
gi|11640586|gb|AAG39290.1| MSTP039 [Homo sapiens] 36 2.7
gi|47229640|emb|CAG06836.1| unnamed protein product [Tetraodon n... 36 2.7
gi|32406120|ref|XP_323673.1| hypothetical protein [Neurospora cr... 36 2.7
gi|30315217|gb|AAP30832.1| ubiquitin-specific protease 31 [Homo ... 36 2.7
gi|47220071|emb|CAG12219.1| unnamed protein product [Tetraodon n... 36 2.7
gi|34877885|ref|XP_214624.2| similar to ubiquitin specific prote... 36 2.7
gi|31560313|ref|NP_067497.2| ubiquitin specific protease 14; dUB... 36 2.7
gi|7415810|dbj|BAA93551.1| deubiquitinating enzyme [Mus musculus] 36 2.7
gi|12847371|dbj|BAB27544.1| unnamed protein product [Mus musculus] 36 2.7
gi|18860907|ref|NP_115612.3| ubiquitin specific protease 48; ubi... 36 2.7
gi|34851150|gb|AAQ82908.1| ubiquitin-specific protease 7 isoform... 36 2.7
gi|47225945|emb|CAG04319.1| unnamed protein product [Tetraodon n... 36 2.7
gi|31202867|ref|XP_310382.1| ENSANGP00000005611 [Anopheles gambi... 36 2.7
gi|6320081|ref|NP_010161.1| Ubiquitin-specific protease that rem... 36 2.7
gi|136683|sp|P25037|UBP1_YEAST UBIQUITIN CARBOXYL-TERMINAL HYDRO... 36 2.7
gi|30584279|gb|AAP36388.1| Homo sapiens ubiquitin specific prote... 36 3.5
gi|40795667|ref|NP_955475.1| USP4; Unph; ubiquitin specific prot... 36 3.5
gi|7487236|pir||T00757 probable ubiquitin carboxyl terminal hydr... 36 3.5
gi|34785787|gb|AAH57482.1| Wu:fi15g04 protein [Danio rerio] 36 3.5
gi|48103467|ref|XP_395580.1| similar to CG8830-PA [Apis mellifera] 36 3.5
gi|4507857|ref|NP_003461.1| ubiquitin specific protease 7 (herpe... 36 3.5
gi|39588695|emb|CAE58219.1| Hypothetical protein CBG01315 [Caeno... 36 3.5
gi|542487|pir||S40715 hypothetical protein R10E11.3 - Caenorhabd... 36 3.5
gi|21361712|ref|NP_004196.3| ubiquitin specific protease 2 isofo... 36 3.5
gi|20141855|sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hyd... 36 3.5
gi|23613293|ref|NP_703615.1| ubiquitin carboxyl-terminal hydrola... 36 3.5
gi|47218339|emb|CAG04171.1| unnamed protein product [Tetraodon n... 36 3.5
gi|2137412|pir||I58376 hypothetical protein unp - mouse 36 3.5
gi|28373982|pdb|1NBF|A Chain A, Crystal Structure Of A Ubp-Famil... 36 3.5
gi|26349543|dbj|BAC38411.1| unnamed protein product [Mus musculus] 36 3.5
gi|40795665|ref|NP_003354.2| ubiquitin specific protease, proto-... 36 3.5
gi|3123303|sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydr... 36 3.5
gi|28502773|gb|AAH47168.1| Wu:fi15g04 protein [Danio rerio] 36 3.5
gi|42407644|dbj|BAD08758.1| ubiquitin-specific protease-like [Or... 36 3.5
gi|17064774|gb|AAL32541.1| Unknown protein [Arabidopsis thaliana] 36 3.5
gi|38080163|ref|XP_148584.4| similar to Ubiquitin carboxyl-termi... 36 3.5
gi|34868276|ref|XP_340748.1| similar to Ubiquitin carboxyl-termi... 36 3.5
gi|6755943|ref|NP_035808.1| ubiquitin specific protease 4 (proto... 36 3.5
gi|38076192|ref|XP_130778.2| similar to ubiquitin specific prote... 36 3.5
gi|47229944|emb|CAG10358.1| unnamed protein product [Tetraodon n... 36 3.5
gi|19074341|ref|NP_585847.1| UBIQUITIN CARBOXYL-TERMINAL HYDROLA... 35 4.6
gi|27503316|gb|AAH42353.1| LOC398480 protein [Xenopus laevis] 35 4.6
gi|19115029|ref|NP_594117.1| putative ubiquitin carboxyl-termina... 35 4.6
gi|34874725|ref|XP_236919.2| similar to hypothetical protein MGC... 35 4.6
gi|50292819|ref|XP_448842.1| unnamed protein product [Candida gl... 35 4.6
gi|7507228|pir||T24559 hypothetical protein T05H10.1 - Caenorhab... 35 4.6
gi|24653045|ref|NP_610784.1| CG8830-PA [Drosophila melanogaster]... 35 4.6
gi|34784440|gb|AAH57470.1| Unknown (protein for IMAGE:5413509) [... 35 4.6
gi|20160905|dbj|BAB89842.1| putative ubiquitin carboxyl-terminal... 35 4.6
gi|32414833|ref|XP_327896.1| hypothetical protein [Neurospora cr... 35 4.6
gi|24431982|ref|NP_060414.2| ubiquitin specific protease 47 [Hom... 35 6.0
gi|50727049|gb|AAB71016.3| Transporter of sr proteins protein 1 ... 35 6.0
gi|50546843|ref|XP_500891.1| hypothetical protein [Yarrowia lipo... 35 6.0
gi|50427217|ref|XP_462221.1| unnamed protein product [Debaryomyc... 35 6.0
gi|32564969|ref|NP_494279.2| transporter of SR proteins (tsr-1) ... 35 6.0
gi|45199069|ref|NP_986098.1| AFR551Wp [Eremothecium gossypii] >g... 35 6.0
gi|49522486|gb|AAH75532.1| Unknown (protein for IMAGE:6990711) [... 35 6.0
gi|46438280|gb|EAK97613.1| hypothetical protein CaO19.7367 [Cand... 35 6.0
gi|16768276|gb|AAL28357.1| GH27809p [Drosophila melanogaster] 35 6.0
gi|47230636|emb|CAF99829.1| unnamed protein product [Tetraodon n... 35 6.0
gi|50426667|ref|XP_461931.1| unnamed protein product [Debaryomyc... 35 6.0
gi|42415503|ref|NP_065769.2| ubiquitin specific protease 31; ubi... 35 6.0
gi|7504100|pir||T32381 hypothetical protein F53G2.6 - Caenorhabd... 35 6.0
gi|47226065|emb|CAG04439.1| unnamed protein product [Tetraodon n... 35 6.0
gi|47230431|emb|CAF99624.1| unnamed protein product [Tetraodon n... 35 6.0
gi|48098839|ref|XP_394835.1| similar to CG5065-PA [Apis mellifera] 35 6.0
gi|47225719|emb|CAG08062.1| unnamed protein product [Tetraodon n... 35 6.0
gi|5852120|emb|CAB55365.1| putative ubiquitin carboxy-terminal h... 35 6.0
gi|4115923|gb|AAD03434.1| contains similarity to ubiquitin carbo... 35 7.8
gi|23478403|gb|EAA15501.1| tRNA-guaninine transglycosylase, puta... 35 7.8
gi|7495349|pir||T25509 hypothetical protein C04E6.5 - Caenorhabd... 35 7.8
gi|34860013|ref|XP_218997.2| similar to hypothetical protein FLJ... 35 7.8
gi|49067402|ref|XP_397991.1| hypothetical protein UM00376.1 [Ust... 35 7.8
gi|28804572|dbj|BAC57984.1| ubiquitin carboxyl-terminal hydrolas... 35 7.8
gi|27371223|gb|AAH41366.1| USP2 protein [Homo sapiens] 35 7.8
gi|50308685|ref|XP_454346.1| unnamed protein product [Kluyveromy... 35 7.8
gi|24641480|ref|NP_572779.2| CG1490-PB [Drosophila melanogaster]... 35 7.8
gi|38106578|gb|EAA52868.1| hypothetical protein MG05996.4 [Magna... 35 7.8
gi|17557588|ref|NP_504537.1| ubiquitin-specific protease family ... 35 7.8
gi|29504794|gb|AAH50197.1| Usp14 protein [Mus musculus] 35 7.8
>gi|32564647|ref|NP_497422.2| ubiquitin thiolesterase, family 2
(3C659) [Caenorhabditis elegans]
gi|26251691|gb|AAK27886.2| Hypothetical protein Y67D2.2
[Caenorhabditis elegans]
Length = 431
Score = 745 bits (1924), Expect = 0.0
Identities = 369/393 (93%), Positives = 369/393 (93%)
Frame = +1
Query: 1 MDLRGYSPQTIXXXXXXXXXXXXXXXYAFLTSRNGEEASSSRLVPGLANQGNTCYMNALL 180
MDLRGYSPQTI YAFLTSRNGEEASSSRLVPGLANQGNTCYMNALL
Sbjct: 1 MDLRGYSPQTIVAGTLIGGTLAAAVTYAFLTSRNGEEASSSRLVPGLANQGNTCYMNALL 60
Query: 181 QGLASCPSFVGWLKSLKPQDIGIQGGFVDHLSNLLHLLNEPTGSTLTAQSIVESLKAHGW 360
QGLASCPSFVGWLKSLKPQDIGIQGGFVDHLSNLLHLLNEPTGSTLTAQSIVESLKAHGW
Sbjct: 61 QGLASCPSFVGWLKSLKPQDIGIQGGFVDHLSNLLHLLNEPTGSTLTAQSIVESLKAHGW 120
Query: 361 SITVGVEHDLYELFNVFVTTWEDELKSSRRILMNQSIENCHXXXXXXXXXVVRFGRGKLA 540
SITVGVEHDLYELFNVFVTTWEDELKSSRRILMNQSIENCH VVRFGRGKLA
Sbjct: 121 SITVGVEHDLYELFNVFVTTWEDELKSSRRILMNQSIENCHSSSSEDDEDVVRFGRGKLA 180
Query: 541 KNRTVKYESFTVLTLAIPNSQMGTSTNTESLLRRFFCSEIIRDAICDKCRASDRKQQGFL 720
KNRTVKYESFTVLTLAIPNSQMGTSTNTESLLRRFFCSEIIRDAICDKCRASDRKQQGFL
Sbjct: 181 KNRTVKYESFTVLTLAIPNSQMGTSTNTESLLRRFFCSEIIRDAICDKCRASDRKQQGFL 240
Query: 721 KKHGIVKLPQTLMIRIERVGMLPNGSMKLSEHVHFGECLSLQDVCFRKNPKINQKSYEES 900
KKHGIVKLPQTLMIRIERVGMLPNGSMKLSEHVHFGECLSLQDVCFRKNPKINQKSYEES
Sbjct: 241 KKHGIVKLPQTLMIRIERVGMLPNGSMKLSEHVHFGECLSLQDVCFRKNPKINQKSYEES 300
Query: 901 SLHWQLPDGTSRVVGGAEETRSRRSPIHPSQAAIFGDLASNYALIDGGSFVAERREAQKY 1080
SLHWQLPDGTSRVVGGAEETRSRRSPIHPSQAAIFGDLASNYALIDGGSFVAERREAQKY
Sbjct: 301 SLHWQLPDGTSRVVGGAEETRSRRSPIHPSQAAIFGDLASNYALIDGGSFVAERREAQKY 360
Query: 1081 AYQLRAVSEHRGGPYSGHFVTYRRASAPNHHTW 1179
AYQLRAVSEHRGGPYSGHFVTYRRASAPNHHTW
Sbjct: 361 AYQLRAVSEHRGGPYSGHFVTYRRASAPNHHTW 393
Score = 71.2 bits (173), Expect = 8e-11
Identities = 32/32 (100%), Positives = 32/32 (100%)
Frame = +2
Query: 1523 QVTRVPYSHVAACQSYMLFYERVKPHRLYERM 1618
QVTRVPYSHVAACQSYMLFYERVKPHRLYERM
Sbjct: 400 QVTRVPYSHVAACQSYMLFYERVKPHRLYERM 431