Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y69A2AR_5
(900 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17544026|ref|NP_500214.1| ATP synthase mitochondrial (32.4 kD... 538 e-152
gi|39581406|emb|CAE74688.1| Hypothetical protein CBG22500 [Caeno... 482 e-135
gi|17544028|ref|NP_500213.1| ATP synthase mitochondrial (4D261) ... 449 e-125
gi|32565975|ref|NP_872093.1| h+-transporting two-sector ATPase, ... 306 5e-82
gi|31224910|ref|XP_317504.1| ENSANGP00000010167 [Anopheles gambi... 298 1e-79
gi|24651125|ref|NP_524550.1| CG7610-PA [Drosophila melanogaster]... 298 1e-79
gi|543874|sp|P05631|ATPG_BOVIN ATP synthase gamma chain, mitocho... 295 1e-78
gi|162717|gb|AAA30398.1| ATP synthase gamma subunit precursor 295 1e-78
gi|50731535|ref|XP_417296.1| PREDICTED: similar to ATP synthase ... 293 4e-78
gi|46329488|gb|AAH68867.1| MGC82276 protein [Xenopus laevis] 291 2e-77
gi|1827815|pdb|1COW|G Chain G, Bovine Mitochondrial F1-Atpase Co... 291 2e-77
gi|50345988|ref|NP_001001973.1| ATP synthase, H+ transporting, m... 289 5e-77
gi|4885079|ref|NP_005165.1| ATP synthase, H+ transporting, mitoc... 289 5e-77
gi|19684029|gb|AAH26049.1| Unknown (protein for IMAGE:4908447) [... 289 5e-77
gi|48734669|gb|AAH72367.1| Atp5c1-prov protein [Xenopus laevis] 289 7e-77
gi|16877071|gb|AAH16812.1| ATP synthase, H+ transporting, mitoch... 287 2e-76
gi|21263432|sp|Q91VR2|ATPG_MOUSE ATP synthase gamma chain, mitoc... 287 3e-76
gi|11602916|ref|NP_065640.1| ATP synthase, H+ transporting, mito... 286 3e-76
gi|39930503|ref|NP_446277.1| ATP synthase, H+ transporting, mito... 286 4e-76
gi|27882460|gb|AAH44680.1| Atp5c1-prov protein [Xenopus laevis] 285 1e-75
gi|46561754|gb|AAT01082.1| putative mitochondrial ATP synthase g... 285 1e-75
gi|12840425|dbj|BAB24848.1| unnamed protein product [Mus musculus] 284 2e-75
gi|26353108|dbj|BAC40184.1| unnamed protein product [Mus musculus] 283 4e-75
gi|45478238|gb|AAS66290.1| LRRGT00199 [Rattus norvegicus] 282 6e-75
gi|728931|sp|P35435|ATPG_RAT ATP synthase gamma chain, mitochond... 282 6e-75
gi|14009439|dbj|BAB47390.1| mitochondrial ATP synthase gamma-sub... 281 1e-74
gi|41152375|ref|NP_956335.1| mitochondrial ATP synthase gamma-su... 280 3e-74
gi|6729936|pdb|1MAB|G Chain G, Rat Liver F1-Atpase >gnl|BL_ORD_I... 276 4e-73
gi|46124995|ref|XP_387051.1| hypothetical protein FG06875.1 [Gib... 190 4e-47
gi|32422135|ref|XP_331511.1| hypothetical protein [Neurospora cr... 186 6e-46
gi|38099338|gb|EAA46695.1| hypothetical protein MG09916.4 [Magna... 186 8e-46
gi|49077766|ref|XP_402705.1| hypothetical protein UM05090.1 [Ust... 185 1e-45
gi|46439583|gb|EAK98899.1| hypothetical protein CaO19.10734 [Can... 179 6e-44
gi|49084372|ref|XP_404389.1| hypothetical protein AN0252.2 [Aspe... 178 1e-43
gi|50425305|ref|XP_461246.1| unnamed protein product [Debaryomyc... 172 7e-42
gi|50303785|ref|XP_451839.1| ATPG_KLULA [Kluyveromyces lactis] >... 171 2e-41
gi|599905|emb|CAA39064.1| mitochondrial F1-ATPase gamma-subunit ... 170 5e-41
gi|50555031|ref|XP_504924.1| hypothetical protein [Yarrowia lipo... 169 6e-41
gi|45185512|ref|NP_983228.1| ACL176Wp [Eremothecium gossypii] >g... 168 1e-40
gi|50258010|gb|EAL20704.1| hypothetical protein CNBE0690 [Crypto... 167 2e-40
gi|11466530|ref|NP_044779.1| ATP synthase F1 subunit alpha [Recl... 166 7e-40
gi|47218287|emb|CAG04119.1| unnamed protein product [Tetraodon n... 161 8e-40
gi|38048087|gb|AAR09946.1| similar to Drosophila melanogaster AT... 165 1e-39
gi|19112222|ref|NP_595430.1| atp synthase gamma chain, mitochond... 164 3e-39
gi|543867|sp|P26360|ATP3_IPOBA ATP synthase gamma chain, mitocho... 163 4e-39
gi|6319513|ref|NP_009595.1| Gamma subunit of the F1 sector of mi... 163 4e-39
gi|37359704|dbj|BAC97840.1| F1F0-ATPase gamma subunit [Saccharom... 163 6e-39
gi|15227257|ref|NP_180863.1| ATP synthase gamma chain, mitochond... 160 3e-38
gi|7436158|pir||T01103 probable H+-transporting two-sector ATPas... 160 3e-38
gi|50290043|ref|XP_447453.1| unnamed protein product [Candida gl... 160 4e-38
gi|22530902|gb|AAM96955.1| mitochondrial F1-ATPase, gamma subuni... 159 6e-38
gi|48764966|ref|ZP_00269517.1| COG0224: F0F1-type ATP synthase, ... 155 2e-36
gi|38048421|gb|AAR10113.1| similar to Drosophila melanogaster AT... 150 3e-35
gi|35187468|gb|AAQ84325.1| fiber protein Fb33 [Gossypium barbade... 146 5e-34
gi|23490546|gb|EAA22297.1| ATP synthase F1, gamma subunit [Plasm... 144 3e-33
gi|114641|sp|P05436|ATPG_RHOBL ATP synthase gamma chain >gnl|BL_... 140 3e-32
gi|46201337|ref|ZP_00055253.2| COG0224: F0F1-type ATP synthase, ... 140 5e-32
gi|23619051|ref|NP_705013.1| ATP synthase gamma chain, mitochond... 139 7e-32
gi|48848347|ref|ZP_00302593.1| COG0224: F0F1-type ATP synthase, ... 137 2e-31
gi|2058301|emb|CAA73233.1| ATP synthase, gamma subunit [Drosophi... 137 3e-31
gi|37532654|ref|NP_920629.1| putative ATP SYNTHASE GAMMA CHAIN, ... 136 7e-31
gi|23009399|ref|ZP_00050461.1| COG0224: F0F1-type ATP synthase, ... 135 1e-30
gi|39995223|ref|NP_951174.1| ATP synthase F1, gamma subunit [Geo... 134 2e-30
gi|15889878|ref|NP_355559.1| AGR_C_4756p [Agrobacterium tumefaci... 132 8e-30
gi|13473457|ref|NP_105024.1| ATP synthase gamma subunit [Mesorhi... 132 1e-29
gi|45916915|ref|ZP_00197679.1| COG0224: F0F1-type ATP synthase, ... 132 1e-29
gi|22958764|ref|ZP_00006428.1| COG0224: F0F1-type ATP synthase, ... 131 2e-29
gi|2493032|sp|P72246|ATPG_RHOCA ATP synthase gamma chain >gnl|BL... 129 7e-29
gi|27375552|ref|NP_767081.1| ATP synthase gamma chain [Bradyrhiz... 129 1e-28
gi|39933254|ref|NP_945530.1| putative H+-transporting ATP syntha... 128 2e-28
gi|46308381|ref|ZP_00210574.1| COG0224: F0F1-type ATP synthase, ... 127 3e-28
gi|15966788|ref|NP_387141.1| PROBABLE ATP SYNTHASE GAMMA CHAIN P... 125 1e-27
gi|16127678|ref|NP_422242.1| ATP synthase F1, gamma subunit [Cau... 125 2e-27
gi|48833096|ref|ZP_00290120.1| COG0224: F0F1-type ATP synthase, ... 125 2e-27
gi|48844975|ref|ZP_00299267.1| COG0224: F0F1-type ATP synthase, ... 120 3e-26
gi|30248229|ref|NP_840299.1| ATP synthase gamma subunit [Nitroso... 120 3e-26
gi|34556937|ref|NP_906752.1| ATP SYNTHASE F1 GAMMA SUBUNIT [Woli... 120 3e-26
gi|15604634|ref|NP_221152.1| ATP SYNTHASE GAMMA CHAIN (atpG) [R... 119 7e-26
gi|49474711|ref|YP_032753.1| ATP synthase gamma chain [Bartonell... 119 9e-26
gi|231609|sp|P29710|ATPG_PROMO ATP synthase gamma chain, sodium ... 119 9e-26
gi|21230028|ref|NP_635945.1| ATP synthase gamma chain [Xanthomon... 119 9e-26
gi|23502653|ref|NP_698780.1| ATP synthase F1, gamma subunit [Bru... 118 2e-25
gi|21244375|ref|NP_643957.1| ATP synthase gamma chain [Xanthomon... 118 2e-25
gi|17986534|ref|NP_539168.1| ATP SYNTHASE GAMMA CHAIN [Brucella ... 117 3e-25
gi|21397778|ref|NP_653763.1| ATP-synt, ATP synthase [Bacillus an... 117 3e-25
gi|49235185|ref|ZP_00329258.1| COG0224: F0F1-type ATP synthase, ... 116 8e-25
gi|49476188|ref|YP_034229.1| ATP synthase gamma chain [Bartonell... 115 1e-24
gi|17548035|ref|NP_521437.1| PROBABLE ATP SYNTHASE GAMMA CHAIN P... 114 2e-24
gi|41725902|ref|ZP_00152660.1| COG0224: F0F1-type ATP synthase, ... 114 3e-24
gi|15612126|ref|NP_223778.1| ATP synthase F1, subunit gamma [Hel... 114 3e-24
gi|15896120|ref|NP_349469.1| FoF1-type ATP synthase gamma subuni... 114 3e-24
gi|47573981|ref|ZP_00244018.1| COG0224: F0F1-type ATP synthase, ... 114 4e-24
gi|15645747|ref|NP_207924.1| ATP synthase F1, subunit gamma (atp... 114 4e-24
gi|18146850|dbj|BAB82483.1| F0F1-ATPase subunit gamma [Colwellia... 113 5e-24
gi|22993592|ref|ZP_00038163.1| COG0224: F0F1-type ATP synthase, ... 113 5e-24
gi|15837746|ref|NP_298434.1| ATP synthase, gamma chain [Xylella ... 113 7e-24
gi|23114961|ref|ZP_00100238.1| COG0224: F0F1-type ATP synthase, ... 112 1e-23
gi|50801410|ref|XP_424169.1| PREDICTED: similar to Atp5c1-prov p... 111 2e-23
gi|23476032|ref|ZP_00131268.1| COG0224: F0F1-type ATP synthase, ... 111 3e-23
gi|1929512|gb|AAB51465.1| ATP synthase subunit gamma 111 3e-23
gi|42525219|ref|NP_970599.1| ATP synthase gamma chain [Bdellovib... 111 3e-23
gi|2662065|dbj|BAA23687.1| proton-translocating ATPase, gamma su... 110 3e-23
gi|22266798|gb|AAM94912.1| subunit gamma [Ilyobacter tartaricus] 110 3e-23
gi|584816|sp|P37810|ATPG_BACSU ATP synthase gamma chain >gnl|BL_... 110 3e-23
gi|22997186|ref|ZP_00041421.1| COG0224: F0F1-type ATP synthase, ... 110 4e-23
gi|22970021|ref|ZP_00017192.1| hypothetical protein [Chloroflexu... 110 4e-23
gi|32265927|ref|NP_859959.1| FoF1-type ATP synthase [Helicobacte... 110 6e-23
gi|48771436|ref|ZP_00275778.1| COG0224: F0F1-type ATP synthase, ... 110 6e-23
gi|15893159|ref|NP_360873.1| ATP synthase gamma chain [EC:3.6.1.... 110 6e-23
gi|16080735|ref|NP_391563.1| ATP synthase (subunit gamma) [Bacil... 110 6e-23
gi|46915235|emb|CAG22008.1| putative ATP synthase F1, gamma subu... 109 7e-23
gi|34581171|ref|ZP_00142651.1| ATP synthase gamma chain [Rickett... 109 7e-23
gi|47569801|ref|ZP_00240472.1| ATP synthase F1, gamma subunit [B... 109 7e-23
gi|15616317|ref|NP_244622.1| ATP synthase gamma subunit [Bacillu... 108 1e-22
gi|28198345|ref|NP_778659.1| ATP synthase gamma chain [Xylella f... 108 2e-22
gi|21674842|ref|NP_662907.1| ATP synthase F1, gamma subunit [Chl... 108 2e-22
gi|23100431|ref|NP_693898.1| H(+)-transporting ATP synthase gamm... 108 2e-22
gi|37524073|ref|NP_927417.1| ATP synthase gamma chain [Photorhab... 108 2e-22
gi|114636|sp|P20602|ATPG_BACME ATP synthase gamma chain >gnl|BL_... 107 3e-22
gi|33594185|ref|NP_881829.1| ATP synthase gamma chain [Bordetell... 106 6e-22
gi|33603578|ref|NP_891138.1| ATP synthase gamma chain [Bordetell... 106 8e-22
gi|46915086|emb|CAG21861.1| Putative AtpG, ATP synthase F1, gamm... 106 8e-22
gi|33598627|ref|NP_886270.1| ATP synthase gamma chain [Bordetell... 105 1e-21
gi|33151291|ref|NP_872644.1| ATP synthase gamma chain [Haemophil... 104 2e-21
gi|15603358|ref|NP_246432.1| AtpG [Pasteurella multocida Pm70] >... 104 2e-21
gi|48781405|ref|ZP_00278027.1| COG0224: F0F1-type ATP synthase, ... 104 3e-21
gi|20807129|ref|NP_622300.1| F0F1-type ATP synthase gamma subuni... 104 3e-21
gi|48864614|ref|ZP_00318507.1| COG0224: F0F1-type ATP synthase, ... 104 3e-21
gi|24376220|ref|NP_720264.1| ATP synthase F1, gamma subunit [She... 104 3e-21
gi|23129578|ref|ZP_00111404.1| COG0224: F0F1-type ATP synthase, ... 103 4e-21
gi|18311170|ref|NP_563104.1| ATP synthase gamma subunit [Clostri... 103 4e-21
gi|14715605|gb|AAK72442.1| ATP synthase gamma subunit [Clostridi... 103 4e-21
gi|46312632|ref|ZP_00213227.1| COG0224: F0F1-type ATP synthase, ... 103 4e-21
gi|29655228|ref|NP_820920.1| ATP synthase, F1 gamma subunit [Cox... 103 4e-21
gi|1703746|sp|P50005|ATPG_ACEWO ATP synthase gamma chain, sodium... 103 5e-21
gi|14916965|sp|P22482|ATPG_BACPF ATP synthase gamma chain >gnl|B... 103 5e-21
gi|48855634|ref|ZP_00309792.1| COG0224: F0F1-type ATP synthase, ... 102 9e-21
gi|46579189|ref|YP_009997.1| ATP synthase, F1 gamma subunit [Des... 102 9e-21
gi|26992089|ref|NP_747514.1| ATP synthase F1, gamma subunit [Pse... 102 9e-21
gi|33329386|gb|AAQ10089.1| ATP synthase subunit gamma [Bacillus ... 102 9e-21
gi|34763443|ref|ZP_00144390.1| ATP synthase gamma chain, sodium ... 102 9e-21
gi|37776901|emb|CAD23143.1| H+-transporting ATP synthase [Oryza ... 102 1e-20
gi|6478262|gb|AAF13778.1| gamma subunit of membrane-bound ATP sy... 102 1e-20
gi|32034347|ref|ZP_00134547.1| COG0224: F0F1-type ATP synthase, ... 102 1e-20
gi|114647|sp|P12990|ATPG_VIBAL ATP synthase gamma chain >gnl|BL_... 102 1e-20
gi|148138|gb|AAA24736.1| ATP synthase gamma subunit (atp-7) 102 2e-20
gi|15600748|ref|NP_254242.1| ATP synthase gamma chain [Pseudomon... 102 2e-20
gi|27364453|ref|NP_759981.1| ATP synthase F1, gamma subunit [Vib... 102 2e-20
gi|16767150|ref|NP_462765.1| F1-F0-type proton-ATPase subunit ga... 101 2e-20
gi|28899844|ref|NP_799449.1| ATP synthase F1, gamma subunit [Vib... 101 2e-20
gi|23469340|ref|ZP_00124674.1| COG0224: F0F1-type ATP synthase, ... 101 3e-20
gi|46320832|ref|ZP_00221215.1| COG0224: F0F1-type ATP synthase, ... 101 3e-20
gi|728932|sp|P41169|ATPG_THIFE ATP synthase gamma chain >gnl|BL_... 100 3e-20
gi|114646|sp|P09222|ATPG_BACP3 ATP synthase gamma chain precurso... 100 3e-20
gi|28872699|ref|NP_795318.1| ATP synthase F1, gamma subunit [Pse... 100 3e-20
gi|48891819|ref|ZP_00325268.1| COG0224: F0F1-type ATP synthase, ... 100 3e-20
gi|1333799|emb|CAA30654.1| unnamed protein product [thermophilic... 100 3e-20
gi|15791494|ref|NP_281317.1| ATP synthase F1 sector gamma subuni... 100 4e-20
gi|15804333|ref|NP_290372.1| membrane-bound ATP synthase, F1 sec... 100 4e-20
gi|15642758|ref|NP_232391.1| ATP synthase F1, gamma subunit [Vib... 100 4e-20
gi|33865031|ref|NP_896590.1| ATP synthase subunit gamma [Synecho... 100 4e-20
gi|46439650|gb|EAK98965.1| hypothetical protein CaO19.3223 [Cand... 100 4e-20
gi|50875722|emb|CAG35562.1| probable ATP synthase, gamma chain (... 100 6e-20
gi|19703701|ref|NP_603263.1| ATP synthase gamma chain, sodium io... 100 8e-20
gi|80098|pir||S17725 H+-transporting two-sector ATPase (EC 3.6.3... 100 8e-20
gi|24298789|dbj|BAC22104.1| F-ATPase gamma-subunit [Thermotoga n... 100 8e-20
gi|50123429|ref|YP_052596.1| ATP synthase gamma chain [Erwinia c... 99 1e-19
gi|46141708|ref|ZP_00147061.2| COG0224: F0F1-type ATP synthase, ... 99 1e-19
gi|79755|pir||H31090 H+-transporting two-sector ATPase (EC 3.6.3... 99 1e-19
gi|16272427|ref|NP_438640.1| ATP synthase F1 subunit gamma [Haem... 99 1e-19
gi|17227500|ref|NP_484048.1| ATP synthase subunit gamma [Nostoc ... 99 2e-19
gi|6625702|gb|AAF19361.1| ATP synthase subunit gamma [Salmonella... 99 2e-19
gi|42521030|ref|NP_966945.1| ATP synthase F1, gamma subunit [Wol... 99 2e-19
gi|16762460|ref|NP_458077.1| ATP synthase gamma subunit [Salmone... 98 2e-19
gi|48860213|ref|ZP_00314139.1| COG0224: F0F1-type ATP synthase, ... 98 2e-19
gi|27468619|ref|NP_765256.1| ATP synthase gamma chain [Staphyloc... 98 2e-19
gi|22297928|ref|NP_681175.1| H+-transporting ATP synthase gamma ... 98 3e-19
gi|48731318|ref|ZP_00265063.1| COG0224: F0F1-type ATP synthase, ... 98 3e-19
gi|16124230|ref|NP_407543.1| ATP synthase gamma subunit protein ... 98 3e-19
gi|21672301|ref|NP_660368.1| ATP synthase gamma chain [Buchnera ... 98 3e-19
gi|7436157|pir||T06998 probable H+-transporting two-sector ATPas... 98 3e-19
gi|15793516|ref|NP_283338.1| ATP synthase gamma chain [Neisseria... 97 4e-19
gi|1168595|sp|P42007|ATPG_BACST ATP synthase gamma chain >gnl|BL... 97 5e-19
gi|48868416|ref|ZP_00321753.1| COG0224: F0F1-type ATP synthase, ... 97 5e-19
gi|34496126|ref|NP_900341.1| H+-transporting two-sector ATPase, ... 97 5e-19
gi|23104634|ref|ZP_00091096.1| COG0224: F0F1-type ATP synthase, ... 97 6e-19
gi|15677765|ref|NP_274929.1| ATP synthase F1, gamma subunit [Nei... 97 6e-19
gi|15607016|ref|NP_214398.1| ATP synthase F1 gamma subunit [Aqui... 97 6e-19
gi|6478270|gb|AAF13784.1| gamma subunit of membrane-bound ATP sy... 97 6e-19
gi|728930|sp|P41010|ATPG_BACCA ATP synthase gamma chain >gnl|BL_... 96 8e-19
gi|23467975|ref|ZP_00123550.1| COG0224: F0F1-type ATP synthase, ... 96 8e-19
gi|33241052|ref|NP_875994.1| ATP synthase gamma chain [Prochloro... 96 8e-19
gi|46366076|ref|ZP_00228480.1| COG0224: F0F1-type ATP synthase, ... 96 1e-18
gi|32028587|ref|ZP_00131743.1| COG0224: F0F1-type ATP synthase, ... 96 1e-18
gi|50083468|ref|YP_044978.1| membrane-bound ATP synthase , F1 se... 96 1e-18
gi|15616637|ref|NP_239849.1| ATP synthase gamma chain [Buchnera ... 96 1e-18
gi|41408550|ref|NP_961386.1| AtpG [Mycobacterium avium subsp. pa... 95 2e-18
gi|32490756|ref|NP_871010.1| atpG [Wigglesworthia glossinidia en... 95 2e-18
gi|33862006|ref|NP_893567.1| ATP synthase gamma subunit [Prochlo... 95 2e-18
gi|114644|sp|P08450|ATPG_SYNP6 ATP synthase gamma chain >gnl|BL_... 95 2e-18
gi|15608449|ref|NP_215825.1| atpG [Mycobacterium tuberculosis H3... 94 3e-18
gi|45528415|ref|ZP_00179614.1| COG0224: F0F1-type ATP synthase, ... 94 3e-18
gi|50364929|ref|YP_053354.1| ATP synthase gamma chain [Mesoplasm... 94 4e-18
gi|16329326|ref|NP_440054.1| ATP synthase g subunit [Synechocyst... 94 4e-18
gi|15644359|ref|NP_229411.1| ATP synthase F1, subunit gamma [The... 94 4e-18
gi|461582|sp|Q05384|ATPG_SYNP1 ATP synthase gamma chain >gnl|BL_... 93 7e-18
gi|26553513|ref|NP_757447.1| ATP synthase subunit gamma [Mycopla... 92 1e-17
gi|15673747|ref|NP_267921.1| ATP synthase gamma subunit [Lactoco... 92 1e-17
gi|37523884|ref|NP_927261.1| ATP synthase gamma chain [Gloeobact... 92 2e-17
gi|15827575|ref|NP_301838.1| ATP synthase [gamma] chain [Mycobac... 92 2e-17
gi|46447303|ref|YP_008668.1| putative H+-transporting two-sector... 92 2e-17
gi|33863733|ref|NP_895293.1| ATP synthase gamma subunit [Prochlo... 92 2e-17
gi|543876|sp|Q06908|ATPG_ODOSI ATP synthase gamma chain, chlorop... 91 3e-17
gi|16801735|ref|NP_472003.1| highly similar to H+-transporting A... 91 3e-17
gi|23023846|ref|ZP_00063075.1| COG0224: F0F1-type ATP synthase, ... 91 3e-17
gi|15925094|ref|NP_372628.1| ATP synthase gamma chain [Staphyloc... 91 5e-17
gi|1703748|sp|P50006|ATPG_SPIPL ATP synthase gamma chain >gnl|BL... 90 8e-17
gi|421743|pir||S32401 H+-transporting two-sector ATPase (EC 3.6.... 89 1e-16
gi|228698|prf||1808328A CF1 ATP synthase:SUBUNIT=gamma 89 1e-16
gi|4100656|gb|AAD00917.1| proton-translocating ATPase gamma subu... 89 1e-16
gi|47459044|ref|YP_015906.1| ATP synthase gamma chain [Mycoplasm... 88 2e-16
gi|11466190|ref|NP_066513.1| ATP synthase F1 subunit gamma [Naeg... 88 3e-16
gi|42284|emb|CAA23597.1| unnamed protein product [Escherichia coli] 87 4e-16
gi|27904520|ref|NP_777646.1| ATP synthase gamma chain [Buchnera ... 87 5e-16
gi|42561404|ref|NP_975855.1| ATP SYNTHASE GAMMA CHAIN [Mycoplasm... 87 5e-16
gi|114638|sp|P12113|ATPG_CHLRE ATP synthase gamma chain, chlorop... 87 7e-16
gi|20070092|gb|AAM01189.1| H+-ATPase cytoplasmic F1-part gamma-s... 87 7e-16
gi|29377094|ref|NP_816248.1| ATP synthase F1, gamma subunit [Ent... 87 7e-16
gi|15828738|ref|NP_326098.1| ATP SYNTHASE GAMMA CHAIN [Mycoplasm... 86 9e-16
gi|15901356|ref|NP_345960.1| ATP synthase F1, gamma subunit [Str... 86 1e-15
gi|231610|sp|P29790|ATPG_TOBAC ATP synthase gamma chain, chlorop... 84 3e-15
gi|33519490|ref|NP_878322.1| ATP synthase gamma subunit [Candida... 84 3e-15
gi|28565375|gb|AAO43198.1| chloroplast ATPase gamma subunit prec... 84 4e-15
gi|6048352|gb|AAF02207.1| H+-ATPase cytoplasmic F1-part gamma-su... 84 4e-15
gi|282596|pir||S24338 H+-transporting two-sector ATPase (EC 3.6.... 84 4e-15
gi|31544509|ref|NP_853087.1| AtpG [Mycoplasma gallisepticum R] >... 84 6e-15
gi|46439651|gb|EAK98966.1| hypothetical protein CaO19.3224 [Cand... 83 1e-14
gi|22537025|ref|NP_687876.1| ATP synthase F1, gamma subunit [Str... 83 1e-14
gi|6478266|gb|AAF13781.1| gamma subunit of membrane-bound ATP sy... 82 2e-14
gi|25010935|ref|NP_735330.1| H+-transporting ATP synthase gamma ... 82 2e-14
gi|18412632|ref|NP_567265.1| ATP synthase gamma chain 1, chlorop... 81 3e-14
gi|2493034|sp|Q41075|ATPG_PHATR ATP synthase gamma chain, chloro... 80 5e-14
gi|2662325|dbj|BAA23754.1| proton-translocating ATPase, gamma su... 80 5e-14
gi|32476316|ref|NP_869310.1| ATP synthase gamma subunit [Pirellu... 80 5e-14
gi|6652832|gb|AAF22497.1| F1F0-ATPase subunit gamma [Lactobacill... 80 8e-14
gi|28378939|ref|NP_785831.1| H(+)-transporting two-sector ATPase... 80 8e-14
gi|32307462|gb|AAP79136.1| ATP synthase gamma subunit [Bigelowie... 80 8e-14
gi|15674807|ref|NP_268981.1| putative proton-translocating ATPas... 79 1e-13
gi|21910034|ref|NP_664302.1| putative proton-translocating ATPas... 79 1e-13
gi|48824469|ref|ZP_00285843.1| COG0224: F0F1-type ATP synthase, ... 79 2e-13
gi|24379918|ref|NP_721873.1| FoF1 membrane-bound proton-transloc... 79 2e-13
gi|29346129|ref|NP_809632.1| ATP synthase gamma chain [Bacteroid... 79 2e-13
gi|1168596|sp|P43452|ATPG_ENTHR ATP synthase gamma chain >gnl|BL... 78 2e-13
gi|15218281|ref|NP_173022.1| ATP synthase gamma chain 2, chlorop... 78 2e-13
gi|7436160|pir||JC5740 membrane-bound proton-translocating ATPas... 78 3e-13
gi|10039451|dbj|BAB13359.1| H+-ATPase gamma subunit [Brevibacter... 78 3e-13
gi|19552434|ref|NP_600436.1| F0F1-type ATP synthase gamma subuni... 78 3e-13
gi|50591373|ref|ZP_00332687.1| COG0224: F0F1-type ATP synthase, ... 77 4e-13
gi|12045262|ref|NP_073073.1| ATP synthase F1, subunit gamma (atp... 77 4e-13
gi|38087220|ref|XP_111973.3| similar to expressed sequence AW011... 77 5e-13
gi|21636588|gb|AAM70051.1| ATP synthase gamma subunit 1 [Sus scr... 77 5e-13
gi|50842720|ref|YP_055947.1| ATP synthase gamma chain [Propionib... 77 5e-13
gi|1703749|sp|P50007|ATPG_STRLI ATP synthase gamma chain >gnl|BL... 77 5e-13
gi|21684963|emb|CAD22546.1| F1F0-ATPase subunit gamma [Oenococcu... 77 5e-13
gi|755801|emb|CAA68727.1| ATP synthase [Spinacia oleracea] 77 5e-13
gi|114643|sp|P05435|ATPG_SPIOL ATP synthase gamma chain, chlorop... 77 5e-13
gi|48836977|ref|ZP_00293972.1| COG0224: F0F1-type ATP synthase, ... 77 7e-13
gi|29829424|ref|NP_824058.1| putative ATP synthase gamma chain [... 77 7e-13
gi|21223732|ref|NP_629511.1| ATP synthase gamma chain [Streptomy... 77 7e-13
gi|46321713|ref|ZP_00222088.1| COG0224: F0F1-type ATP synthase, ... 77 7e-13
gi|114640|sp|P28552|ATPG_PEA ATP synthase gamma chain, chloropla... 75 2e-12
gi|45657125|ref|YP_001211.1| ATP synthase gamma chain [Leptospir... 75 3e-12
gi|13508338|ref|NP_110288.1| ATP synthase gamma chain [Mycoplasm... 74 4e-12
gi|45593085|gb|AAS68129.1| ATP synthase gamma subunit [Bifidobac... 74 6e-12
gi|45515670|ref|ZP_00167224.1| COG0224: F0F1-type ATP synthase, ... 73 8e-12
gi|48871161|ref|ZP_00323877.1| COG0224: F0F1-type ATP synthase, ... 73 1e-11
gi|42518864|ref|NP_964794.1| ATP synthase gamma chain [Lactobaci... 73 1e-11
gi|27818005|dbj|BAC55768.1| putative ATP synthase gamma chain 1,... 72 1e-11
gi|45520811|ref|ZP_00172336.1| COG0224: F0F1-type ATP synthase, ... 72 1e-11
gi|23336547|ref|ZP_00121759.1| COG0224: F0F1-type ATP synthase, ... 72 1e-11
gi|45593079|gb|AAS68124.1| ATP synthase gamma subunit [Bifidobac... 72 2e-11
gi|23002569|ref|ZP_00046244.1| COG0224: F0F1-type ATP synthase, ... 71 3e-11
gi|38233645|ref|NP_939412.1| ATP synthase gamma chain [Corynebac... 71 4e-11
gi|45531241|ref|ZP_00182302.1| COG0224: F0F1-type ATP synthase, ... 70 5e-11
gi|5708095|emb|CAB52365.1| ATP synthase gamma chain, chloroplast... 70 6e-11
gi|25027870|ref|NP_737924.1| H+-ATPase gamma subunit [Corynebact... 67 5e-10
gi|32043130|ref|ZP_00140392.1| COG0224: F0F1-type ATP synthase, ... 67 7e-10
gi|5811567|dbj|BAA83612.1| F1F0-ATPase gamma subunit [Desulfovib... 66 9e-10
gi|24215477|ref|NP_712958.1| ATP synthase F1, gamma subunit [Lep... 66 9e-10
gi|7530124|emb|CAB86705.1| hypothetical protein L3640.10 [Leishm... 65 2e-09
gi|13357687|ref|NP_077961.1| ATP synthase gamma chain [Ureaplasm... 64 4e-09
gi|48839593|ref|ZP_00296524.1| COG0224: F0F1-type ATP synthase, ... 64 6e-09
gi|45512007|ref|ZP_00163574.1| COG0224: F0F1-type ATP synthase, ... 63 8e-09
gi|42630774|ref|ZP_00156313.1| COG0224: F0F1-type ATP synthase, ... 62 2e-08
gi|42629934|ref|ZP_00155479.1| COG0224: F0F1-type ATP synthase, ... 62 2e-08
gi|23116279|ref|ZP_00100917.1| COG0224: F0F1-type ATP synthase, ... 62 2e-08
gi|23025252|ref|ZP_00064400.1| COG0224: F0F1-type ATP synthase, ... 62 2e-08
gi|14193338|gb|AAK55914.1| ATP synthase gamma subunit [Candidatu... 61 3e-08
gi|28493392|ref|NP_787553.1| ATP synthase gamma chain [Tropherym... 60 5e-08
gi|14193274|gb|AAK55866.1| ATP synthase gamma subunit [Candidatu... 60 7e-08
gi|6478836|dbj|BAA87181.1| ATP synthase gamma chain [Schizosacch... 60 9e-08
gi|46105928|ref|ZP_00186330.2| COG0224: F0F1-type ATP synthase, ... 60 9e-08
gi|16802139|ref|NP_463624.1| similar to ATP synthase gamma chain... 60 9e-08
gi|46906330|ref|YP_012719.1| ATP synthase F1, gamma subunit, put... 60 9e-08
gi|14193330|gb|AAK55908.1| ATP synthase gamma subunit [Candidatu... 59 1e-07
gi|14193270|gb|AAK55863.1| ATP synthase gamma subunit [Candidatu... 59 2e-07
gi|29422125|gb|AAO84482.1| ATP synthase F1 complex gamma chain [... 58 3e-07
gi|20091264|ref|NP_617339.1| H(+)-transporting ATP synthase, sub... 57 4e-07
gi|14193306|gb|AAK55890.1| ATP synthase gamma subunit [Candidatu... 57 6e-07
gi|14028607|gb|AAK52427.1| ATP synthase gamma-subunit [Candidatu... 57 7e-07
gi|14193334|gb|AAK55911.1| ATP synthase gamma subunit [Candidatu... 57 7e-07
gi|14193310|gb|AAK55893.1| ATP synthase gamma subunit [Candidatu... 56 1e-06
gi|14193258|gb|AAK55854.1| ATP synthase gamma subunit [Candidatu... 56 1e-06
gi|1304066|dbj|BAA12666.1| proton ATPase gamma subunit [Desulfov... 55 2e-06
gi|14028611|gb|AAK52430.1| ATP synthase gamma-subunit [Candidatu... 55 3e-06
gi|45509543|ref|ZP_00161877.1| COG0224: F0F1-type ATP synthase, ... 54 4e-06
gi|14193298|gb|AAK55884.1| ATP synthase gamma subunit [Candidatu... 54 4e-06
gi|13272347|gb|AAK17110.1| ATP synthase gamma subunit [Candidatu... 54 4e-06
gi|14193286|gb|AAK55875.1| ATP synthase gamma subunit [Candidatu... 54 4e-06
gi|14193342|gb|AAK55917.1| ATP synthase gamma subunit [Candidatu... 54 4e-06
gi|2605828|gb|AAC38058.1| ATP synthase gamma subunit C-terminus ... 54 5e-06
gi|14193358|gb|AAK55929.1| ATP synthase gamma subunit [Candidatu... 54 6e-06
gi|14193318|gb|AAK55899.1| ATP synthase gamma subunit [Candidatu... 54 6e-06
gi|14193302|gb|AAK55887.1| ATP synthase gamma subunit [Candidatu... 53 1e-05
gi|16799214|ref|NP_469482.1| similar to ATP synthase gamma chain... 53 1e-05
gi|14193254|gb|AAK55851.1| ATP synthase gamma subunit [Candidatu... 52 1e-05
gi|45546237|ref|ZP_00186331.1| COG0224: F0F1-type ATP synthase, ... 52 2e-05
gi|4102866|gb|AAD01607.1| F1-ATPase gamma-subunit [Paracoccus de... 52 2e-05
gi|4633071|gb|AAD26614.1| F1-ATP synthase gamma subunit [Rhodoba... 51 4e-05
gi|14193262|gb|AAK55857.1| ATP synthase gamma subunit [Candidatu... 50 5e-05
gi|14278249|pdb|1FS0|G Chain G, Complex Of GammaEPSILON ATP SYNT... 50 5e-05
gi|14193282|gb|AAK55872.1| ATP synthase gamma subunit [Candidatu... 50 7e-05
gi|14193314|gb|AAK55896.1| ATP synthase gamma subunit [Candidatu... 50 7e-05
gi|42454278|ref|ZP_00154185.1| hypothetical protein Rick117101 [... 49 1e-04
gi|14193266|gb|AAK55860.1| ATP synthase gamma subunit [Candidatu... 49 2e-04
gi|14193322|gb|AAK55902.1| ATP synthase gamma subunit [Candidatu... 46 0.001
gi|14193354|gb|AAK55926.1| ATP synthase gamma subunit [Candidatu... 45 0.002
gi|23025253|ref|ZP_00064401.1| COG0224: F0F1-type ATP synthase, ... 44 0.006
gi|14193362|gb|AAK55932.1| ATP synthase gamma subunit [Candidatu... 42 0.024
gi|48865199|ref|ZP_00319062.1| COG0224: F0F1-type ATP synthase, ... 41 0.042
gi|50874959|emb|CAG34799.1| hypothetical protein [Desulfotalea p... 40 0.071
gi|47059614|gb|AAT09436.1| putative ATP synthase gamma chain [Py... 39 0.21
gi|33772256|gb|AAQ54563.1| putative ATP synthase gamma chain [Ma... 39 0.21
gi|30678740|ref|NP_567189.2| expressed protein [Arabidopsis thal... 36 1.0
gi|7485290|pir||T01566 hypothetical protein A_TM018A10.23 - Arab... 36 1.0
gi|148147|gb|AAA24742.1| H+-ATPase gamma subunit (uncG) 36 1.0
gi|34223562|gb|AAG01230.2| cellulosomal scaffoldin precursor [Ba... 36 1.3
gi|32450643|gb|AAH54305.1| LOC398627 protein [Xenopus laevis] 34 3.9
gi|30060741|gb|AAP19746.1| ATP synthase F1 epsilon subunit [Haem... 34 5.1
gi|30060765|gb|AAP19758.1| ATP synthase F1 epsilon subunit [Haem... 34 5.1
gi|30060735|gb|AAP19743.1| ATP synthase F1 epsilon subunit [Haem... 34 5.1
gi|30060737|gb|AAP19744.1| ATP synthase F1 epsilon subunit [Haem... 34 5.1
gi|30060757|gb|AAP19754.1| ATP synthase F1 epsilon subunit [Haem... 34 5.1
gi|30060771|gb|AAP19761.1| ATP synthase F1 epsilon subunit [Haem... 34 5.1
gi|40792792|gb|AAR90362.1| SidH [Legionella pneumophila] 33 6.6
gi|30060761|gb|AAP19756.1| ATP synthase F1 epsilon subunit [Haem... 33 6.6
gi|30060733|gb|AAP19742.1| ATP synthase F1 epsilon subunit [Haem... 33 6.6
gi|30060739|gb|AAP19745.1| ATP synthase F1 epsilon subunit [Haem... 33 6.6
gi|111752|pir||A33160 H+-transporting two-sector ATPase (EC 3.6.... 33 6.6
gi|39584925|emb|CAE64349.1| Hypothetical protein CBG09036 [Caeno... 33 6.6
gi|50260251|gb|EAL22910.1| hypothetical protein CNBA6790 [Crypto... 33 6.6
gi|442632|pdb|1ALA| Annexin V 33 6.6
gi|48847750|ref|ZP_00301999.1| hypothetical protein Saro02003633... 33 8.7
gi|30060749|gb|AAP19750.1| ATP synthase F1 epsilon subunit [Haem... 33 8.7
gi|29469225|gb|AAO65338.1| unknown [Streptomyces murayamaensis] 33 8.7
gi|116775|sp|P03136|COAT_PAVHH Coat protein VP1 [Contains: Coat ... 33 8.7
gi|50746875|ref|XP_426323.1| PREDICTED: similar to annexin V - c... 33 8.7
gi|4097010|gb|AAD00028.1| ATP synthase gamma-subunit [Mus musculus] 33 8.7
gi|1351941|sp|P17153|ANX5_CHICK Annexin A5 (Annexin V) (Lipocort... 33 8.7
>gi|17544026|ref|NP_500214.1| ATP synthase mitochondrial (32.4 kD)
(4D261) [Caenorhabditis elegans]
gi|14574453|gb|AAK68562.1| Hypothetical protein Y69A2AR.18a
[Caenorhabditis elegans]
Length = 299
Score = 538 bits (1387), Expect = e-152
Identities = 285/299 (95%), Positives = 285/299 (95%)
Frame = +1
Query: 1 MLRQGAGTLQLVSQGFANAEQARGFATLKDISIRLKSVKNIQKITXXXXXXXXXXXXXXE 180
MLRQGAGTLQLVSQGFANAEQARGFATLKDISIRLKSVKNIQKIT E
Sbjct: 1 MLRQGAGTLQLVSQGFANAEQARGFATLKDISIRLKSVKNIQKITKSMKMVAAAKYAKAE 60
Query: 181 RELKGARAYGVGAKTFFDNIDPVVEGVEKQESKKQVLVLITSDRGLCGGVHSSIVKEAKN 360
RELKGARAYGVGAKTFFDNIDPVVEGVEKQESKKQVLVLITSDRGLCGGVHSSIVKEAKN
Sbjct: 61 RELKGARAYGVGAKTFFDNIDPVVEGVEKQESKKQVLVLITSDRGLCGGVHSSIVKEAKN 120
Query: 361 ILNNAGDKEIRVVAIGDKSRAGLQRLYANSILLSGNEIGRAPPSFADASIAAKAILDSGY 540
ILNNAGDKEIRVVAIGDKSRAGLQRLYANSILLSGNEIGRAPPSFADASIAAKAILDSGY
Sbjct: 121 ILNNAGDKEIRVVAIGDKSRAGLQRLYANSILLSGNEIGRAPPSFADASIAAKAILDSGY 180
Query: 541 DFETGTILFNRFKTVVSYETSKLQILPLEAIKAKEALSTYDSVDDDVLQSYSEYSLAQLI 720
DFETGTILFNRFKTVVSYETSKLQILPLEAIKAKEALSTYDSVDDDVLQSYSEYSLAQLI
Sbjct: 181 DFETGTILFNRFKTVVSYETSKLQILPLEAIKAKEALSTYDSVDDDVLQSYSEYSLAQLI 240
Query: 721 YYGMKESATSEQSSRMTAMDGASKNAGEMIDKLTLAFNRTRQAVITRELIEIISGAACV 897
YYGMKESATSEQSSRMTAMDGASKNAGEMIDKLTLAFNRTRQAVITRELIEIISGAACV
Sbjct: 241 YYGMKESATSEQSSRMTAMDGASKNAGEMIDKLTLAFNRTRQAVITRELIEIISGAACV 299